4R2EA

Wilms tumor protein (wt1) zinc fingers in complex with methylated dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein, isoform 4/CRA_a
publication title Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4r2eA00
4F2JC 4R2PA 3EPKA 2M9AA 1P47A 2YTNA 2DGCA 2EQ0A 1A1GA 1TF3A 1KJKA 2EM7A 2J7JA 5KL7A 4R2RA 2EN1A 2DRPA 2EMFA 3EPLA 2EOJA 2WCC3 2EN6A 2EOSA 2EORA 2YRHA 5KL3A 1G2FC 2CT1A 2EMIA 2YTGA 2YTDA 4IJDA 4R2QA 3M99B 2NABA 2BB8A 2YTOA 2GLIA 2EMCA 2EMAA 2EOHA 1A1IA 2EOZA 1X5WA 2LCEA 2EM0A 2EN3A 2EQ3A 2CTDA 2EOOA 2LT7A 2YTJA 4F6NA 2EPPA 5KL2A 2DMIA 2EP3A 2EL4A 1BB8A 2EM6A 2EM9A 2EN8A 2EN4A 2LO3A 5KL4A 2YTFA 2HGHA 1DGCA 2EPZA 2ELZA 2MKDA 1TF6A 2MDGA 1TN9A 1UN6B 1LLMC 2YSPA 1UBDC 1G2DC 2E72A 2YTPA 1X6FA 1JK1A 2ENHA 2YRKA 3MHSC 2EMBA 1AAYA 2EOEA 2EE8A 3MHHC 1YSAC 1A1HA 2EOYA 1A1FA 4R2DA 2EMGA 4M9VC 2ADRA 2EL5A 1NCSA 1A1LA 2EMZA 1F2IG 2EOMA 2LV2A 2EJ4A 2VRDA 2EM5A 2EM8A 2EPXA 2ELYA 4R2SA 3UK3C 2MKNA 5KL6A 3EPHA 2EMKA 1ZAAC 1ZU1A 2ENCA 2LVHA 2EMLA 1BBOA 2EOIA 2YTIA 1B69A 1ZR9A 2DLKA 4X9JA 2YU8A 4GZNC 1X6EA 4IS1C 3VHTB 1JK2A 1Z1BA 2RPCA 1YUIA 2JPAA 2I13A 2EPRA 4R2EA 4R2CA 1A1KA 1YUJA 2ENAA 4WSGA 1X6HA 2EPCA 3EPJA 4F6MA 2CSHA 2WBSA 1RMDA 2EMXA 2EMYA 2GHFA 2YTEA 2EOQA 2EMWA 2DLQA 2EPUA 2YTQA 2EM2A 1X3CA 2EL6A 2WBTA 2EMHA 1MEYC 2YSOA 5KL5A 2EOFA 2WBUA 1WJPA 2JP9A 2EOXA 2R1FA 2EN2A 2RSIA 2YRMA 2EN7A 2YU5A 4R2AA 2EPAA 2EM3A 4FK5C 2EQ1A 1A1JA 2PRTA 2A25A 2D9HA 2EM4A
chains in the Genus database with same CATH superfamily
3IWCA 3J7Yp 4R2PA 2M9AA 3P1XA 2E5LE 2YTNA 4DV6E 2EQ0A 1A1GA 1TF3A 1KJKA 2J7JA 4K0KE 2EMFA 4TUIA 4LFAE 2EN6A 4O43A 2EOSA 2EORA 2CT1A 4LF8E 4IJDA 2NABA 4DV0E 1A1IA 1PJTA 2EN3A 4DKKA 2LT7A 5T6JA 1YYOA 2EPPA 2GPIA 3DJWA 3C4TA 1KYQA 1FJGE 2EN8A 2EN4A 1IBKE 2LJUA 4DR2E 2EPZA 2ELZA 1TF6A 4M2ZA 4O4KA 3BGHA 4GKKE 1X6FA 5LMUE 3MHSC 5CFFE 2UXDE 4LF4E 3MSWA 1A1HA 2EPLX 2EOYA 4TUGA 2Q8UA 4M9VC 2FV4B 1NCSA 2VRDA 2EM5A 3HPSA 2MKNA 3UK3C 4R2SA 5KL6A 1XNRE 1YPNA 2LVHA 2UUBE 4WPYA 2NUFA 4JI2E 1GQEA 4GZNC 1N3GA 5IWAE 3HTXA 3T1YE 4MLQA 4NZVA 4ZYHA 3VHTB 2V83A 1YUIA 2L3CA 2ODRD 1A1KA 1YUJA 2E1MA 1IQSA 1X6HA 5AE2A 1J5EE 4JI7E 2NUGA 2DSYA 2L2NA 3ADGA 5A6AA 2WBSA 4DR3E 2N3GA 4O5GA 2NUEA 4JI5E 5TSEA 2HJJA 3F6GA 2H36X 5AASA 4DR6E 4LU9A 4NHRA 1MEYC 4O24A 2NA2A 4F54A 2BBGA 4B3TE 2RSIA 3HXLA 2EN7A 2EPAA 2V88A 4X62E 1HNXE 3K6QA 2D9HA 2EM4A 4DV7E 3EPKA 2DGCA 4B3SE 2LUQA 4OOGC 2EN1A 1HR0E 4LTYA 1YFHA 2EOJA 2JOBA 4BHBA 4M30A 4X66E 1G2FC 4DV5E 2EMIA 3J81C 2UU9E 5LL6R 3H09A 4R2QA 5A6BA 4L5NC 2V8QB 3C6KA 2EOZA 1X5WA 2LCEA 3ECRA 2EQ3A 2B7TA 1PJSA 3ZOQB 2DMIA 4NXNE 2EP3A 4DR4E 4RH8A 1N34E 4GKJE 5F3WA 2YTFA 2HGHA 2L2MA 2KONA 1DGCA 3KZYA 2JOXA 4DUYE 3THOB 2L6MA 4WFTA 1LLMC 2YWQA 1WRJA 1PKPA 3VYYA 1YYWA 4JI0E 1AAYA 1YYKA 2EPMX 2DB2A 1IBLE 1A1FA 2EMGA 2ADRA 4WXDA 3AUZA 2EL5A 1N33E 2EOMA 2EJ4A 4LFBE 1I94E 1ZAAC 2ENCA 1IQOA 2EMLA 2G7HA 2F8BA 1B69A 4JI6E 1N32E 4F9AB 4KHPE 4BC9A 2N8XA 3EQ1A 2MC6A 2HHHE 4DV4E 4I8OA 1AH5A 2I13A 4R2EA 4JI4E 4WSGA 1GZ6A 4F6MA 2CSHA 3C4BA 2GHFA 1SFEA 5A6BD 2DMYA 4BBYA 2EWLA 2EMWA 2DLQA 1N36E 2B9DA 2L92A 2EM2A 1X3CA 4ZYEA 2WBTA 4JV5E 4BC7A 5KL5A 2EOFA 3JTZA 2EPKX 2WBUA 2JWOA 4Q35B 3ADIA 4R2AA 2EM3A 2M1SA 3OMLA 4FK5C 1FKAE 1MGTA 2PRTA 5AC4A 3VYXA 4F2JC 1P47A 4DV1E 5AC5A 2JR1A 1RQ0A 4R2RA 2DRPA 3HQ1A 3EPLA 2UUCE 4JI3E 2WCC3 1SR9A 4Q28A 5KL3A 4KZSA 5IT9C 2YTGA 4MLVA 5LLQA 2EPNA 4DV2E 2YTDA 2UXCE 2MC5A 2FGGA 4M0VA 2EZ6A 2L2KB 4WX9A 2YPNA 2YTOA 3TQMA 1EH8A 2JXPA 4DMIA 5DNYA 2EMAA 2B3TB 2EOHA 2ZM6E 4LF7E 4JYAE 2EM0A 4RHBB 5A6JA 4HEIA 1XMQE 2UXBE 2LTSA 2YTJA 3HPZA 4F6NA 1IMUA 3JAMC 5KL2A 4B3RE 3ADLA 3VK6A 1BB8A 2EM6A 2LO3A 1ZBQA 3BF2A 4LF9E 1HNZE 4DR1E 4OX9E 1UN6B 1EKZA 2YSPA 2E72A 2YTPA 2YRKA 1T4OA 2EMBA 5IXMB 2EOEA 3MHHC 1YSAC 1STUA 1T4NA 4DUZE 2B7VA 4F9BB 4R2DA 2LRSA 3BBGA 3AV0A 4DR5E 1A1LA 2YZTA 2WZOA 4DR7E 2EMKA 4AQYE 1HNWE 1ZU1A 4R03A 2F4VE 1BBOA 2EOIA 3LLHA 2YU8A 1DQ3A 1X6EA 2LTRA 2UUAE 2CPNA 4IS1C 2ODRC 2K7IA 5AE3A 2K4VA 4WXCA 2EPCA 2KHXA 3EPJA 1J26A 3C6MA 1UHZA 4BMJA 1L4SA 1RMDA 2EMXA 2EMYA 3JU0A 1X49A 4JI8E 2EOQA 2IHR1 2LBSB 2EPUA 3KWRA 4LF5E 5IV8B 2EL6A 2LE2A 2L33A 2HC5A 1WJPA 2VE7C 4ZYDA 2EOXA 2R1FA 2JP9A 5A6KA 5BR8E 4HTGA 4NXME 3IWDA 2V87A 1A1JA 2MDRA 2V85A 3L00A 1BBGA 2KOUA 2RS6A 2JY9A 2YT4A 1O0WA 4JI1E 3RMPA 2EM7A 5KL7A 1ZBTA 4LFCE 2FTXB 4P7DA 2L3JA 5AE1A 2YRHA 3THNA 4BCAA 4GEQB 2V89A 1WHNA 4X65E 3M99B 1X48A 2JYAA 2BB8A 2LUPB 1WXRA 2GLIA 2EMCA 2VQFE 1XMOE 1T38A 4DV3E 4WSPA 2CTDA 2EOOA 3ADJA 3T1HE 3DF6A 2EL4A 2RQLA 2EM9A 2M7QA 3KZZA 5KL4A 5LMNE 4LF6E 4R8OA 2MKDA 1TN9A 2MDGA 4X8WA 5FLXC 1T4LB 1UBDC 1G2DC 2JVAA 2VQEE 1JK1A 2ENHA 4L8NA 1XNQE 1PJQA 1UILA 3F6HA 2EE8A 3J80C 4YY3E 2R76A 2EMZA 1F2IG 2DIXA 1EH7A 2LV2A 2EM8A 2V86A 2EPXA 2ELYA 3EPHA 4BS9A 2I9IA 2M4IA 3OTOE 2YTIA 4N4RB 2EPOA 1ZR9A 2LMZA 1T39A 2L8TA 2DLKA 4X9JA 4P78A 1RC7A 2RS7A 3J7AG 1YZ9A 1JK2A 4J8ZA 2RPCA 4BHCA 5ADZA 5A2QC 1Z1BA 3IWBA 5A69A 2JPAA 2EPRA 4R2CA 1PDAA 4WYQB 4KWYA 2ENAA 1NEIA 2LJHA 2YTEA 2N3HA 1DI2A 3QG5C 4X64E 1EH6A 2RSMA 2RTXA 4F9CB 4YHHE 1X47A 2YTQA 2EMHA 3BIDA 2YSOA 2VF1A 3LMLA 2EN2A 2YRMA 1WHQA 2YU5A 4B3ME 2EQ1A 1IBME 4ZYGA 1QU6A 1QNTA 2A25A 3FIGA 1GTKA
chains in the Genus database with same CATH topology
4F2JC 4R2PA 3EPKA 2M9AA 1P47A 2YTNA 2DGCA 2EQ0A 1A1GA 1TF3A 1KJKA 2EM7A 2J7JA 5KL7A 4R2RA 2EN1A 2DRPA 2EMFA 3EPLA 2EOJA 2WCC3 2EN6A 2EOSA 2EORA 2YRHA 5KL3A 1G2FC 2CT1A 2EMIA 2YTGA 2YTDA 4IJDA 4R2QA 3M99B 2NABA 2BB8A 2YTOA 2GLIA 2EMCA 2EMAA 2EOHA 1A1IA 2EOZA 1X5WA 2LCEA 2EM0A 2EN3A 2EQ3A 2CTDA 2EOOA 2LT7A 2YTJA 4F6NA 2EPPA 5KL2A 2DMIA 2EP3A 2EL4A 1BB8A 2EM6A 2EM9A 2EN8A 2EN4A 2LO3A 5KL4A 2YTFA 2HGHA 1DGCA 2EPZA 2ELZA 2MKDA 1TF6A 2MDGA 1TN9A 1UN6B 1LLMC 2YSPA 1UBDC 1G2DC 2E72A 2YTPA 1X6FA 1JK1A 2ENHA 2YRKA 3MHSC 2EMBA 1AAYA 2EOEA 2EE8A 3MHHC 1YSAC 1A1HA 2EOYA 1A1FA 4R2DA 2EMGA 4M9VC 2ADRA 2EL5A 1NCSA 1A1LA 2EMZA 1F2IG 2EOMA 2LV2A 2EJ4A 2VRDA 2EM5A 2EM8A 2EPXA 2ELYA 4R2SA 3UK3C 2MKNA 5KL6A 3EPHA 2EMKA 1ZAAC 1ZU1A 2ENCA 2LVHA 2EMLA 1BBOA 2EOIA 2YTIA 1B69A 1ZR9A 2DLKA 4X9JA 2YU8A 4GZNC 1X6EA 4IS1C 3VHTB 1JK2A 1Z1BA 2RPCA 1YUIA 2JPAA 2I13A 2EPRA 4R2EA 4R2CA 1A1KA 1YUJA 2ENAA 4WSGA 1X6HA 2EPCA 3EPJA 4F6MA 2CSHA 2WBSA 1RMDA 2EMXA 2EMYA 2GHFA 2YTEA 2EOQA 2EMWA 2DLQA 2EPUA 2YTQA 2EM2A 1X3CA 2EL6A 2WBTA 2EMHA 1MEYC 2YSOA 5KL5A 2EOFA 2WBUA 1WJPA 2JP9A 2EOXA 2R1FA 2EN2A 2RSIA 2YRMA 2EN7A 2YU5A 4R2AA 2EPAA 2EM3A 4FK5C 2EQ1A 1A1JA 2PRTA 2A25A 2D9HA 2EM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F2J C;  4R2P A;  3EPK A;  2M9A A;  1P47 A;  2YTN A;  2DGC A;  2EQ0 A;  1A1G A;  1TF3 A;  1KJK A;  2EM7 A;  2J7J A;  5KL7 A;  4R2R A;  2EN1 A;  2DRP A;  2EMF A;  3EPL A;  2EOJ A;  2WCC 3;  2EN6 A;  2EOS A;  2EOR A;  2YRH A;  5KL3 A;  1G2F C;  2CT1 A;  2EMI A;  2YTG A;  2YTD A;  4IJD A;  4R2Q A;  3M99 B;  2NAB A;  2BB8 A;  2YTO A;  2GLI A;  2EMC A;  2EMA A;  2EOH A;  1A1I A;  2EOZ A;  1X5W A;  2LCE A;  2EM0 A;  2EN3 A;  2EQ3 A;  2CTD A;  2EOO A;  2LT7 A;  2YTJ A;  4F6N A;  2EPP A;  5KL2 A;  2DMI A;  2EP3 A;  2EL4 A;  1BB8 A;  2EM6 A;  2EM9 A;  2EN8 A;  2EN4 A;  2LO3 A;  5KL4 A;  2YTF A;  2HGH A;  1DGC A;  2EPZ A;  2ELZ A;  2MKD A;  1TF6 A;  2MDG A;  1TN9 A;  1UN6 B;  1LLM C;  2YSP A;  1UBD C;  1G2D C;  2E72 A;  2YTP A;  1X6F A;  1JK1 A;  2ENH A;  2YRK A;  3MHS C;  2EMB A;  1AAY A;  2EOE A;  2EE8 A;  3MHH C;  1YSA C;  1A1H A;  2EOY A;  1A1F A;  4R2D A;  2EMG A;  4M9V C;  2ADR A;  2EL5 A;  1NCS A;  1A1L A;  2EMZ A;  1F2I G;  2EOM A;  2LV2 A;  2EJ4 A;  2VRD A;  2EM5 A;  2EM8 A;  2EPX A;  2ELY A;  4R2S A;  3UK3 C;  2MKN A;  5KL6 A;  3EPH A;  2EMK A;  1ZAA C;  1ZU1 A;  2ENC A;  2LVH A;  2EML A;  1BBO A;  2EOI A;  2YTI A;  1B69 A;  1ZR9 A;  2DLK A;  4X9J A;  2YU8 A;  4GZN C;  1X6E A;  4IS1 C;  3VHT B;  1JK2 A;  1Z1B A;  2RPC A;  1YUI A;  2JPA A;  2I13 A;  2EPR A;  4R2E A;  4R2C A;  1A1K A;  1YUJ A;  2ENA A;  4WSG A;  1X6H A;  2EPC A;  3EPJ A;  4F6M A;  2CSH A;  2WBS A;  1RMD A;  2EMX A;  2EMY A;  2GHF A;  2YTE A;  2EOQ A;  2EMW A;  2DLQ A;  2EPU A;  2YTQ A;  2EM2 A;  1X3C A;  2EL6 A;  2WBT A;  2EMH A;  1MEY C;  2YSO A;  5KL5 A;  2EOF A;  2WBU A;  1WJP A;  2JP9 A;  2EOX A;  2R1F A;  2EN2 A;  2RSI A;  2YRM A;  2EN7 A;  2YU5 A;  4R2A A;  2EPA A;  2EM3 A;  4FK5 C;  2EQ1 A;  1A1J A;  2PRT A;  2A25 A;  2D9H A;  2EM4 A; 
#chains in the Genus database with same CATH topology
 3IWC A;  3J7Y p;  4R2P A;  2M9A A;  3P1X A;  2E5L E;  2YTN A;  4DV6 E;  2EQ0 A;  1A1G A;  1TF3 A;  1KJK A;  2J7J A;  4K0K E;  2EMF A;  4TUI A;  4LFA E;  2EN6 A;  4O43 A;  2EOS A;  2EOR A;  2CT1 A;  4LF8 E;  4IJD A;  2NAB A;  4DV0 E;  1A1I A;  1PJT A;  2EN3 A;  4DKK A;  2LT7 A;  5T6J A;  1YYO A;  2EPP A;  2GPI A;  3DJW A;  3C4T A;  1KYQ A;  1FJG E;  2EN8 A;  2EN4 A;  1IBK E;  2LJU A;  4DR2 E;  2EPZ A;  2ELZ A;  1TF6 A;  4M2Z A;  4O4K A;  3BGH A;  4GKK E;  1X6F A;  5LMU E;  3MHS C;  5CFF E;  2UXD E;  4LF4 E;  3MSW A;  1A1H A;  2EPL X;  2EOY A;  4TUG A;  2Q8U A;  4M9V C;  2FV4 B;  1NCS A;  2VRD A;  2EM5 A;  3HPS A;  2MKN A;  3UK3 C;  4R2S A;  5KL6 A;  1XNR E;  1YPN A;  2LVH A;  2UUB E;  4WPY A;  2NUF A;  4JI2 E;  1GQE A;  4GZN C;  1N3G A;  5IWA E;  3HTX A;  3T1Y E;  4MLQ A;  4NZV A;  4ZYH A;  3VHT B;  2V83 A;  1YUI A;  2L3C A;  2ODR D;  1A1K A;  1YUJ A;  2E1M A;  1IQS A;  1X6H A;  5AE2 A;  1J5E E;  4JI7 E;  2NUG A;  2DSY A;  2L2N A;  3ADG A;  5A6A A;  2WBS A;  4DR3 E;  2N3G A;  4O5G A;  2NUE A;  4JI5 E;  5TSE A;  2HJJ A;  3F6G A;  2H36 X;  5AAS A;  4DR6 E;  4LU9 A;  4NHR A;  1MEY C;  4O24 A;  2NA2 A;  4F54 A;  2BBG A;  4B3T E;  2RSI A;  3HXL A;  2EN7 A;  2EPA A;  2V88 A;  4X62 E;  1HNX E;  3K6Q A;  2D9H A;  2EM4 A;  4DV7 E;  3EPK A;  2DGC A;  4B3S E;  2LUQ A;  4OOG C;  2EN1 A;  1HR0 E;  4LTY A;  1YFH A;  2EOJ A;  2JOB A;  4BHB A;  4M30 A;  4X66 E;  1G2F C;  4DV5 E;  2EMI A;  3J81 C;  2UU9 E;  5LL6 R;  3H09 A;  4R2Q A;  5A6B A;  4L5N C;  2V8Q B;  3C6K A;  2EOZ A;  1X5W A;  2LCE A;  3ECR A;  2EQ3 A;  2B7T A;  1PJS A;  3ZOQ B;  2DMI A;  4NXN E;  2EP3 A;  4DR4 E;  4RH8 A;  1N34 E;  4GKJ E;  5F3W A;  2YTF A;  2HGH A;  2L2M A;  2KON A;  1DGC A;  3KZY A;  2JOX A;  4DUY E;  3THO B;  2L6M A;  4WFT A;  1LLM C;  2YWQ A;  1WRJ A;  1PKP A;  3VYY A;  1YYW A;  4JI0 E;  1AAY A;  1YYK A;  2EPM X;  2DB2 A;  1IBL E;  1A1F A;  2EMG A;  2ADR A;  4WXD A;  3AUZ A;  2EL5 A;  1N33 E;  2EOM A;  2EJ4 A;  4LFB E;  1I94 E;  1ZAA C;  2ENC A;  1IQO A;  2EML A;  2G7H A;  2F8B A;  1B69 A;  4JI6 E;  1N32 E;  4F9A B;  4KHP E;  4BC9 A;  2N8X A;  3EQ1 A;  2MC6 A;  2HHH E;  4DV4 E;  4I8O A;  1AH5 A;  2I13 A;  4R2E A;  4JI4 E;  4WSG A;  1GZ6 A;  4F6M A;  2CSH A;  3C4B A;  2GHF A;  1SFE A;  5A6B D;  2DMY A;  4BBY A;  2EWL A;  2EMW A;  2DLQ A;  1N36 E;  2B9D A;  2L92 A;  2EM2 A;  1X3C A;  4ZYE A;  2WBT A;  4JV5 E;  4BC7 A;  5KL5 A;  2EOF A;  3JTZ A;  2EPK X;  2WBU A;  2JWO A;  4Q35 B;  3ADI A;  4R2A A;  2EM3 A;  2M1S A;  3OML A;  4FK5 C;  1FKA E;  1MGT A;  2PRT A;  5AC4 A;  3VYX A;  4F2J C;  1P47 A;  4DV1 E;  5AC5 A;  2JR1 A;  1RQ0 A;  4R2R A;  2DRP A;  3HQ1 A;  3EPL A;  2UUC E;  4JI3 E;  2WCC 3;  1SR9 A;  4Q28 A;  5KL3 A;  4KZS A;  5IT9 C;  2YTG A;  4MLV A;  5LLQ A;  2EPN A;  4DV2 E;  2YTD A;  2UXC E;  2MC5 A;  2FGG A;  4M0V A;  2EZ6 A;  2L2K B;  4WX9 A;  2YPN A;  2YTO A;  3TQM A;  1EH8 A;  2JXP A;  4DMI A;  5DNY A;  2EMA A;  2B3T B;  2EOH A;  2ZM6 E;  4LF7 E;  4JYA E;  2EM0 A;  4RHB B;  5A6J A;  4HEI A;  1XMQ E;  2UXB E;  2LTS A;  2YTJ A;  3HPZ A;  4F6N A;  1IMU A;  3JAM C;  5KL2 A;  4B3R E;  3ADL A;  3VK6 A;  1BB8 A;  2EM6 A;  2LO3 A;  1ZBQ A;  3BF2 A;  4LF9 E;  1HNZ E;  4DR1 E;  4OX9 E;  1UN6 B;  1EKZ A;  2YSP A;  2E72 A;  2YTP A;  2YRK A;  1T4O A;  2EMB A;  5IXM B;  2EOE A;  3MHH C;  1YSA C;  1STU A;  1T4N A;  4DUZ E;  2B7V A;  4F9B B;  4R2D A;  2LRS A;  3BBG A;  3AV0 A;  4DR5 E;  1A1L A;  2YZT A;  2WZO A;  4DR7 E;  2EMK A;  4AQY E;  1HNW E;  1ZU1 A;  4R03 A;  2F4V E;  1BBO A;  2EOI A;  3LLH A;  2YU8 A;  1DQ3 A;  1X6E A;  2LTR A;  2UUA E;  2CPN A;  4IS1 C;  2ODR C;  2K7I A;  5AE3 A;  2K4V A;  4WXC A;  2EPC A;  2KHX A;  3EPJ A;  1J26 A;  3C6M A;  1UHZ A;  4BMJ A;  1L4S A;  1RMD A;  2EMX A;  2EMY A;  3JU0 A;  1X49 A;  4JI8 E;  2EOQ A;  2IHR 1;  2LBS B;  2EPU A;  3KWR A;  4LF5 E;  5IV8 B;  2EL6 A;  2LE2 A;  2L33 A;  2HC5 A;  1WJP A;  2VE7 C;  4ZYD A;  2EOX A;  2R1F A;  2JP9 A;  5A6K A;  5BR8 E;  4HTG A;  4NXM E;  3IWD A;  2V87 A;  1A1J A;  2MDR A;  2V85 A;  3L00 A;  1BBG A;  2KOU A;  2RS6 A;  2JY9 A;  2YT4 A;  1O0W A;  4JI1 E;  3RMP A;  2EM7 A;  5KL7 A;  1ZBT A;  4LFC E;  2FTX B;  4P7D A;  2L3J A;  5AE1 A;  2YRH A;  3THN A;  4BCA A;  4GEQ B;  2V89 A;  1WHN A;  4X65 E;  3M99 B;  1X48 A;  2JYA A;  2BB8 A;  2LUP B;  1WXR A;  2GLI A;  2EMC A;  2VQF E;  1XMO E;  1T38 A;  4DV3 E;  4WSP A;  2CTD A;  2EOO A;  3ADJ A;  3T1H E;  3DF6 A;  2EL4 A;  2RQL A;  2EM9 A;  2M7Q A;  3KZZ A;  5KL4 A;  5LMN E;  4LF6 E;  4R8O A;  2MKD A;  1TN9 A;  2MDG A;  4X8W A;  5FLX C;  1T4L B;  1UBD C;  1G2D C;  2JVA A;  2VQE E;  1JK1 A;  2ENH A;  4L8N A;  1XNQ E;  1PJQ A;  1UIL A;  3F6H A;  2EE8 A;  3J80 C;  4YY3 E;  2R76 A;  2EMZ A;  1F2I G;  2DIX A;  1EH7 A;  2LV2 A;  2EM8 A;  2V86 A;  2EPX A;  2ELY A;  3EPH A;  4BS9 A;  2I9I A;  2M4I A;  3OTO E;  2YTI A;  4N4R B;  2EPO A;  1ZR9 A;  2LMZ A;  1T39 A;  2L8T A;  2DLK A;  4X9J A;  4P78 A;  1RC7 A;  2RS7 A;  3J7A G;  1YZ9 A;  1JK2 A;  4J8Z A;  2RPC A;  4BHC A;  5ADZ A;  5A2Q C;  1Z1B A;  3IWB A;  5A69 A;  2JPA A;  2EPR A;  4R2C A;  1PDA A;  4WYQ B;  4KWY A;  2ENA A;  1NEI A;  2LJH A;  2YTE A;  2N3H A;  1DI2 A;  3QG5 C;  4X64 E;  1EH6 A;  2RSM A;  2RTX A;  4F9C B;  4YHH E;  1X47 A;  2YTQ A;  2EMH A;  3BID A;  2YSO A;  2VF1 A;  3LML A;  2EN2 A;  2YRM A;  1WHQ A;  2YU5 A;  4B3M E;  2EQ1 A;  1IBM E;  4ZYG A;  1QU6 A;  1QNT A;  2A25 A;  3FIG A;  1GTK A; 
#chains in the Genus database with same CATH homology
 4F2J C;  4R2P A;  3EPK A;  2M9A A;  1P47 A;  2YTN A;  2DGC A;  2EQ0 A;  1A1G A;  1TF3 A;  1KJK A;  2EM7 A;  2J7J A;  5KL7 A;  4R2R A;  2EN1 A;  2DRP A;  2EMF A;  3EPL A;  2EOJ A;  2WCC 3;  2EN6 A;  2EOS A;  2EOR A;  2YRH A;  5KL3 A;  1G2F C;  2CT1 A;  2EMI A;  2YTG A;  2YTD A;  4IJD A;  4R2Q A;  3M99 B;  2NAB A;  2BB8 A;  2YTO A;  2GLI A;  2EMC A;  2EMA A;  2EOH A;  1A1I A;  2EOZ A;  1X5W A;  2LCE A;  2EM0 A;  2EN3 A;  2EQ3 A;  2CTD A;  2EOO A;  2LT7 A;  2YTJ A;  4F6N A;  2EPP A;  5KL2 A;  2DMI A;  2EP3 A;  2EL4 A;  1BB8 A;  2EM6 A;  2EM9 A;  2EN8 A;  2EN4 A;  2LO3 A;  5KL4 A;  2YTF A;  2HGH A;  1DGC A;  2EPZ A;  2ELZ A;  2MKD A;  1TF6 A;  2MDG A;  1TN9 A;  1UN6 B;  1LLM C;  2YSP A;  1UBD C;  1G2D C;  2E72 A;  2YTP A;  1X6F A;  1JK1 A;  2ENH A;  2YRK A;  3MHS C;  2EMB A;  1AAY A;  2EOE A;  2EE8 A;  3MHH C;  1YSA C;  1A1H A;  2EOY A;  1A1F A;  4R2D A;  2EMG A;  4M9V C;  2ADR A;  2EL5 A;  1NCS A;  1A1L A;  2EMZ A;  1F2I G;  2EOM A;  2LV2 A;  2EJ4 A;  2VRD A;  2EM5 A;  2EM8 A;  2EPX A;  2ELY A;  4R2S A;  3UK3 C;  2MKN A;  5KL6 A;  3EPH A;  2EMK A;  1ZAA C;  1ZU1 A;  2ENC A;  2LVH A;  2EML A;  1BBO A;  2EOI A;  2YTI A;  1B69 A;  1ZR9 A;  2DLK A;  4X9J A;  2YU8 A;  4GZN C;  1X6E A;  4IS1 C;  3VHT B;  1JK2 A;  1Z1B A;  2RPC A;  1YUI A;  2JPA A;  2I13 A;  2EPR A;  4R2E A;  4R2C A;  1A1K A;  1YUJ A;  2ENA A;  4WSG A;  1X6H A;  2EPC A;  3EPJ A;  4F6M A;  2CSH A;  2WBS A;  1RMD A;  2EMX A;  2EMY A;  2GHF A;  2YTE A;  2EOQ A;  2EMW A;  2DLQ A;  2EPU A;  2YTQ A;  2EM2 A;  1X3C A;  2EL6 A;  2WBT A;  2EMH A;  1MEY C;  2YSO A;  5KL5 A;  2EOF A;  2WBU A;  1WJP A;  2JP9 A;  2EOX A;  2R1F A;  2EN2 A;  2RSI A;  2YRM A;  2EN7 A;  2YU5 A;  4R2A A;  2EPA A;  2EM3 A;  4FK5 C;  2EQ1 A;  1A1J A;  2PRT A;  2A25 A;  2D9H A;  2EM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...