4R2EA

Wilms tumor protein (wt1) zinc fingers in complex with methylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2eA00
1ZR9A 4R2PA 4R2QA 1A1IA 2EM4A 2PRTA 2EOOA 1ZAAC 2EMZA 4R2AA 2DLKA 2EN2A 2YTFA 3VHTB 1YSAC 2EOEA 2EM9A 2EPXA 3M99B 1BB8A 4R2CA 3EPLA 1LLMC 2ADRA 2GLIA 4R2RA 2EN1A 1P47A 4WSGA 4X9JA 2EOIA 2YTJA 2EMCA 1X6FA 1JK2A 2MKNA 2YTGA 2YSOA 2YTEA 1F2IG 1Z1BA 2EM8A 2WBSA 1ZU1A 4R2EA 2EM5A 2NABA 2M9AA 2EMIA 4R2DA 2EM7A 2MKDA 1X5WA 2ELZA 2D9HA 2VRDA 1G2DC 2EOQA 2DLQA 2I13A 2EMKA 2YTNA 4IJDA 2EOFA 2EPZA 2LO3A 2YTIA 5KL5A 5KL4A 2DGCA 2EOXA 2EM3A 1A1KA 2EN4A 1NCSA 1YUJA 5KL2A 2EOZA 2EN7A 2EJ4A 2EMLA 2RSIA 2EOYA 2YRKA 2LVHA 3EPHA 2YU8A 2EORA 5KL7A 2YSPA 1X6EA 1A1FA 1TF6A 1BBOA 1A1HA 2EQ3A 1A1GA 1WJPA 1UN6B 2EMGA 2EOMA 4IS1C 2ENCA 1TN9A 1AAYA 3EPJA 2EM2A 2GHFA 2EPAA 2YRHA 1RMDA 2JPAA 2JP9A 4F2JC 4M9VC 2EMXA 2YTPA 2EPPA 3UK3C 2YTQA 5KL6A 1KJKA 2CT1A 1X6HA 2EMFA 2EQ0A 2R1FA 4GZNC 2EMBA 2HGHA 2WBUA 2EOHA 2WBTA 4F6NA 2LCEA 1A1JA 2EL5A 2EPRA 2EOJA 2ENHA 2LT7A 1G2FC 2BB8A 2CTDA 2EN8A 4R2SA 1A1LA 1JK1A 1TF3A 2EM0A 2EN6A 5KL3A 2EP3A 2EQ1A 2MDGA 2EPUA 2YTDA 2EL4A 3MHHC 4FK5C 4F6MA 1MEYC 1YUIA 2DRPA 2EMHA 2ENAA 2EMYA 2YRMA 2ELYA 2EM6A 2EL6A 2EE8A 2YTOA 2EN3A 3MHSC 2EMWA 2J7JA 2E72A 2EOSA 2LV2A 2WCC3 2A25A 2EPCA 2YU5A 2CSHA 1DGCA 3EPKA 2RPCA 2EMAA 1B69A 1UBDC 2DMIA 1X3CA
chains in the Genus database with same CATH superfamily
4KWYA 2EM4A 1ZAAC 2L2MA 2EN2A 3KZZA 1DQ3A 2IHR1 4TUIA 1BB8A 1EKZA 3FIGA 1QNTA 2GLIA 1P47A 5F3WA 4JI2E 2K7IA 2YTGA 2M4IA 2L2NA 3H09A 3L00A 4R2EA 5T6JA 4KHPE 5AE1A 1T38A 3BF2A 2VRDA 2FV4B 2EOQA 2NUFA 1YYOA 4JV5E 1UHZA 2LO3A 4JI7E 3OMLA 3IWBA 2EN4A 1NCSA 1N33E 1YUJA 5KL2A 2EN7A 1HNXE 4ZYEA 2EMLA 4WXDA 2RSIA 5IV8B 1L4SA 2EOYA 2YRKA 2YU8A 2YSPA 1A1FA 2LJHA 2LJUA 2YZTA 2EQ3A 1PJTA 4F54A 1A1GA 2EOMA 2ENCA 2EM2A 1RMDA 2JPAA 2JP9A 4M9VC 4M30A 3UK3C 4O4KA 4O24A 1FJGE 2YTQA 3HPZA 3J7AG 1UILA 4DUZE 1X6HA 5A6AA 4DV3E 2MDRA 1O0WA 4RHBB 2K4VA 1N34E 3ADGA 2LT7A 1X48A 1EH6A 4R2SA 1A1LA 4JI5E 1JK1A 1TF3A 1BBGA 3LLHA 2RS7A 2JYAA 2KHXA 2L92A 2ODRD 2EL4A 2JY9A 2YWQA 4FK5C 4BHBA 2CPNA 4F6MA 2ENAA 2B7VA 2LRSA 2V88A 2JOXA 1NEIA 3MHSC 4DR4E 3LMLA 4GEQB 4LFCE 4I8OA 2J7JA 2V89A 4GKJE 2WCC3 1IBKE 2GPIA 4LFAE 2F4VE 1DGCA 3KZYA 2EMAA 1B69A 1X3CA 1ZR9A 4R2QA 1A1IA 5IWAE 2L8TA 4LU9A 2EMZA 2L3CA 2DLKA 4ZYDA 2RQLA 1YSAC 2I9IA 2EM9A 2UXBE 1SFEA 3M99B 2EPKX 4R2CA 1LLMC 1IMUA 1J26A 1PJSA 2DMYA 4X9JA 3TQMA 2UUBE 2EOIA 3J80C 4L8NA 2MKNA 2YTEA 4JI8E 1F2IG 3J7Yp 2WBSA 4DR6E 2ZM6E 1ZU1A 3HXLA 2M9AA 4ZYGA 2G7HA 5FLXC 2DLQA 4Q28A 4F9BB 4B3ME 4IJDA 2DIXA 2EPZA 2B9DA 1GQEA 5A69A 2DGCA 2EM3A 1AH5A 2L3JA 4LF7E 2EOZA 2EJ4A 2KONA 4LF4E 1T4OA 1WHNA 3DF6A 1GZ6A 2EORA 4MLQA 3VK6A 4JI4E 2UXCE 2RTXA 2V8QB 3F6HA 2UUCE 4LF9E 4IS1C 4JI0E 1EH7A 4BHCA 3F6GA 2GHFA 1YFHA 4F2JC 2YTPA 1YPNA 5LMUE 3THNA 5IT9C 5KL6A 2BBGA 5TSEA 4O43A 4DV7E 2EMFA 2EQ0A 4GZNC 3ECRA 4F6NA 4WPYA 1T39A 4DV5E 4L5NC 4N4RB 2CTDA 2EN8A 1HR0E 5AC4A 4DR2E 2EM0A 2EP3A 2R76A 4NXME 4NZVA 2EPMX 4B3TE 2YT4A 2MDGA 3C6KA 4WXCA 3ADIA 2EPUA 4WX9A 2YTDA 3C6MA 3MHHC 3IWCA 2EPLX 2Q8UA 2EMYA 2ELYA 2NA2A 2EL6A 2YTOA 1XNQE 4NXNE 3AUZA 4DR1E 2E72A 1WXRA 2VF1A 4X64E 3OTOE 4JI3E 2EPCA 3BGHA 2RPCA 3JTZA 4R03A 2DMIA 4ZYHA 5AE2A 4R2PA 4F9AB 3KWRA 2EOOA 2B7TA 4DV4E 3ADLA 5A6BA 2MC6A 2NUEA 2YTFA 4K0KE 1QU6A 2LTSA 2VQFE 3EPLA 2ADRA 4R2RA 2EN1A 4BS9A 1WRJA 2YTJA 1JK2A 2EPNA 1ZBTA 2E1MA 1IQSA 4YY3E 1Z1BA 1GTKA 2EM8A 2EWLA 5AC5A 4DV6E 2NABA 4X66E 5A6KA 2EMIA 2WZOA 3VYYA 3AV0A 1STUA 2I13A 5A2QC 4HEIA 2UUAE 2YTNA 2EOFA 5KL5A 5KL4A 4WFTA 2EOXA 4F9CB 2VQEE 4X62E 4DR7E 2HJJA 2DSYA 4LF5E 3IWDA 3HPSA 4RH8A 3HQ1A 1PJQA 3VYXA 3EPHA 4O5GA 1X6EA 4NHRA 2E5LE 3QG5C 3BIDA 1TF6A 4P7DA 1WJPA 1UN6B 4JYAE 2N3HA 4LTYA 1AAYA 3ZOQB 5CFFE 3MSWA 4BCAA 2EMXA 2H36X 1EH8A 3HTXA 2CT1A 4BC9A 2EMBA 2EOHA 2WBTA 1T4NA 2LCEA 4M0VA 1MGTA 1KYQA 2EPRA 4DV2E 2V86A 1IBLE 1YYKA 2BB8A 3DJWA 3J81C 2EN6A 5KL3A 2RS6A 4OOGC 1HNWE 1YUIA 2DRPA 2EMHA 2JWOA 2L2KB 2LE2A 2RSMA 4B3SE 2EM6A 2EE8A 4DR5E 2EN3A 2L33A 4LF8E 2JOBA 4WSPA 5DNYA 3JAMC 2LV2A 4JI6E 4WYQB 1X49A 1ZBQA 1RQ0A 5IXMB 1XNRE 4JI1E 4KZSA 3THOB 5AE3A 3EPKA 1N32E 5BR8E 5LMNE 1UBDC 2N3GA 2JR1A 1T4LB 1IQOA 2PRTA 1XMOE 4YHHE 4DKKA 4R2AA 2EPOA 4M2ZA 4X8WA 4DV0E 3VHTB 1N3GA 4R8OA 2EOEA 4DUYE 2M7QA 2EPXA 4HTGA 4TUGA 4J8ZA 2V85A 3T1HE 2DB2A 4LF6E 4WSGA 2KOUA 2EMCA 1X6FA 2YSOA 4DR3E 2JVAA 3P1XA 2EM5A 2YPNA 5LL6R 4R2DA 1WHQA 2EM7A 2V87A 2MKDA 2D9HA 1X5WA 2ELZA 4BC7A 1G2DC 5A6BD 2EMKA 2LBSB 2YTIA 1PDAA 3C4TA 1X47A 4BBYA 2UXDE 2LTRA 1A1KA 2HC5A 2HHHE 2LVHA 1IBME 4OX9E 2UU9E 5KL7A 1BBOA 4X65E 1A1HA 1XMQE 2FTXB 2EMGA 1TN9A 3EPJA 2L6MA 2EPAA 2YRHA 5A6JA 2M1SA 4DV1E 2N8XA 2EPPA 1KJKA 1FKAE 2R1FA 2HGHA 1N36E 2WBUA 4AQYE 3ADJA 3C4BA 1A1JA 2EL5A 1HNZE 2EOJA 2ENHA 1G2FC 2V83A 5ADZA 2ODRC 2EQ1A 2F8BA 1J5EE 1SR9A 1DI2A 2B3TB 4LFBE 2FGGA 3BBGA 5LLQA 1MEYC 3EQ1A 2NUGA 2JXPA 2YRMA 1I94E 1YZ9A 2MC5A 4MLVA 2EMWA 2LUPB 2LMZA 4GKKE 4BMJA 2EOSA 4Q35B 2VE7C 2A25A 1RC7A 1PKPA 4DMIA 2YU5A 4B3RE 5AASA 2CSHA 2LUQA 3JU0A 3K6QA 3RMPA 2EZ6A 3T1YE 1YYWA 4P78A
chains in the Genus database with same CATH topology
1ZR9A 4R2PA 4R2QA 1A1IA 2EM4A 2PRTA 2EOOA 1ZAAC 2EMZA 4R2AA 2DLKA 2EN2A 2YTFA 3VHTB 1YSAC 2EOEA 2EM9A 2EPXA 3M99B 1BB8A 4R2CA 3EPLA 1LLMC 2ADRA 2GLIA 4R2RA 2EN1A 1P47A 4WSGA 4X9JA 2EOIA 2YTJA 2EMCA 1X6FA 1JK2A 2MKNA 2YTGA 2YSOA 2YTEA 1F2IG 1Z1BA 2EM8A 2WBSA 1ZU1A 4R2EA 2EM5A 2NABA 2M9AA 2EMIA 4R2DA 2EM7A 2MKDA 1X5WA 2ELZA 2D9HA 2VRDA 1G2DC 2EOQA 2DLQA 2I13A 2EMKA 2YTNA 4IJDA 2EOFA 2EPZA 2LO3A 2YTIA 5KL5A 5KL4A 2DGCA 2EOXA 2EM3A 1A1KA 2EN4A 1NCSA 1YUJA 5KL2A 2EOZA 2EN7A 2EJ4A 2EMLA 2RSIA 2EOYA 2YRKA 2LVHA 3EPHA 2YU8A 2EORA 5KL7A 2YSPA 1X6EA 1A1FA 1TF6A 1BBOA 1A1HA 2EQ3A 1A1GA 1WJPA 1UN6B 2EMGA 2EOMA 4IS1C 2ENCA 1TN9A 1AAYA 3EPJA 2EM2A 2GHFA 2EPAA 2YRHA 1RMDA 2JPAA 2JP9A 4F2JC 4M9VC 2EMXA 2YTPA 2EPPA 3UK3C 2YTQA 5KL6A 1KJKA 2CT1A 1X6HA 2EMFA 2EQ0A 2R1FA 4GZNC 2EMBA 2HGHA 2WBUA 2EOHA 2WBTA 4F6NA 2LCEA 1A1JA 2EL5A 2EPRA 2EOJA 2ENHA 2LT7A 1G2FC 2BB8A 2CTDA 2EN8A 4R2SA 1A1LA 1JK1A 1TF3A 2EM0A 2EN6A 5KL3A 2EP3A 2EQ1A 2MDGA 2EPUA 2YTDA 2EL4A 3MHHC 4FK5C 4F6MA 1MEYC 1YUIA 2DRPA 2EMHA 2ENAA 2EMYA 2YRMA 2ELYA 2EM6A 2EL6A 2EE8A 2YTOA 2EN3A 3MHSC 2EMWA 2J7JA 2E72A 2EOSA 2LV2A 2WCC3 2A25A 2EPCA 2YU5A 2CSHA 1DGCA 3EPKA 2RPCA 2EMAA 1B69A 1UBDC 2DMIA 1X3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR9 A;  4R2P A;  4R2Q A;  1A1I A;  2EM4 A;  2PRT A;  2EOO A;  1ZAA C;  2EMZ A;  4R2A A;  2DLK A;  2EN2 A;  2YTF A;  3VHT B;  1YSA C;  2EOE A;  2EM9 A;  2EPX A;  3M99 B;  1BB8 A;  4R2C A;  3EPL A;  1LLM C;  2ADR A;  2GLI A;  4R2R A;  2EN1 A;  1P47 A;  4WSG A;  4X9J A;  2EOI A;  2YTJ A;  2EMC A;  1X6F A;  1JK2 A;  2MKN A;  2YTG A;  2YSO A;  2YTE A;  1F2I G;  1Z1B A;  2EM8 A;  2WBS A;  1ZU1 A;  4R2E A;  2EM5 A;  2NAB A;  2M9A A;  2EMI A;  4R2D A;  2EM7 A;  2MKD A;  1X5W A;  2ELZ A;  2D9H A;  2VRD A;  1G2D C;  2EOQ A;  2DLQ A;  2I13 A;  2EMK A;  2YTN A;  4IJD A;  2EOF A;  2EPZ A;  2LO3 A;  2YTI A;  5KL5 A;  5KL4 A;  2DGC A;  2EOX A;  2EM3 A;  1A1K A;  2EN4 A;  1NCS A;  1YUJ A;  5KL2 A;  2EOZ A;  2EN7 A;  2EJ4 A;  2EML A;  2RSI A;  2EOY A;  2YRK A;  2LVH A;  3EPH A;  2YU8 A;  2EOR A;  5KL7 A;  2YSP A;  1X6E A;  1A1F A;  1TF6 A;  1BBO A;  1A1H A;  2EQ3 A;  1A1G A;  1WJP A;  1UN6 B;  2EMG A;  2EOM A;  4IS1 C;  2ENC A;  1TN9 A;  1AAY A;  3EPJ A;  2EM2 A;  2GHF A;  2EPA A;  2YRH A;  1RMD A;  2JPA A;  2JP9 A;  4F2J C;  4M9V C;  2EMX A;  2YTP A;  2EPP A;  3UK3 C;  2YTQ A;  5KL6 A;  1KJK A;  2CT1 A;  1X6H A;  2EMF A;  2EQ0 A;  2R1F A;  4GZN C;  2EMB A;  2HGH A;  2WBU A;  2EOH A;  2WBT A;  4F6N A;  2LCE A;  1A1J A;  2EL5 A;  2EPR A;  2EOJ A;  2ENH A;  2LT7 A;  1G2F C;  2BB8 A;  2CTD A;  2EN8 A;  4R2S A;  1A1L A;  1JK1 A;  1TF3 A;  2EM0 A;  2EN6 A;  5KL3 A;  2EP3 A;  2EQ1 A;  2MDG A;  2EPU A;  2YTD A;  2EL4 A;  3MHH C;  4FK5 C;  4F6M A;  1MEY C;  1YUI A;  2DRP A;  2EMH A;  2ENA A;  2EMY A;  2YRM A;  2ELY A;  2EM6 A;  2EL6 A;  2EE8 A;  2YTO A;  2EN3 A;  3MHS C;  2EMW A;  2J7J A;  2E72 A;  2EOS A;  2LV2 A;  2WCC 3;  2A25 A;  2EPC A;  2YU5 A;  2CSH A;  1DGC A;  3EPK A;  2RPC A;  2EMA A;  1B69 A;  1UBD C;  2DMI A;  1X3C A; 
#chains in the Genus database with same CATH topology
 4KWY A;  2EM4 A;  1ZAA C;  2L2M A;  2EN2 A;  3KZZ A;  1DQ3 A;  2IHR 1;  4TUI A;  1BB8 A;  1EKZ A;  3FIG A;  1QNT A;  2GLI A;  1P47 A;  5F3W A;  4JI2 E;  2K7I A;  2YTG A;  2M4I A;  2L2N A;  3H09 A;  3L00 A;  4R2E A;  5T6J A;  4KHP E;  5AE1 A;  1T38 A;  3BF2 A;  2VRD A;  2FV4 B;  2EOQ A;  2NUF A;  1YYO A;  4JV5 E;  1UHZ A;  2LO3 A;  4JI7 E;  3OML A;  3IWB A;  2EN4 A;  1NCS A;  1N33 E;  1YUJ A;  5KL2 A;  2EN7 A;  1HNX E;  4ZYE A;  2EML A;  4WXD A;  2RSI A;  5IV8 B;  1L4S A;  2EOY A;  2YRK A;  2YU8 A;  2YSP A;  1A1F A;  2LJH A;  2LJU A;  2YZT A;  2EQ3 A;  1PJT A;  4F54 A;  1A1G A;  2EOM A;  2ENC A;  2EM2 A;  1RMD A;  2JPA A;  2JP9 A;  4M9V C;  4M30 A;  3UK3 C;  4O4K A;  4O24 A;  1FJG E;  2YTQ A;  3HPZ A;  3J7A G;  1UIL A;  4DUZ E;  1X6H A;  5A6A A;  4DV3 E;  2MDR A;  1O0W A;  4RHB B;  2K4V A;  1N34 E;  3ADG A;  2LT7 A;  1X48 A;  1EH6 A;  4R2S A;  1A1L A;  4JI5 E;  1JK1 A;  1TF3 A;  1BBG A;  3LLH A;  2RS7 A;  2JYA A;  2KHX A;  2L92 A;  2ODR D;  2EL4 A;  2JY9 A;  2YWQ A;  4FK5 C;  4BHB A;  2CPN A;  4F6M A;  2ENA A;  2B7V A;  2LRS A;  2V88 A;  2JOX A;  1NEI A;  3MHS C;  4DR4 E;  3LML A;  4GEQ B;  4LFC E;  4I8O A;  2J7J A;  2V89 A;  4GKJ E;  2WCC 3;  1IBK E;  2GPI A;  4LFA E;  2F4V E;  1DGC A;  3KZY A;  2EMA A;  1B69 A;  1X3C A;  1ZR9 A;  4R2Q A;  1A1I A;  5IWA E;  2L8T A;  4LU9 A;  2EMZ A;  2L3C A;  2DLK A;  4ZYD A;  2RQL A;  1YSA C;  2I9I A;  2EM9 A;  2UXB E;  1SFE A;  3M99 B;  2EPK X;  4R2C A;  1LLM C;  1IMU A;  1J26 A;  1PJS A;  2DMY A;  4X9J A;  3TQM A;  2UUB E;  2EOI A;  3J80 C;  4L8N A;  2MKN A;  2YTE A;  4JI8 E;  1F2I G;  3J7Y p;  2WBS A;  4DR6 E;  2ZM6 E;  1ZU1 A;  3HXL A;  2M9A A;  4ZYG A;  2G7H A;  5FLX C;  2DLQ A;  4Q28 A;  4F9B B;  4B3M E;  4IJD A;  2DIX A;  2EPZ A;  2B9D A;  1GQE A;  5A69 A;  2DGC A;  2EM3 A;  1AH5 A;  2L3J A;  4LF7 E;  2EOZ A;  2EJ4 A;  2KON A;  4LF4 E;  1T4O A;  1WHN A;  3DF6 A;  1GZ6 A;  2EOR A;  4MLQ A;  3VK6 A;  4JI4 E;  2UXC E;  2RTX A;  2V8Q B;  3F6H A;  2UUC E;  4LF9 E;  4IS1 C;  4JI0 E;  1EH7 A;  4BHC A;  3F6G A;  2GHF A;  1YFH A;  4F2J C;  2YTP A;  1YPN A;  5LMU E;  3THN A;  5IT9 C;  5KL6 A;  2BBG A;  5TSE A;  4O43 A;  4DV7 E;  2EMF A;  2EQ0 A;  4GZN C;  3ECR A;  4F6N A;  4WPY A;  1T39 A;  4DV5 E;  4L5N C;  4N4R B;  2CTD A;  2EN8 A;  1HR0 E;  5AC4 A;  4DR2 E;  2EM0 A;  2EP3 A;  2R76 A;  4NXM E;  4NZV A;  2EPM X;  4B3T E;  2YT4 A;  2MDG A;  3C6K A;  4WXC A;  3ADI A;  2EPU A;  4WX9 A;  2YTD A;  3C6M A;  3MHH C;  3IWC A;  2EPL X;  2Q8U A;  2EMY A;  2ELY A;  2NA2 A;  2EL6 A;  2YTO A;  1XNQ E;  4NXN E;  3AUZ A;  4DR1 E;  2E72 A;  1WXR A;  2VF1 A;  4X64 E;  3OTO E;  4JI3 E;  2EPC A;  3BGH A;  2RPC A;  3JTZ A;  4R03 A;  2DMI A;  4ZYH A;  5AE2 A;  4R2P A;  4F9A B;  3KWR A;  2EOO A;  2B7T A;  4DV4 E;  3ADL A;  5A6B A;  2MC6 A;  2NUE A;  2YTF A;  4K0K E;  1QU6 A;  2LTS A;  2VQF E;  3EPL A;  2ADR A;  4R2R A;  2EN1 A;  4BS9 A;  1WRJ A;  2YTJ A;  1JK2 A;  2EPN A;  1ZBT A;  2E1M A;  1IQS A;  4YY3 E;  1Z1B A;  1GTK A;  2EM8 A;  2EWL A;  5AC5 A;  4DV6 E;  2NAB A;  4X66 E;  5A6K A;  2EMI A;  2WZO A;  3VYY A;  3AV0 A;  1STU A;  2I13 A;  5A2Q C;  4HEI A;  2UUA E;  2YTN A;  2EOF A;  5KL5 A;  5KL4 A;  4WFT A;  2EOX A;  4F9C B;  2VQE E;  4X62 E;  4DR7 E;  2HJJ A;  2DSY A;  4LF5 E;  3IWD A;  3HPS A;  4RH8 A;  3HQ1 A;  1PJQ A;  3VYX A;  3EPH A;  4O5G A;  1X6E A;  4NHR A;  2E5L E;  3QG5 C;  3BID A;  1TF6 A;  4P7D A;  1WJP A;  1UN6 B;  4JYA E;  2N3H A;  4LTY A;  1AAY A;  3ZOQ B;  5CFF E;  3MSW A;  4BCA A;  2EMX A;  2H36 X;  1EH8 A;  3HTX A;  2CT1 A;  4BC9 A;  2EMB A;  2EOH A;  2WBT A;  1T4N A;  2LCE A;  4M0V A;  1MGT A;  1KYQ A;  2EPR A;  4DV2 E;  2V86 A;  1IBL E;  1YYK A;  2BB8 A;  3DJW A;  3J81 C;  2EN6 A;  5KL3 A;  2RS6 A;  4OOG C;  1HNW E;  1YUI A;  2DRP A;  2EMH A;  2JWO A;  2L2K B;  2LE2 A;  2RSM A;  4B3S E;  2EM6 A;  2EE8 A;  4DR5 E;  2EN3 A;  2L33 A;  4LF8 E;  2JOB A;  4WSP A;  5DNY A;  3JAM C;  2LV2 A;  4JI6 E;  4WYQ B;  1X49 A;  1ZBQ A;  1RQ0 A;  5IXM B;  1XNR E;  4JI1 E;  4KZS A;  3THO B;  5AE3 A;  3EPK A;  1N32 E;  5BR8 E;  5LMN E;  1UBD C;  2N3G A;  2JR1 A;  1T4L B;  1IQO A;  2PRT A;  1XMO E;  4YHH E;  4DKK A;  4R2A A;  2EPO A;  4M2Z A;  4X8W A;  4DV0 E;  3VHT B;  1N3G A;  4R8O A;  2EOE A;  4DUY E;  2M7Q A;  2EPX A;  4HTG A;  4TUG A;  4J8Z A;  2V85 A;  3T1H E;  2DB2 A;  4LF6 E;  4WSG A;  2KOU A;  2EMC A;  1X6F A;  2YSO A;  4DR3 E;  2JVA A;  3P1X A;  2EM5 A;  2YPN A;  5LL6 R;  4R2D A;  1WHQ A;  2EM7 A;  2V87 A;  2MKD A;  2D9H A;  1X5W A;  2ELZ A;  4BC7 A;  1G2D C;  5A6B D;  2EMK A;  2LBS B;  2YTI A;  1PDA A;  3C4T A;  1X47 A;  4BBY A;  2UXD E;  2LTR A;  1A1K A;  2HC5 A;  2HHH E;  2LVH A;  1IBM E;  4OX9 E;  2UU9 E;  5KL7 A;  1BBO A;  4X65 E;  1A1H A;  1XMQ E;  2FTX B;  2EMG A;  1TN9 A;  3EPJ A;  2L6M A;  2EPA A;  2YRH A;  5A6J A;  2M1S A;  4DV1 E;  2N8X A;  2EPP A;  1KJK A;  1FKA E;  2R1F A;  2HGH A;  1N36 E;  2WBU A;  4AQY E;  3ADJ A;  3C4B A;  1A1J A;  2EL5 A;  1HNZ E;  2EOJ A;  2ENH A;  1G2F C;  2V83 A;  5ADZ A;  2ODR C;  2EQ1 A;  2F8B A;  1J5E E;  1SR9 A;  1DI2 A;  2B3T B;  4LFB E;  2FGG A;  3BBG A;  5LLQ A;  1MEY C;  3EQ1 A;  2NUG A;  2JXP A;  2YRM A;  1I94 E;  1YZ9 A;  2MC5 A;  4MLV A;  2EMW A;  2LUP B;  2LMZ A;  4GKK E;  4BMJ A;  2EOS A;  4Q35 B;  2VE7 C;  2A25 A;  1RC7 A;  1PKP A;  4DMI A;  2YU5 A;  4B3R E;  5AAS A;  2CSH A;  2LUQ A;  3JU0 A;  3K6Q A;  3RMP A;  2EZ6 A;  3T1Y E;  1YYW A;  4P78 A; 
#chains in the Genus database with same CATH homology
 1ZR9 A;  4R2P A;  4R2Q A;  1A1I A;  2EM4 A;  2PRT A;  2EOO A;  1ZAA C;  2EMZ A;  4R2A A;  2DLK A;  2EN2 A;  2YTF A;  3VHT B;  1YSA C;  2EOE A;  2EM9 A;  2EPX A;  3M99 B;  1BB8 A;  4R2C A;  3EPL A;  1LLM C;  2ADR A;  2GLI A;  4R2R A;  2EN1 A;  1P47 A;  4WSG A;  4X9J A;  2EOI A;  2YTJ A;  2EMC A;  1X6F A;  1JK2 A;  2MKN A;  2YTG A;  2YSO A;  2YTE A;  1F2I G;  1Z1B A;  2EM8 A;  2WBS A;  1ZU1 A;  4R2E A;  2EM5 A;  2NAB A;  2M9A A;  2EMI A;  4R2D A;  2EM7 A;  2MKD A;  1X5W A;  2ELZ A;  2D9H A;  2VRD A;  1G2D C;  2EOQ A;  2DLQ A;  2I13 A;  2EMK A;  2YTN A;  4IJD A;  2EOF A;  2EPZ A;  2LO3 A;  2YTI A;  5KL5 A;  5KL4 A;  2DGC A;  2EOX A;  2EM3 A;  1A1K A;  2EN4 A;  1NCS A;  1YUJ A;  5KL2 A;  2EOZ A;  2EN7 A;  2EJ4 A;  2EML A;  2RSI A;  2EOY A;  2YRK A;  2LVH A;  3EPH A;  2YU8 A;  2EOR A;  5KL7 A;  2YSP A;  1X6E A;  1A1F A;  1TF6 A;  1BBO A;  1A1H A;  2EQ3 A;  1A1G A;  1WJP A;  1UN6 B;  2EMG A;  2EOM A;  4IS1 C;  2ENC A;  1TN9 A;  1AAY A;  3EPJ A;  2EM2 A;  2GHF A;  2EPA A;  2YRH A;  1RMD A;  2JPA A;  2JP9 A;  4F2J C;  4M9V C;  2EMX A;  2YTP A;  2EPP A;  3UK3 C;  2YTQ A;  5KL6 A;  1KJK A;  2CT1 A;  1X6H A;  2EMF A;  2EQ0 A;  2R1F A;  4GZN C;  2EMB A;  2HGH A;  2WBU A;  2EOH A;  2WBT A;  4F6N A;  2LCE A;  1A1J A;  2EL5 A;  2EPR A;  2EOJ A;  2ENH A;  2LT7 A;  1G2F C;  2BB8 A;  2CTD A;  2EN8 A;  4R2S A;  1A1L A;  1JK1 A;  1TF3 A;  2EM0 A;  2EN6 A;  5KL3 A;  2EP3 A;  2EQ1 A;  2MDG A;  2EPU A;  2YTD A;  2EL4 A;  3MHH C;  4FK5 C;  4F6M A;  1MEY C;  1YUI A;  2DRP A;  2EMH A;  2ENA A;  2EMY A;  2YRM A;  2ELY A;  2EM6 A;  2EL6 A;  2EE8 A;  2YTO A;  2EN3 A;  3MHS C;  2EMW A;  2J7J A;  2E72 A;  2EOS A;  2LV2 A;  2WCC 3;  2A25 A;  2EPC A;  2YU5 A;  2CSH A;  1DGC A;  3EPK A;  2RPC A;  2EMA A;  1B69 A;  1UBD C;  2DMI A;  1X3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...