3P1XA

Crystal structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin enhancer-binding factor 3
publication title Crystal structure of DRBM 2 domain of Interleukin enhancer-binding factor 3 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4527E
rcsb
molecule tags Transcription regulator
total genus 11
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3p1xA00
2LUQA 4JI6E 1T4NA 2YT4A 4X62E 4DUZE 4DV5E 1HNWE 4JI0E 2RS7A 1I94E 2RS6A 1FKAE 2L33A 4LF4E 1HNXE 5BR8E 1IBKE 3ADJA 1HR0E 4DR4E 5CFFE 4DV1E 3OTOE 1PKPA 3VYYA 4DR1E 2L2KB 1X48A 4JI5E 2F4VE 3T1HE 1HNZE 2UUCE 4B3RE 1N34E 4JYAE 2LUPB 4NXNE 1STUA 2VQEE 2HHHE 1XMOE 4WYQB 1T4LB 1UHZA 3C4TA 4DKKA 4JV5E 1QU6A 5IWAE 4LF9E 4GKJE 3T1YE 1IBME 4DR7E 2RSMA 2EZ6A 2LJHA 2VQFE 2N3GA 3J7Yp 4DUYE 3ADLA 4KHPE 2UXBE 4LFBE 1N32E 4K0KE 4X64E 4X66E 4X8WA 2MDRA 4DV2E 1DI2A 4LF6E 1WHQA 2UUBE 3P1XA 2NUGA 4GKKE 4JI7E 4B3TE 2CPNA 3LLHA 1FJGE 4DV7E 2UXDE 4WFTA 4LF5E 4JI4E 1J26A 2DMYA 1WHNA 2LRSA 1ZBTA 4DR3E 5LMUE 2UXCE 1J5EE 3VYXA 4LFCE 4NXME 4LF7E 2L2NA 2L2MA 2DIXA 1RQ0A 1YZ9A 4DV6E 3ADGA 2L3JA 1O0WA 4YHHE 4DR5E 4LF8E 2LTRA 1X47A 1N33E 4JI3E 4DV4E 2IHR1 1N36E 3ADIA 1UILA 4LFAE 2LBSB 4YY3E 4X65E 1YYOA 2DB2A 4JI2E 4AQYE 2UUAE 1YYWA 1GQEA 2UU9E 4M2ZA 2L3CA 4DV3E 1EKZA 2LTSA 1XMQE 2KHXA 1X49A 2N3HA 4M30A 4JI8E 2ZM6E 4DV0E 2NUFA 3HTXA 2NA2A 2JVAA 1RC7A 2B3TB 2JY9A 4B3SE 1XNRE 1YYKA 4OOGC 1IBLE 2B7VA 4DR2E 5LMNE 2B7TA 2E5LE 4B3ME 2RTXA 1XNQE 2NUEA 4OX9E 4JI1E 3C4BA 4DR6E 1T4OA
chains in the Genus database with same CATH superfamily
2EQ1A 2EMFA 2ELZA 4X62E 2EN3A 2EL5A 1KJKA 3QG5C 2YTDA 4R03A 2DLKA 2YTIA 2RS7A 2YTFA 1I94E 2YTQA 2CSHA 1PDAA 1FKAE 2FV4B 4KWYA 2EPNA 3BIDA 3ADJA 5ADZA 2LCEA 2FTXB 1T39A 2YRHA 4DV1E 1UN6B 1PKPA 2EL6A 4P7DA 1DGCA 2EQ0A 4R8OA 2L2KB 2F4VE 2LJUA 1HNZE 2UUCE 1BBOA 2V89A 2MDGA 3HQ1A 2EN1A 4BC9A 4F9CB 2RSIA 2ODRD 2JP9A 3C4TA 2JYAA 1AH5A 4IJDA 3AUZA 5F3WA 5T6JA 2HJJA 5KL2A 1IBME 4DR7E 2EZ6A 2LJHA 2VQFE 3J7Yp 4ZYDA 4LFBE 2CT1A 4X64E 2RPCA 4LU9A 3P1XA 5KL7A 4GKKE 2CPNA 2ODRC 2EPRA 2UXDE 4WFTA 1J26A 1WHNA 4DR3E 3HPZA 2DRPA 2UXCE 3HXLA 2V8QB 3VYXA 1PJSA 1RMDA 2YSOA 2EPZA 4LFCE 2L2MA 5KL5A 2YTJA 4NZVA 3EPJA 3IWCA 2L8TA 3EQ1A 4WX9A 2EOFA 2IHR1 2EN8A 3J81C 4GEQB 5KL6A 4YY3E 4Q28A 4X65E 2V85A 1IQOA 2DB2A 4AQYE 2EMXA 3ECRA 4R2CA 1X49A 2JR1A 2ADRA 4P78A 4ZYEA 2EN2A 2NA2A 2EPKX 3H09A 3VK6A 5A6BA 1B69A 2EN6A 2ENAA 4I8OA 1X5WA 4ZYGA 5AE3A 4M9VC 1BB8A 1X6EA 5A6JA 2GLIA 2B7VA 5LLQA 5LMNE 2Q8UA 4B3ME 5AE2A 2EP3A 4DR6E 2EMBA 1T4OA 3JAMC 2YT4A 4DUZE 4F6NA 4R2EA 2M1SA 1HNWE 4JI0E 2EOZA 2L33A 4LF4E 1ZBQA 2WBSA 1IBKE 3EPKA 2JOBA 4WXCA 2YTGA 2EPMX 2DMIA 5AASA 5AC4A 1IMUA 3F6GA 2YRKA 2YTOA 1X48A 1UBDC 1N34E 3J80C 2EMLA 2JXPA 3JTZA 1A1LA 4NXNE 3DF6A 2EM9A 1XMOE 3EPLA 2FGGA 1A1KA 2JPAA 2V86A 4DKKA 1YUIA 2WBTA 3THNA 4LF9E 2LV2A 3T1YE 2RSMA 3ADLA 1X3CA 5IV8B 4FK5C 4F9BB 4R2PA 2UXBE 4L8NA 4K0KE 2I9IA 2EMZA 3ZOQB 4X8WA 2MDRA 2F8BA 4DV2E 1WHQA 2UUBE 3JU0A 1L4SA 2WBUA 5A6AA 2LO3A 1FJGE 2LE2A 5DNYA 5LMUE 2EM3A 2EJ4A 4R2RA 5KL3A 1YPNA 2LMZA 2EM2A 2L2NA 3THOB 2DSYA 1YZ9A 2E72A 4O5GA 3ADGA 2DGCA 1O0WA 2LTRA 3K6QA 1N33E 4O43A 3MHHC 3ADIA 1QNTA 2K7IA 4R2QA 1YYOA 1YYWA 4M2ZA 1XMQE 2KHXA 1A1GA 3HTXA 4M30A 2WZOA 3DJWA 1SR9A 2M7QA 2JVAA 2BB8A 3OMLA 1XNRE 4OOGC 3HPSA 1T38A 4JI1E 4DMIA 2YTEA 4BHBA 2RTXA 1TF6A 5IXMB 2K4VA 2LUQA 2L6MA 1T4NA 1EH8A 2YTPA 4NHRA 4R2DA 5A6BD 5LL6R 4RHBB 4BMJA 4X9JA 3MSWA 4O24A 4MLQA 2ENCA 2RQLA 1HNXE 2YZTA 2EMAA 5BR8E 4IS1C 2EPAA 4LTYA 3IWBA 1PJQA 1HR0E 4DR4E 2EQ3A 1A1JA 3VYYA 2EPUA 1NCSA 4JI5E 2EMKA 4JYAE 2LUPB 2EL4A 2EOSA 4R2SA 2VQEE 1AAYA 1G2FC 4BCAA 2YWQA 4WYQB 4WXDA 2EOYA 4JV5E 5KL4A 1QU6A 5IWAE 2V88A 4GKJE 2EM0A 1YSAC 2MC6A 2N3GA 4DUYE 1PJTA 2EWLA 2KOUA 1MGTA 2EPXA 5IT9C 2EOJA 2LVHA 3TQMA 1BBGA 2EM8A 3KZZA 1A1FA 2EOXA 2WCC3 2HC5A 3LLHA 2EM6A 1WJPA 2EPCA 3BF2A 4L5NC 4LF5E 5A2QC 1A1HA 1ZBTA 1KYQA 2EOEA 1JK1A 3MHSC 1J5EE 4BHCA 4LF7E 1MEYC 1WXRA 3L00A 2GHFA 2EM5A 2GPIA 4TUIA 4JI3E 1NEIA 4DV4E 2EMGA 2MKDA 4TUGA 2VRDA 1UILA 4LFAE 5A69A 2LBSB 2EOOA 4WSPA 4MLVA 2G7HA 4HEIA 1GQEA 2UU9E 3M99B 2ELYA 2LTSA 4JI8E 2ZM6E 2NUFA 4F9AB 2EPLX 4F54A 1RC7A 2B3TB 2MKNA 1X6FA 4B3SE 1YYKA 2J7JA 2EM4A 2PRTA 1IBLE 2YU5A 3J7AG 1Z1BA 2NUEA 2YTNA 4OX9E 3IWDA 1F2IG 3VHTB 1ZR9A 4N4RB 2N8XA 4JI6E 4DV5E 1YFHA 2RS6A 1IQSA 4R2AA 4GZNC 2EMWA 2EE8A 1ZU1A 2EPPA 2CTDA 2NABA 2JWOA 3BBGA 3KWRA 3C6KA 2V83A 1EH6A 5CFFE 2YSPA 2LT7A 2EM7A 3OTOE 4DR1E 1WRJA 3T1HE 1P47A 2BBGA 4B3RE 1STUA 4KZSA 5AE1A 2HHHE 2YU8A 1A1IA 3AV0A 1TN9A 2M4IA 2EMYA 5AC5A 1T4LB 1UHZA 3F6HA 2L92A 4BBYA 2YPNA 2EOMA 2EMCA 3C6MA 4KHPE 2KONA 1N32E 2MC5A 4X66E 1YUJA 2R76A 5TSEA 1DI2A 4LF6E 4ZYHA 2NUGA 2EPOA 1N3GA 4JI7E 4B3TE 4M0VA 4DV7E 4JI4E 2A25A 2DMYA 2LRSA 4WSGA 4NXME 4F2JC 2B9DA 2YRMA 1GTKA 2DIXA 1TF3A 1RQ0A 3KZYA 2M9AA 2E1MA 4DV6E 2L3JA 2EMHA 2EN4A 4YHHE 3FIGA 4DR5E 4LF8E 3UK3C 1X47A 2H36X 1N36E 2EOIA 1EH7A 4JI2E 3LMLA 2UUAE 4J8ZA 1GZ6A 4HTGA 1JK2A 5A6KA 2L3CA 4DV3E 1EKZA 2I13A 2EOQA 4BS9A 1DQ3A 2N3HA 4RH8A 2EORA 4DV0E 4F6MA 3RMPA 2EN7A 4O4KA 2VE7C 2HGHA 1X6HA 2JY9A 2V87A 1SFEA 2JOXA 5FLXC 2ENHA 3EPHA 4DR2E 2B7TA 2E5LE 2VF1A 4BC7A 4Q35B 1G2DC 2D9HA 4WPYA 3BGHA 2DLQA 1ZAAC 1XNQE 2EOHA 2EMIA 1LLMC 3C4BA 2R1FA
chains in the Genus database with same CATH topology
2LUQA 2L6MA 3JAMC 4JI6E 1T4NA 2YT4A 4X62E 4DUZE 4DV5E 5LL6R 1HNWE 2M1SA 4JI0E 4R03A 4BMJA 2RS7A 1I94E 3MSWA 2RS6A 1FKAE 2L33A 4LF4E 1HNXE 1ZBQA 2FV4B 2YZTA 5BR8E 4LTYA 1IBKE 2JOBA 2JWOA 3IWBA 2ZM6E 3KWRA 5ADZA 3ADJA 2V83A 1HR0E 5AASA 2FTXB 4DR4E 5CFFE 4DV1E 3OTOE 1PKPA 3F6GA 3VYYA 4P7DA 4R8OA 4DR1E 1X48A 2L2KB 4JI5E 2F4VE 3T1HE 1HNZE 2UUCE 4B3RE 1N34E 4JYAE 3J80C 2V89A 2LUPB 3JTZA 3HQ1A 4NXNE 1STUA 4KZSA 5AE1A 2VQEE 3DF6A 2HHHE 4BC9A 1XMOE 3AV0A 4BCAA 2FGGA 2M4IA 4F9CB 2ODRD 4WYQB 1T4LB 2V86A 1UHZA 3C4TA 3F6HA 2L92A 4DKKA 4JV5E 4BBYA 3AUZA 1QU6A 5IWAE 2V88A 5F3WA 4LF9E 4GKJE 5T6JA 3T1YE 1IBME 4DR7E 2MC6A 2RSMA 2EZ6A 2LJHA 2VQFE 2N3GA 3J7Yp 4DUYE 3ADLA 4KHPE 4F9BB 4LFBE 2UXBE 2KONA 4L8NA 2MC5A 1N32E 2EWLA 4K0KE 2KOUA 4X64E 4LU9A 4X66E 5IT9C 3ZOQB 4X8WA 2MDRA 2F8BA 4DV2E 1DI2A 4LF6E 1WHQA 2UUBE 3JU0A 3P1XA 2NUGA 4GKKE 4JI7E 4B3TE 2CPNA 2ODRC 3LLHA 4M0VA 4DV7E 1FJGE 2UXDE 2LE2A 4WFTA 4L5NC 4JI4E 4LF5E 5A2QC 2DMYA 1WHNA 2LRSA 1ZBTA 5DNYA 4DR3E 1J26A 3HPZA 5LMUE 2UXCE 3HXLA 1J5EE 2V8QB 3VYXA 4LFCE 4NXME 2LMZA 2B9DA 2L2NA 2L2MA 4LF7E 2DIXA 1WXRA 1RQ0A 2DSYA 1YZ9A 3HTXA 2E1MA 4DV6E 1T4OA 3ADGA 2L3JA 3IWCA 1O0WA 4YHHE 3FIGA 2L8TA 2LTRA 3K6QA 1X47A 2H36X 4DV0E 4TUIA 4DR5E 4JI3E 4LF8E 1N33E 4DV4E 2IHR1 1N36E 3ADIA 3J81C 4TUGA 1UILA 4LFAE 4GEQB 2LBSB 4YY3E 4Q28A 4X65E 1YYOA 2V85A 4WSPA 2DB2A 4JI2E 3LMLA 2G7HA 4AQYE 2UUAE 4J8ZA 1GQEA 1GZ6A 2NUFA 2UU9E 2L3CA 4M2ZA 4DV3E 1EKZA 2LTSA 1YYWA 4BS9A 1XMQE 1DQ3A 1X49A 2JR1A 2KHXA 2N3HA 2WZOA 3DJWA 1SR9A 4M30A 4P78A 2M7QA 4JI8E 2NA2A 3H09A 2JVAA 3VK6A 4F54A 4F9AB 3RMPA 1RC7A 2VE7C 2B3TB 3OMLA 4I8OA 2JY9A 2V87A 5AE3A 4B3SE 2JOXA 4OOGC 1XNRE 1YYKA 5FLXC 1IBLE 2B7VA 3HPSA 4DR2E 4DMIA 5LMNE 2B7TA 3J7AG 2E5LE 2VF1A 4BC7A 4B3ME 4WPYA 2RTXA 5AE2A 1XNQE 2NUEA 4OX9E 3IWDA 4JI1E 3C4BA 4DR6E 2K4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUQ A;  4JI6 E;  1T4N A;  2YT4 A;  4X62 E;  4DUZ E;  4DV5 E;  1HNW E;  4JI0 E;  2RS7 A;  1I94 E;  2RS6 A;  1FKA E;  2L33 A;  4LF4 E;  1HNX E;  5BR8 E;  1IBK E;  3ADJ A;  1HR0 E;  4DR4 E;  5CFF E;  4DV1 E;  3OTO E;  1PKP A;  3VYY A;  4DR1 E;  2L2K B;  1X48 A;  4JI5 E;  2F4V E;  3T1H E;  1HNZ E;  2UUC E;  4B3R E;  1N34 E;  4JYA E;  2LUP B;  4NXN E;  1STU A;  2VQE E;  2HHH E;  1XMO E;  4WYQ B;  1T4L B;  1UHZ A;  3C4T A;  4DKK A;  4JV5 E;  1QU6 A;  5IWA E;  4LF9 E;  4GKJ E;  3T1Y E;  1IBM E;  4DR7 E;  2RSM A;  2EZ6 A;  2LJH A;  2VQF E;  2N3G A;  3J7Y p;  4DUY E;  3ADL A;  4KHP E;  2UXB E;  4LFB E;  1N32 E;  4K0K E;  4X64 E;  4X66 E;  4X8W A;  2MDR A;  4DV2 E;  1DI2 A;  4LF6 E;  1WHQ A;  2UUB E;  3P1X A;  2NUG A;  4GKK E;  4JI7 E;  4B3T E;  2CPN A;  3LLH A;  1FJG E;  4DV7 E;  2UXD E;  4WFT A;  4LF5 E;  4JI4 E;  1J26 A;  2DMY A;  1WHN A;  2LRS A;  1ZBT A;  4DR3 E;  5LMU E;  2UXC E;  1J5E E;  3VYX A;  4LFC E;  4NXM E;  4LF7 E;  2L2N A;  2L2M A;  2DIX A;  1RQ0 A;  1YZ9 A;  4DV6 E;  3ADG A;  2L3J A;  1O0W A;  4YHH E;  4DR5 E;  4LF8 E;  2LTR A;  1X47 A;  1N33 E;  4JI3 E;  4DV4 E;  2IHR 1;  1N36 E;  3ADI A;  1UIL A;  4LFA E;  2LBS B;  4YY3 E;  4X65 E;  1YYO A;  2DB2 A;  4JI2 E;  4AQY E;  2UUA E;  1YYW A;  1GQE A;  2UU9 E;  4M2Z A;  2L3C A;  4DV3 E;  1EKZ A;  2LTS A;  1XMQ E;  2KHX A;  1X49 A;  2N3H A;  4M30 A;  4JI8 E;  2ZM6 E;  4DV0 E;  2NUF A;  3HTX A;  2NA2 A;  2JVA A;  1RC7 A;  2B3T B;  2JY9 A;  4B3S E;  1XNR E;  1YYK A;  4OOG C;  1IBL E;  2B7V A;  4DR2 E;  5LMN E;  2B7T A;  2E5L E;  4B3M E;  2RTX A;  1XNQ E;  2NUE A;  4OX9 E;  4JI1 E;  3C4B A;  4DR6 E;  1T4O A; 
#chains in the Genus database with same CATH topology
 2EQ1 A;  2EMF A;  2ELZ A;  4X62 E;  2EN3 A;  2EL5 A;  1KJK A;  3QG5 C;  2YTD A;  4R03 A;  2DLK A;  2YTI A;  2RS7 A;  2YTF A;  1I94 E;  2YTQ A;  2CSH A;  1PDA A;  1FKA E;  2FV4 B;  4KWY A;  2EPN A;  3BID A;  3ADJ A;  5ADZ A;  2LCE A;  2FTX B;  1T39 A;  2YRH A;  4DV1 E;  1UN6 B;  1PKP A;  2EL6 A;  4P7D A;  1DGC A;  2EQ0 A;  4R8O A;  2L2K B;  2F4V E;  2LJU A;  1HNZ E;  2UUC E;  1BBO A;  2V89 A;  2MDG A;  3HQ1 A;  2EN1 A;  4BC9 A;  4F9C B;  2RSI A;  2ODR D;  2JP9 A;  3C4T A;  2JYA A;  1AH5 A;  4IJD A;  3AUZ A;  5F3W A;  5T6J A;  2HJJ A;  5KL2 A;  1IBM E;  4DR7 E;  2EZ6 A;  2LJH A;  2VQF E;  3J7Y p;  4ZYD A;  4LFB E;  2CT1 A;  4X64 E;  2RPC A;  4LU9 A;  3P1X A;  5KL7 A;  4GKK E;  2CPN A;  2ODR C;  2EPR A;  2UXD E;  4WFT A;  1J26 A;  1WHN A;  4DR3 E;  3HPZ A;  2DRP A;  2UXC E;  3HXL A;  2V8Q B;  3VYX A;  1PJS A;  1RMD A;  2YSO A;  2EPZ A;  4LFC E;  2L2M A;  5KL5 A;  2YTJ A;  4NZV A;  3EPJ A;  3IWC A;  2L8T A;  3EQ1 A;  4WX9 A;  2EOF A;  2IHR 1;  2EN8 A;  3J81 C;  4GEQ B;  5KL6 A;  4YY3 E;  4Q28 A;  4X65 E;  2V85 A;  1IQO A;  2DB2 A;  4AQY E;  2EMX A;  3ECR A;  4R2C A;  1X49 A;  2JR1 A;  2ADR A;  4P78 A;  4ZYE A;  2EN2 A;  2NA2 A;  2EPK X;  3H09 A;  3VK6 A;  5A6B A;  1B69 A;  2EN6 A;  2ENA A;  4I8O A;  1X5W A;  4ZYG A;  5AE3 A;  4M9V C;  1BB8 A;  1X6E A;  5A6J A;  2GLI A;  2B7V A;  5LLQ A;  5LMN E;  2Q8U A;  4B3M E;  5AE2 A;  2EP3 A;  4DR6 E;  2EMB A;  1T4O A;  3JAM C;  2YT4 A;  4DUZ E;  4F6N A;  4R2E A;  2M1S A;  1HNW E;  4JI0 E;  2EOZ A;  2L33 A;  4LF4 E;  1ZBQ A;  2WBS A;  1IBK E;  3EPK A;  2JOB A;  4WXC A;  2YTG A;  2EPM X;  2DMI A;  5AAS A;  5AC4 A;  1IMU A;  3F6G A;  2YRK A;  2YTO A;  1X48 A;  1UBD C;  1N34 E;  3J80 C;  2EML A;  2JXP A;  3JTZ A;  1A1L A;  4NXN E;  3DF6 A;  2EM9 A;  1XMO E;  3EPL A;  2FGG A;  1A1K A;  2JPA A;  2V86 A;  4DKK A;  1YUI A;  2WBT A;  3THN A;  4LF9 E;  2LV2 A;  3T1Y E;  2RSM A;  3ADL A;  1X3C A;  5IV8 B;  4FK5 C;  4F9B B;  4R2P A;  2UXB E;  4L8N A;  4K0K E;  2I9I A;  2EMZ A;  3ZOQ B;  4X8W A;  2MDR A;  2F8B A;  4DV2 E;  1WHQ A;  2UUB E;  3JU0 A;  1L4S A;  2WBU A;  5A6A A;  2LO3 A;  1FJG E;  2LE2 A;  5DNY A;  5LMU E;  2EM3 A;  2EJ4 A;  4R2R A;  5KL3 A;  1YPN A;  2LMZ A;  2EM2 A;  2L2N A;  3THO B;  2DSY A;  1YZ9 A;  2E72 A;  4O5G A;  3ADG A;  2DGC A;  1O0W A;  2LTR A;  3K6Q A;  1N33 E;  4O43 A;  3MHH C;  3ADI A;  1QNT A;  2K7I A;  4R2Q A;  1YYO A;  1YYW A;  4M2Z A;  1XMQ E;  2KHX A;  1A1G A;  3HTX A;  4M30 A;  2WZO A;  3DJW A;  1SR9 A;  2M7Q A;  2JVA A;  2BB8 A;  3OML A;  1XNR E;  4OOG C;  3HPS A;  1T38 A;  4JI1 E;  4DMI A;  2YTE A;  4BHB A;  2RTX A;  1TF6 A;  5IXM B;  2K4V A;  2LUQ A;  2L6M A;  1T4N A;  1EH8 A;  2YTP A;  4NHR A;  4R2D A;  5A6B D;  5LL6 R;  4RHB B;  4BMJ A;  4X9J A;  3MSW A;  4O24 A;  4MLQ A;  2ENC A;  2RQL A;  1HNX E;  2YZT A;  2EMA A;  5BR8 E;  4IS1 C;  2EPA A;  4LTY A;  3IWB A;  1PJQ A;  1HR0 E;  4DR4 E;  2EQ3 A;  1A1J A;  3VYY A;  2EPU A;  1NCS A;  4JI5 E;  2EMK A;  4JYA E;  2LUP B;  2EL4 A;  2EOS A;  4R2S A;  2VQE E;  1AAY A;  1G2F C;  4BCA A;  2YWQ A;  4WYQ B;  4WXD A;  2EOY A;  4JV5 E;  5KL4 A;  1QU6 A;  5IWA E;  2V88 A;  4GKJ E;  2EM0 A;  1YSA C;  2MC6 A;  2N3G A;  4DUY E;  1PJT A;  2EWL A;  2KOU A;  1MGT A;  2EPX A;  5IT9 C;  2EOJ A;  2LVH A;  3TQM A;  1BBG A;  2EM8 A;  3KZZ A;  1A1F A;  2EOX A;  2WCC 3;  2HC5 A;  3LLH A;  2EM6 A;  1WJP A;  2EPC A;  3BF2 A;  4L5N C;  4LF5 E;  5A2Q C;  1A1H A;  1ZBT A;  1KYQ A;  2EOE A;  1JK1 A;  3MHS C;  1J5E E;  4BHC A;  4LF7 E;  1MEY C;  1WXR A;  3L00 A;  2GHF A;  2EM5 A;  2GPI A;  4TUI A;  4JI3 E;  1NEI A;  4DV4 E;  2EMG A;  2MKD A;  4TUG A;  2VRD A;  1UIL A;  4LFA E;  5A69 A;  2LBS B;  2EOO A;  4WSP A;  4MLV A;  2G7H A;  4HEI A;  1GQE A;  2UU9 E;  3M99 B;  2ELY A;  2LTS A;  4JI8 E;  2ZM6 E;  2NUF A;  4F9A B;  2EPL X;  4F54 A;  1RC7 A;  2B3T B;  2MKN A;  1X6F A;  4B3S E;  1YYK A;  2J7J A;  2EM4 A;  2PRT A;  1IBL E;  2YU5 A;  3J7A G;  1Z1B A;  2NUE A;  2YTN A;  4OX9 E;  3IWD A;  1F2I G;  3VHT B;  1ZR9 A;  4N4R B;  2N8X A;  4JI6 E;  4DV5 E;  1YFH A;  2RS6 A;  1IQS A;  4R2A A;  4GZN C;  2EMW A;  2EE8 A;  1ZU1 A;  2EPP A;  2CTD A;  2NAB A;  2JWO A;  3BBG A;  3KWR A;  3C6K A;  2V83 A;  1EH6 A;  5CFF E;  2YSP A;  2LT7 A;  2EM7 A;  3OTO E;  4DR1 E;  1WRJ A;  3T1H E;  1P47 A;  2BBG A;  4B3R E;  1STU A;  4KZS A;  5AE1 A;  2HHH E;  2YU8 A;  1A1I A;  3AV0 A;  1TN9 A;  2M4I A;  2EMY A;  5AC5 A;  1T4L B;  1UHZ A;  3F6H A;  2L92 A;  4BBY A;  2YPN A;  2EOM A;  2EMC A;  3C6M A;  4KHP E;  2KON A;  1N32 E;  2MC5 A;  4X66 E;  1YUJ A;  2R76 A;  5TSE A;  1DI2 A;  4LF6 E;  4ZYH A;  2NUG A;  2EPO A;  1N3G A;  4JI7 E;  4B3T E;  4M0V A;  4DV7 E;  4JI4 E;  2A25 A;  2DMY A;  2LRS A;  4WSG A;  4NXM E;  4F2J C;  2B9D A;  2YRM A;  1GTK A;  2DIX A;  1TF3 A;  1RQ0 A;  3KZY A;  2M9A A;  2E1M A;  4DV6 E;  2L3J A;  2EMH A;  2EN4 A;  4YHH E;  3FIG A;  4DR5 E;  4LF8 E;  3UK3 C;  1X47 A;  2H36 X;  1N36 E;  2EOI A;  1EH7 A;  4JI2 E;  3LML A;  2UUA E;  4J8Z A;  1GZ6 A;  4HTG A;  1JK2 A;  5A6K A;  2L3C A;  4DV3 E;  1EKZ A;  2I13 A;  2EOQ A;  4BS9 A;  1DQ3 A;  2N3H A;  4RH8 A;  2EOR A;  4DV0 E;  4F6M A;  3RMP A;  2EN7 A;  4O4K A;  2VE7 C;  2HGH A;  1X6H A;  2JY9 A;  2V87 A;  1SFE A;  2JOX A;  5FLX C;  2ENH A;  3EPH A;  4DR2 E;  2B7T A;  2E5L E;  2VF1 A;  4BC7 A;  4Q35 B;  1G2D C;  2D9H A;  4WPY A;  3BGH A;  2DLQ A;  1ZAA C;  1XNQ E;  2EOH A;  2EMI A;  1LLM C;  3C4B A;  2R1F A; 
#chains in the Genus database with same CATH homology
 2LUQ A;  2L6M A;  3JAM C;  4JI6 E;  1T4N A;  2YT4 A;  4X62 E;  4DUZ E;  4DV5 E;  5LL6 R;  1HNW E;  2M1S A;  4JI0 E;  4R03 A;  4BMJ A;  2RS7 A;  1I94 E;  3MSW A;  2RS6 A;  1FKA E;  2L33 A;  4LF4 E;  1HNX E;  1ZBQ A;  2FV4 B;  2YZT A;  5BR8 E;  4LTY A;  1IBK E;  2JOB A;  2JWO A;  3IWB A;  2ZM6 E;  3KWR A;  5ADZ A;  3ADJ A;  2V83 A;  1HR0 E;  5AAS A;  2FTX B;  4DR4 E;  5CFF E;  4DV1 E;  3OTO E;  1PKP A;  3F6G A;  3VYY A;  4P7D A;  4R8O A;  4DR1 E;  1X48 A;  2L2K B;  4JI5 E;  2F4V E;  3T1H E;  1HNZ E;  2UUC E;  4B3R E;  1N34 E;  4JYA E;  3J80 C;  2V89 A;  2LUP B;  3JTZ A;  3HQ1 A;  4NXN E;  1STU A;  4KZS A;  5AE1 A;  2VQE E;  3DF6 A;  2HHH E;  4BC9 A;  1XMO E;  3AV0 A;  4BCA A;  2FGG A;  2M4I A;  4F9C B;  2ODR D;  4WYQ B;  1T4L B;  2V86 A;  1UHZ A;  3C4T A;  3F6H A;  2L92 A;  4DKK A;  4JV5 E;  4BBY A;  3AUZ A;  1QU6 A;  5IWA E;  2V88 A;  5F3W A;  4LF9 E;  4GKJ E;  5T6J A;  3T1Y E;  1IBM E;  4DR7 E;  2MC6 A;  2RSM A;  2EZ6 A;  2LJH A;  2VQF E;  2N3G A;  3J7Y p;  4DUY E;  3ADL A;  4KHP E;  4F9B B;  4LFB E;  2UXB E;  2KON A;  4L8N A;  2MC5 A;  1N32 E;  2EWL A;  4K0K E;  2KOU A;  4X64 E;  4LU9 A;  4X66 E;  5IT9 C;  3ZOQ B;  4X8W A;  2MDR A;  2F8B A;  4DV2 E;  1DI2 A;  4LF6 E;  1WHQ A;  2UUB E;  3JU0 A;  3P1X A;  2NUG A;  4GKK E;  4JI7 E;  4B3T E;  2CPN A;  2ODR C;  3LLH A;  4M0V A;  4DV7 E;  1FJG E;  2UXD E;  2LE2 A;  4WFT A;  4L5N C;  4JI4 E;  4LF5 E;  5A2Q C;  2DMY A;  1WHN A;  2LRS A;  1ZBT A;  5DNY A;  4DR3 E;  1J26 A;  3HPZ A;  5LMU E;  2UXC E;  3HXL A;  1J5E E;  2V8Q B;  3VYX A;  4LFC E;  4NXM E;  2LMZ A;  2B9D A;  2L2N A;  2L2M A;  4LF7 E;  2DIX A;  1WXR A;  1RQ0 A;  2DSY A;  1YZ9 A;  3HTX A;  2E1M A;  4DV6 E;  1T4O A;  3ADG A;  2L3J A;  3IWC A;  1O0W A;  4YHH E;  3FIG A;  2L8T A;  2LTR A;  3K6Q A;  1X47 A;  2H36 X;  4DV0 E;  4TUI A;  4DR5 E;  4JI3 E;  4LF8 E;  1N33 E;  4DV4 E;  2IHR 1;  1N36 E;  3ADI A;  3J81 C;  4TUG A;  1UIL A;  4LFA E;  4GEQ B;  2LBS B;  4YY3 E;  4Q28 A;  4X65 E;  1YYO A;  2V85 A;  4WSP A;  2DB2 A;  4JI2 E;  3LML A;  2G7H A;  4AQY E;  2UUA E;  4J8Z A;  1GQE A;  1GZ6 A;  2NUF A;  2UU9 E;  2L3C A;  4M2Z A;  4DV3 E;  1EKZ A;  2LTS A;  1YYW A;  4BS9 A;  1XMQ E;  1DQ3 A;  1X49 A;  2JR1 A;  2KHX A;  2N3H A;  2WZO A;  3DJW A;  1SR9 A;  4M30 A;  4P78 A;  2M7Q A;  4JI8 E;  2NA2 A;  3H09 A;  2JVA A;  3VK6 A;  4F54 A;  4F9A B;  3RMP A;  1RC7 A;  2VE7 C;  2B3T B;  3OML A;  4I8O A;  2JY9 A;  2V87 A;  5AE3 A;  4B3S E;  2JOX A;  4OOG C;  1XNR E;  1YYK A;  5FLX C;  1IBL E;  2B7V A;  3HPS A;  4DR2 E;  4DMI A;  5LMN E;  2B7T A;  3J7A G;  2E5L E;  2VF1 A;  4BC7 A;  4B3M E;  4WPY A;  2RTX A;  5AE2 A;  1XNQ E;  2NUE A;  4OX9 E;  3IWD A;  4JI1 E;  3C4B A;  4DR6 E;  2K4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...