4R2EA

Wilms tumor protein (wt1) zinc fingers in complex with methylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Wilms tumor protein, isoform 4/CRA_a
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2eA00
2EN4A 2EM4A 2EM8A 1X6FA 3EPHA 2EM6A 2BB8A 2EMWA 2YTJA 2EPUA 2MDGA 2EE8A 2EM7A 2EMBA 1AAYA 1A1KA 2EN1A 2LT7A 2YTQA 4F6NA 2YRKA 1A1IA 1X6EA 2EMGA 1LLMC 2JPAA 1ZR9A 2ENHA 2ENAA 2EPZA 2ELZA 2YTFA 4R2RA 2EPCA 4F2JC 2CT1A 5KL6A 3UK3C 4GZNC 2EJ4A 2A25A 4X9JA 2EOOA 5KL5A 2EMZA 2RSIA 2YTGA 3EPJA 2EOYA 1JK2A 5KL3A 2EOQA 2WCC3 1YSAC 2EQ1A 2EOZA 5KL2A 2EPRA 2LCEA 1DGCA 1UBDC 2DRPA 2EN7A 1X6HA 4R2CA 4R2QA 2ENCA 2M9AA 1WJPA 1YUJA 2E72A 2EMAA 2EQ0A 2WBUA 2D9HA 2EPXA 2YTNA 1TF6A 2YU8A 2EN2A 1NCSA 2GHFA 2YU5A 2JP9A 2EOXA 2EOIA 1Z1BA 2YRMA 4R2PA 2EPAA 1G2FC 2GLIA 4IS1C 2LO3A 5KL4A 2EL5A 2EORA 1MEYC 2MKNA 2EOMA 2I13A 2WBSA 2EN6A 1X5WA 2VRDA 2EL6A 2LVHA 2EMHA 2EMCA 2EM3A 2YTIA 1RMDA 2YSPA 2YRHA 3EPLA 2CSHA 1KJKA 4M9VC 2YSOA 1B69A 2EOSA 2EMYA 4R2AA 2YTDA 1BB8A 1ZAAC 1X3CA 3EPKA 1P47A 1A1FA 1TF3A 2YTOA 2EM2A 2YTEA 2EMIA 2EN8A 2EM0A 3MHHC 2DGCA 2EL4A 2ELYA 1BBOA 2EOFA 2J7JA 4R2SA 2EPPA 1A1JA 2YTPA 2DMIA 2HGHA 4WSGA 2ADRA 2NABA 1F2IG 1YUIA 2RPCA 2R1FA 2EN3A 2CTDA 3MHSC 1UN6B 5KL7A 4IJDA 1JK1A 2EMLA 1TN9A 2EMFA 2DLKA 2EOJA 1A1LA 3VHTB 2WBTA 4R2DA 1G2DC 2EP3A 1A1HA 2EM5A 2EM9A 4R2EA 2PRTA 1ZU1A 2EOHA 3M99B 2EQ3A 4FK5C 2LV2A 4F6MA 2EMKA 2MKDA 2EOEA 2DLQA 2EMXA 1A1GA
chains in the Genus database with same CATH superfamily
2VF1A 5CFFE 2EM6A 4NXME 4B3TE 5LLQA 2EE8A 2H36X 2EMBA 1J26A 1A1KA 4JI7E 2LT7A 3ADGA 4JI2E 2V86A 4LF8E 1SR9A 1X6EA 2N3HA 2JPAA 3ADJA 2ENHA 1EH6A 5AE3A 3J7AG 2V88A 2L3JA 2L6MA 1I94E 4R2RA 1X49A 2YWQA 1XNRE 2RSMA 2EJ4A 1GQEA 2EMZA 2LUQA 2V85A 2MC5A 3RMPA 2JYAA 1IBKE 2HC5A 2HHHE 5KL3A 3C6KA 3JTZA 1YSAC 4DUYE 4DV1E 4NHRA 1T39A 1YFHA 5LMNE 3F6GA 4JI1E 4DV4E 2D9HA 1WRJA 2EN2A 1DI2A 2EPAA 1NEIA 1XMOE 2GLIA 4F9AB 2LE2A 5A6BD 4IS1C 2LO3A 4P78A 5BR8E 2EORA 4ZYDA 1HR0E 3C4TA 2WBSA 1X5WA 2NA2A 1GZ6A 2HJJA 2LVHA 2EMHA 4R03A 4O5GA 2EM3A 1RMDA 4DV7E 4O4KA 4JI3E 2VE7C 4P7DA 2YSOA 2EOSA 2EMYA 1BB8A 2YTDA 2YT4A 1ZAAC 1HNZE 2EM2A 2EN8A 2EM0A 2VQEE 3MHHC 4DV2E 3LMLA 4HEIA 2RS7A 4BCAA 1A1JA 4GEQB 2N8XA 4WSGA 4WX9A 4DV0E 1YUIA 2R1FA 1IBLE 3MHSC 1UHZA 1QU6A 2JVAA 1JK1A 1N36E 2EMLA 1TN9A 4DR7E 4LTYA 2ODRC 3VYYA 4R2DA 1ZU1A 2EOHA 4LFCE 1IMUA 4F6MA 2EOEA 3KZYA 4X8WA 2L8TA 5F3WA 2DRPA 1PJTA 2DSYA 2EN4A 2EM8A 1SFEA 2EMWA 2YTJA 1WXRA 1N33E 4BBYA 2I9IA 1ZBTA 4DKKA 2YTQA 2YRKA 4MLVA 3ADIA 2RQLA 2F4VE 1T38A 5IV8B 2M4IA 2V89A 5IWAE 2LBSB 4RHBB 2EPCA 4F2JC 1YPNA 5KL6A 2YTGA 4LF6E 1ZBQA 1JK2A 4DR2E 4WSPA 3LLHA 4WYQB 2EOQA 3P1XA 1DQ3A 5KL2A 2EPRA 3JU0A 2E72A 4WXDA 1TF6A 2E5LE 2YU8A 4DR4E 2MC6A 2JP9A 5T6JA 1HNWE 2EOIA 2JXPA 1Z1BA 2YRMA 4M0VA 5AE1A 4BHBA 1L4SA 1IBME 5LL6R 5KL4A 2KOUA 2WZOA 2VRDA 2EL6A 3KZZA 4LF4E 4O43A 4X64E 2YSPA 4DR1E 1BBGA 3TQMA 2JY9A 2B3TB 4B3ME 5A69A 2EMIA 2DB2A 2EPMX 2DGCA 1EKZA 2EL4A 5A2QC 2EOFA 3KWRA 4M2ZA 2EPPA 2V87A 2B7VA 5A6JA 2ADRA 5ADZA 2RPCA 4DMIA 2L2NA 2CTDA 4ZYEA 3J81C 5KL7A 3VHTB 1G2DC 2EM5A 4BHCA 4F9BB 4R2EA 3VK6A 3HPSA 1N3GA 4FK5C 5AC4A 2LV2A 1XMQE 2DLQA 4LF5E 3HXLA 2EM4A 1X6FA 2LTRA 2BB8A 2EPUA 3QG5C 2EM7A 4DV5E 2Q8UA 4DV3E 3IWCA 2EN1A 4TUGA 4F6NA 2K7IA 1QNTA 2EMGA 1LLMC 4B3RE 3EQ1A 4F9CB 3L00A 3MSWA 4WXCA 4OX9E 2EPZA 4GKKE 4WFTA 2YTFA 1RC7A 2EWLA 2CT1A 4HTGA 4GZNC 4X9JA 2EOOA 5KL5A 5FLXC 2RSIA 2NUGA 5TSEA 2EOYA 4DR5E 4N4RB 1YYWA 2WCC3 2YPNA 4JI4E 4M30A 2EQ1A 3THOB 2VQFE 1YYKA 2EN7A 3ECRA 4OOGC 4R2CA 2V83A 4K0KE 2YZTA 1WHQA 1T4NA 3HQ1A 2ENCA 1YUJA 1WJPA 2MDRA 1UILA 4LFAE 2WBUA 4BC9A 2GHFA 1YZ9A 2YU5A 4DR3E 1PJQA 1N32E 2EOXA 1PDAA 3HPZA 4R2PA 1YYOA 3DF6A 3K6QA 2LJHA 1X47A 2MKNA 4DV6E 1AH5A 2I13A 2EMCA 2RTXA 3FIGA 2R76A 4L5NC 3EPLA 1KJKA 1B69A 4R2AA 2LUPB 3C4BA 1X3CA 3BIDA 3EPKA 1P47A 1N34E 1A1FA 4ZYHA 2UUCE 1PKPA 2B7TA 4LF7E 4R2SA 4L8NA 2UXCE 2YTPA 2UXBE 2DMIA 1IQSA 1XNQE 2HGHA 4ZYGA 3AUZA 2JOBA 4YHHE 1T4LB 2NUFA 1GTKA 2GPIA 2EZ6A 4IJDA 4JI8E 5A6AA 2V8QB 2L2KB 2EPOA 2DLKA 4BS9A 2WBTA 3AV0A 1A1HA 2M7QA 3T1HE 2EMKA 2MKDA 2UU9E 2E1MA 4KWYA 3ADLA 2EPNA 1A1GA 1O0WA 1MGTA 3EPHA 2DMYA 4LU9A 2ZM6E 2MDGA 3VYXA 2L2MA 2K4VA 1AAYA 4LF9E 2F8BA 4MLQA 4R8OA 2CPNA 1A1IA 3H09A 4JYAE 4KZSA 1ZR9A 4F54A 2ENAA 3IWBA 2ELZA 2FTXB 4J8ZA 3F6HA 3BBGA 5IXMB 3UK3C 2A25A 2BBGA 1J5EE 1HNXE 3EPJA 5DNYA 4JI6E 2G7HA 2EOZA 5A6KA 2ODRD 2LCEA 1DGCA 1UBDC 1X6HA 4BMJA 3THNA 2B9DA 5AE2A 4R2QA 4B3SE 2M9AA 2EMAA 4Q35B 2EQ0A 3IWDA 3J80C 2EPXA 2YTNA 2FGGA 2KONA 1NCSA 2EPLX 2LMZA 2EPKX 1IQOA 4NZVA 1G2FC 2UUBE 3JAMC 2JOXA 4X65E 4WPYA 2NUEA 4JI5E 2EL5A 3BF2A 4YY3E 1MEYC 2L92A 2EOMA 3DJWA 4BC7A 2EN6A 2LRSA 2YTIA 5IT9C 2DIXA 2YRHA 2CSHA 4M9VC 5AC5A 4JI0E 5A6BA 4DR6E 1X48A 1TF3A 1EH8A 2YTOA 2YTEA 5AASA 2JWOA 2RS6A 2LTSA 4X66E 1BBOA 1RQ0A 2ELYA 2L3CA 1T4OA 2N3GA 3BGHA 2UXDE 4NXNE 2J7JA 4X62E 1PJSA 4GKJE 1FJGE 2NABA 4LFBE 1F2IG 4TUIA 4JV5E 2JR1A 2EN3A 3OTOE 2FV4B 5LMUE 1FKAE 1UN6B 2L33A 4AQYE 1WHNA 2EMFA 2EOJA 1KYQA 1A1LA 4Q28A 3ZOQB 3C6MA 2LJUA 2IHR1 2EP3A 2EM9A 2M1SA 4DUZE 2PRTA 4KHPE 3J7Yp 1EH7A 3M99B 2KHXA 1STUA 2EQ3A 4RH8A 4I8OA 4O24A 3HTXA 3T1YE 2UUAE 2EMXA 3OMLA
chains in the Genus database with same CATH topology
2EN4A 2EM4A 2EM8A 1X6FA 3EPHA 2EM6A 2BB8A 2EMWA 2YTJA 2EPUA 2MDGA 2EE8A 2EM7A 2EMBA 1AAYA 1A1KA 2EN1A 2LT7A 2YTQA 4F6NA 2YRKA 1A1IA 1X6EA 2EMGA 1LLMC 2JPAA 1ZR9A 2ENHA 2ENAA 2EPZA 2ELZA 2YTFA 4R2RA 2EPCA 4F2JC 2CT1A 5KL6A 3UK3C 4GZNC 2EJ4A 2A25A 4X9JA 2EOOA 5KL5A 2EMZA 2RSIA 2YTGA 3EPJA 2EOYA 1JK2A 5KL3A 2EOQA 2WCC3 1YSAC 2EQ1A 2EOZA 5KL2A 2EPRA 2LCEA 1DGCA 1UBDC 2DRPA 2EN7A 1X6HA 4R2CA 4R2QA 2ENCA 2M9AA 1WJPA 1YUJA 2E72A 2EMAA 2EQ0A 2WBUA 2D9HA 2EPXA 2YTNA 1TF6A 2YU8A 2EN2A 1NCSA 2GHFA 2YU5A 2JP9A 2EOXA 2EOIA 1Z1BA 2YRMA 4R2PA 2EPAA 1G2FC 2GLIA 4IS1C 2LO3A 5KL4A 2EL5A 2EORA 1MEYC 2MKNA 2EOMA 2I13A 2WBSA 2EN6A 1X5WA 2VRDA 2EL6A 2LVHA 2EMHA 2EMCA 2EM3A 2YTIA 1RMDA 2YSPA 2YRHA 3EPLA 2CSHA 1KJKA 4M9VC 2YSOA 1B69A 2EOSA 2EMYA 4R2AA 2YTDA 1BB8A 1ZAAC 1X3CA 3EPKA 1P47A 1A1FA 1TF3A 2YTOA 2EM2A 2YTEA 2EMIA 2EN8A 2EM0A 3MHHC 2DGCA 2EL4A 2ELYA 1BBOA 2EOFA 2J7JA 4R2SA 2EPPA 1A1JA 2YTPA 2DMIA 2HGHA 4WSGA 2ADRA 2NABA 1F2IG 1YUIA 2RPCA 2R1FA 2EN3A 2CTDA 3MHSC 1UN6B 5KL7A 4IJDA 1JK1A 2EMLA 1TN9A 2EMFA 2DLKA 2EOJA 1A1LA 3VHTB 2WBTA 4R2DA 1G2DC 2EP3A 1A1HA 2EM5A 2EM9A 4R2EA 2PRTA 1ZU1A 2EOHA 3M99B 2EQ3A 4FK5C 2LV2A 4F6MA 2EMKA 2MKDA 2EOEA 2DLQA 2EMXA 1A1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN4 A;  2EM4 A;  2EM8 A;  1X6F A;  3EPH A;  2EM6 A;  2BB8 A;  2EMW A;  2YTJ A;  2EPU A;  2MDG A;  2EE8 A;  2EM7 A;  2EMB A;  1AAY A;  1A1K A;  2EN1 A;  2LT7 A;  2YTQ A;  4F6N A;  2YRK A;  1A1I A;  1X6E A;  2EMG A;  1LLM C;  2JPA A;  1ZR9 A;  2ENH A;  2ENA A;  2EPZ A;  2ELZ A;  2YTF A;  4R2R A;  2EPC A;  4F2J C;  2CT1 A;  5KL6 A;  3UK3 C;  4GZN C;  2EJ4 A;  2A25 A;  4X9J A;  2EOO A;  5KL5 A;  2EMZ A;  2RSI A;  2YTG A;  3EPJ A;  2EOY A;  1JK2 A;  5KL3 A;  2EOQ A;  2WCC 3;  1YSA C;  2EQ1 A;  2EOZ A;  5KL2 A;  2EPR A;  2LCE A;  1DGC A;  1UBD C;  2DRP A;  2EN7 A;  1X6H A;  4R2C A;  4R2Q A;  2ENC A;  2M9A A;  1WJP A;  1YUJ A;  2E72 A;  2EMA A;  2EQ0 A;  2WBU A;  2D9H A;  2EPX A;  2YTN A;  1TF6 A;  2YU8 A;  2EN2 A;  1NCS A;  2GHF A;  2YU5 A;  2JP9 A;  2EOX A;  2EOI A;  1Z1B A;  2YRM A;  4R2P A;  2EPA A;  1G2F C;  2GLI A;  4IS1 C;  2LO3 A;  5KL4 A;  2EL5 A;  2EOR A;  1MEY C;  2MKN A;  2EOM A;  2I13 A;  2WBS A;  2EN6 A;  1X5W A;  2VRD A;  2EL6 A;  2LVH A;  2EMH A;  2EMC A;  2EM3 A;  2YTI A;  1RMD A;  2YSP A;  2YRH A;  3EPL A;  2CSH A;  1KJK A;  4M9V C;  2YSO A;  1B69 A;  2EOS A;  2EMY A;  4R2A A;  2YTD A;  1BB8 A;  1ZAA C;  1X3C A;  3EPK A;  1P47 A;  1A1F A;  1TF3 A;  2YTO A;  2EM2 A;  2YTE A;  2EMI A;  2EN8 A;  2EM0 A;  3MHH C;  2DGC A;  2EL4 A;  2ELY A;  1BBO A;  2EOF A;  2J7J A;  4R2S A;  2EPP A;  1A1J A;  2YTP A;  2DMI A;  2HGH A;  4WSG A;  2ADR A;  2NAB A;  1F2I G;  1YUI A;  2RPC A;  2R1F A;  2EN3 A;  2CTD A;  3MHS C;  1UN6 B;  5KL7 A;  4IJD A;  1JK1 A;  2EML A;  1TN9 A;  2EMF A;  2DLK A;  2EOJ A;  1A1L A;  3VHT B;  2WBT A;  4R2D A;  1G2D C;  2EP3 A;  1A1H A;  2EM5 A;  2EM9 A;  4R2E A;  2PRT A;  1ZU1 A;  2EOH A;  3M99 B;  2EQ3 A;  4FK5 C;  2LV2 A;  4F6M A;  2EMK A;  2MKD A;  2EOE A;  2DLQ A;  2EMX A;  1A1G A; 
#chains in the Genus database with same CATH topology
 2VF1 A;  5CFF E;  2EM6 A;  4NXM E;  4B3T E;  5LLQ A;  2EE8 A;  2H36 X;  2EMB A;  1J26 A;  1A1K A;  4JI7 E;  2LT7 A;  3ADG A;  4JI2 E;  2V86 A;  4LF8 E;  1SR9 A;  1X6E A;  2N3H A;  2JPA A;  3ADJ A;  2ENH A;  1EH6 A;  5AE3 A;  3J7A G;  2V88 A;  2L3J A;  2L6M A;  1I94 E;  4R2R A;  1X49 A;  2YWQ A;  1XNR E;  2RSM A;  2EJ4 A;  1GQE A;  2EMZ A;  2LUQ A;  2V85 A;  2MC5 A;  3RMP A;  2JYA A;  1IBK E;  2HC5 A;  2HHH E;  5KL3 A;  3C6K A;  3JTZ A;  1YSA C;  4DUY E;  4DV1 E;  4NHR A;  1T39 A;  1YFH A;  5LMN E;  3F6G A;  4JI1 E;  4DV4 E;  2D9H A;  1WRJ A;  2EN2 A;  1DI2 A;  2EPA A;  1NEI A;  1XMO E;  2GLI A;  4F9A B;  2LE2 A;  5A6B D;  4IS1 C;  2LO3 A;  4P78 A;  5BR8 E;  2EOR A;  4ZYD A;  1HR0 E;  3C4T A;  2WBS A;  1X5W A;  2NA2 A;  1GZ6 A;  2HJJ A;  2LVH A;  2EMH A;  4R03 A;  4O5G A;  2EM3 A;  1RMD A;  4DV7 E;  4O4K A;  4JI3 E;  2VE7 C;  4P7D A;  2YSO A;  2EOS A;  2EMY A;  1BB8 A;  2YTD A;  2YT4 A;  1ZAA C;  1HNZ E;  2EM2 A;  2EN8 A;  2EM0 A;  2VQE E;  3MHH C;  4DV2 E;  3LML A;  4HEI A;  2RS7 A;  4BCA A;  1A1J A;  4GEQ B;  2N8X A;  4WSG A;  4WX9 A;  4DV0 E;  1YUI A;  2R1F A;  1IBL E;  3MHS C;  1UHZ A;  1QU6 A;  2JVA A;  1JK1 A;  1N36 E;  2EML A;  1TN9 A;  4DR7 E;  4LTY A;  2ODR C;  3VYY A;  4R2D A;  1ZU1 A;  2EOH A;  4LFC E;  1IMU A;  4F6M A;  2EOE A;  3KZY A;  4X8W A;  2L8T A;  5F3W A;  2DRP A;  1PJT A;  2DSY A;  2EN4 A;  2EM8 A;  1SFE A;  2EMW A;  2YTJ A;  1WXR A;  1N33 E;  4BBY A;  2I9I A;  1ZBT A;  4DKK A;  2YTQ A;  2YRK A;  4MLV A;  3ADI A;  2RQL A;  2F4V E;  1T38 A;  5IV8 B;  2M4I A;  2V89 A;  5IWA E;  2LBS B;  4RHB B;  2EPC A;  4F2J C;  1YPN A;  5KL6 A;  2YTG A;  4LF6 E;  1ZBQ A;  1JK2 A;  4DR2 E;  4WSP A;  3LLH A;  4WYQ B;  2EOQ A;  3P1X A;  1DQ3 A;  5KL2 A;  2EPR A;  3JU0 A;  2E72 A;  4WXD A;  1TF6 A;  2E5L E;  2YU8 A;  4DR4 E;  2MC6 A;  2JP9 A;  5T6J A;  1HNW E;  2EOI A;  2JXP A;  1Z1B A;  2YRM A;  4M0V A;  5AE1 A;  4BHB A;  1L4S A;  1IBM E;  5LL6 R;  5KL4 A;  2KOU A;  2WZO A;  2VRD A;  2EL6 A;  3KZZ A;  4LF4 E;  4O43 A;  4X64 E;  2YSP A;  4DR1 E;  1BBG A;  3TQM A;  2JY9 A;  2B3T B;  4B3M E;  5A69 A;  2EMI A;  2DB2 A;  2EPM X;  2DGC A;  1EKZ A;  2EL4 A;  5A2Q C;  2EOF A;  3KWR A;  4M2Z A;  2EPP A;  2V87 A;  2B7V A;  5A6J A;  2ADR A;  5ADZ A;  2RPC A;  4DMI A;  2L2N A;  2CTD A;  4ZYE A;  3J81 C;  5KL7 A;  3VHT B;  1G2D C;  2EM5 A;  4BHC A;  4F9B B;  4R2E A;  3VK6 A;  3HPS A;  1N3G A;  4FK5 C;  5AC4 A;  2LV2 A;  1XMQ E;  2DLQ A;  4LF5 E;  3HXL A;  2EM4 A;  1X6F A;  2LTR A;  2BB8 A;  2EPU A;  3QG5 C;  2EM7 A;  4DV5 E;  2Q8U A;  4DV3 E;  3IWC A;  2EN1 A;  4TUG A;  4F6N A;  2K7I A;  1QNT A;  2EMG A;  1LLM C;  4B3R E;  3EQ1 A;  4F9C B;  3L00 A;  3MSW A;  4WXC A;  4OX9 E;  2EPZ A;  4GKK E;  4WFT A;  2YTF A;  1RC7 A;  2EWL A;  2CT1 A;  4HTG A;  4GZN C;  4X9J A;  2EOO A;  5KL5 A;  5FLX C;  2RSI A;  2NUG A;  5TSE A;  2EOY A;  4DR5 E;  4N4R B;  1YYW A;  2WCC 3;  2YPN A;  4JI4 E;  4M30 A;  2EQ1 A;  3THO B;  2VQF E;  1YYK A;  2EN7 A;  3ECR A;  4OOG C;  4R2C A;  2V83 A;  4K0K E;  2YZT A;  1WHQ A;  1T4N A;  3HQ1 A;  2ENC A;  1YUJ A;  1WJP A;  2MDR A;  1UIL A;  4LFA E;  2WBU A;  4BC9 A;  2GHF A;  1YZ9 A;  2YU5 A;  4DR3 E;  1PJQ A;  1N32 E;  2EOX A;  1PDA A;  3HPZ A;  4R2P A;  1YYO A;  3DF6 A;  3K6Q A;  2LJH A;  1X47 A;  2MKN A;  4DV6 E;  1AH5 A;  2I13 A;  2EMC A;  2RTX A;  3FIG A;  2R76 A;  4L5N C;  3EPL A;  1KJK A;  1B69 A;  4R2A A;  2LUP B;  3C4B A;  1X3C A;  3BID A;  3EPK A;  1P47 A;  1N34 E;  1A1F A;  4ZYH A;  2UUC E;  1PKP A;  2B7T A;  4LF7 E;  4R2S A;  4L8N A;  2UXC E;  2YTP A;  2UXB E;  2DMI A;  1IQS A;  1XNQ E;  2HGH A;  4ZYG A;  3AUZ A;  2JOB A;  4YHH E;  1T4L B;  2NUF A;  1GTK A;  2GPI A;  2EZ6 A;  4IJD A;  4JI8 E;  5A6A A;  2V8Q B;  2L2K B;  2EPO A;  2DLK A;  4BS9 A;  2WBT A;  3AV0 A;  1A1H A;  2M7Q A;  3T1H E;  2EMK A;  2MKD A;  2UU9 E;  2E1M A;  4KWY A;  3ADL A;  2EPN A;  1A1G A;  1O0W A;  1MGT A;  3EPH A;  2DMY A;  4LU9 A;  2ZM6 E;  2MDG A;  3VYX A;  2L2M A;  2K4V A;  1AAY A;  4LF9 E;  2F8B A;  4MLQ A;  4R8O A;  2CPN A;  1A1I A;  3H09 A;  4JYA E;  4KZS A;  1ZR9 A;  4F54 A;  2ENA A;  3IWB A;  2ELZ A;  2FTX B;  4J8Z A;  3F6H A;  3BBG A;  5IXM B;  3UK3 C;  2A25 A;  2BBG A;  1J5E E;  1HNX E;  3EPJ A;  5DNY A;  4JI6 E;  2G7H A;  2EOZ A;  5A6K A;  2ODR D;  2LCE A;  1DGC A;  1UBD C;  1X6H A;  4BMJ A;  3THN A;  2B9D A;  5AE2 A;  4R2Q A;  4B3S E;  2M9A A;  2EMA A;  4Q35 B;  2EQ0 A;  3IWD A;  3J80 C;  2EPX A;  2YTN A;  2FGG A;  2KON A;  1NCS A;  2EPL X;  2LMZ A;  2EPK X;  1IQO A;  4NZV A;  1G2F C;  2UUB E;  3JAM C;  2JOX A;  4X65 E;  4WPY A;  2NUE A;  4JI5 E;  2EL5 A;  3BF2 A;  4YY3 E;  1MEY C;  2L92 A;  2EOM A;  3DJW A;  4BC7 A;  2EN6 A;  2LRS A;  2YTI A;  5IT9 C;  2DIX A;  2YRH A;  2CSH A;  4M9V C;  5AC5 A;  4JI0 E;  5A6B A;  4DR6 E;  1X48 A;  1TF3 A;  1EH8 A;  2YTO A;  2YTE A;  5AAS A;  2JWO A;  2RS6 A;  2LTS A;  4X66 E;  1BBO A;  1RQ0 A;  2ELY A;  2L3C A;  1T4O A;  2N3G A;  3BGH A;  2UXD E;  4NXN E;  2J7J A;  4X62 E;  1PJS A;  4GKJ E;  1FJG E;  2NAB A;  4LFB E;  1F2I G;  4TUI A;  4JV5 E;  2JR1 A;  2EN3 A;  3OTO E;  2FV4 B;  5LMU E;  1FKA E;  1UN6 B;  2L33 A;  4AQY E;  1WHN A;  2EMF A;  2EOJ A;  1KYQ A;  1A1L A;  4Q28 A;  3ZOQ B;  3C6M A;  2LJU A;  2IHR 1;  2EP3 A;  2EM9 A;  2M1S A;  4DUZ E;  2PRT A;  4KHP E;  3J7Y p;  1EH7 A;  3M99 B;  2KHX A;  1STU A;  2EQ3 A;  4RH8 A;  4I8O A;  4O24 A;  3HTX A;  3T1Y E;  2UUA E;  2EMX A;  3OML A; 
#chains in the Genus database with same CATH homology
 2EN4 A;  2EM4 A;  2EM8 A;  1X6F A;  3EPH A;  2EM6 A;  2BB8 A;  2EMW A;  2YTJ A;  2EPU A;  2MDG A;  2EE8 A;  2EM7 A;  2EMB A;  1AAY A;  1A1K A;  2EN1 A;  2LT7 A;  2YTQ A;  4F6N A;  2YRK A;  1A1I A;  1X6E A;  2EMG A;  1LLM C;  2JPA A;  1ZR9 A;  2ENH A;  2ENA A;  2EPZ A;  2ELZ A;  2YTF A;  4R2R A;  2EPC A;  4F2J C;  2CT1 A;  5KL6 A;  3UK3 C;  4GZN C;  2EJ4 A;  2A25 A;  4X9J A;  2EOO A;  5KL5 A;  2EMZ A;  2RSI A;  2YTG A;  3EPJ A;  2EOY A;  1JK2 A;  5KL3 A;  2EOQ A;  2WCC 3;  1YSA C;  2EQ1 A;  2EOZ A;  5KL2 A;  2EPR A;  2LCE A;  1DGC A;  1UBD C;  2DRP A;  2EN7 A;  1X6H A;  4R2C A;  4R2Q A;  2ENC A;  2M9A A;  1WJP A;  1YUJ A;  2E72 A;  2EMA A;  2EQ0 A;  2WBU A;  2D9H A;  2EPX A;  2YTN A;  1TF6 A;  2YU8 A;  2EN2 A;  1NCS A;  2GHF A;  2YU5 A;  2JP9 A;  2EOX A;  2EOI A;  1Z1B A;  2YRM A;  4R2P A;  2EPA A;  1G2F C;  2GLI A;  4IS1 C;  2LO3 A;  5KL4 A;  2EL5 A;  2EOR A;  1MEY C;  2MKN A;  2EOM A;  2I13 A;  2WBS A;  2EN6 A;  1X5W A;  2VRD A;  2EL6 A;  2LVH A;  2EMH A;  2EMC A;  2EM3 A;  2YTI A;  1RMD A;  2YSP A;  2YRH A;  3EPL A;  2CSH A;  1KJK A;  4M9V C;  2YSO A;  1B69 A;  2EOS A;  2EMY A;  4R2A A;  2YTD A;  1BB8 A;  1ZAA C;  1X3C A;  3EPK A;  1P47 A;  1A1F A;  1TF3 A;  2YTO A;  2EM2 A;  2YTE A;  2EMI A;  2EN8 A;  2EM0 A;  3MHH C;  2DGC A;  2EL4 A;  2ELY A;  1BBO A;  2EOF A;  2J7J A;  4R2S A;  2EPP A;  1A1J A;  2YTP A;  2DMI A;  2HGH A;  4WSG A;  2ADR A;  2NAB A;  1F2I G;  1YUI A;  2RPC A;  2R1F A;  2EN3 A;  2CTD A;  3MHS C;  1UN6 B;  5KL7 A;  4IJD A;  1JK1 A;  2EML A;  1TN9 A;  2EMF A;  2DLK A;  2EOJ A;  1A1L A;  3VHT B;  2WBT A;  4R2D A;  1G2D C;  2EP3 A;  1A1H A;  2EM5 A;  2EM9 A;  4R2E A;  2PRT A;  1ZU1 A;  2EOH A;  3M99 B;  2EQ3 A;  4FK5 C;  2LV2 A;  4F6M A;  2EMK A;  2MKD A;  2EOE A;  2DLQ A;  2EMX A;  1A1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...