3P1XA

Crystal structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
b'GKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin enhancer-binding factor 3
publication title Crystal structure of DRBM 2 domain of Interleukin enhancer-binding factor 3 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4527E
rcsb
molecule tags Transcription regulator
total genus 11
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3p1xA00
2DMYA 2RSMA 3OTOE 4YHHE 1FJGE 4DR3E 3C4TA 1RQ0A 3ADLA 4X65E 4JI2E 1HNWE 4X62E 4JYAE 2LRSA 1HNZE 1STUA 1UHZA 4DV2E 2RS7A 2F4VE 4AQYE 1X49A 1WHQA 2VQEE 4DV0E 4X66E 4B3TE 1YYWA 5IWAE 4B3ME 1T4LB 1YYOA 4JI3E 1YYKA 2VQFE 1ZBTA 2DIXA 1IBKE 4OX9E 2LUQA 1HR0E 4LF9E 2CPNA 3T1YE 1XNQE 3T1HE 4GKKE 1X48A 4JI4E 1X47A 1HNXE 4WFTA 1T4OA 2DB2A 2L2KB 5LMUE 1XMQE 2UUCE 4DV5E 1O0WA 4JI8E 2B3TB 4M30A 3ADGA 4DR7E 4JI7E 2E5LE 1N32E 2N3GA 4DV6E 1WHNA 1IBLE 4LFBE 4DR4E 2YT4A 4DV1E 4LF4E 1UILA 2UUAE 1PKPA 4DUZE 1FKAE 2L2MA 2JVAA 2RTXA 1RC7A 1XNRE 1I94E 2L3JA 2NA2A 2RS6A 2B7TA 2NUGA 4OOGC 1XMOE 2L33A 2LTSA 4LFAE 2JY9A 1N33E 4JI0E 2UXDE 2KHXA 1GQEA 4LF5E 1DI2A 3LLHA 3ADJA 4X64E 1N34E 4GKJE 2N3HA 3P1XA 1J26A 2NUFA 2ZM6E 2UXBE 4DR6E 5CFFE 5LMNE 4K0KE 4JV5E 4DR5E 4X8WA 4NXNE 2NUEA 2B7VA 4LF6E 1EKZA 4KHPE 1T4NA 2LTRA 2LBSB 3C4BA 3VYYA 4DV4E 2EZ6A 4YY3E 3HTXA 2UU9E 5BR8E 4DUYE 4WYQB 2MDRA 3VYXA 2L2NA 4JI5E 4M2ZA 1IBME 1QU6A 4DV7E 1J5EE 3J7Yp 4DKKA 2UUBE 3ADIA 4DR1E 2HHHE 4JI1E 4LF7E 2UXCE 4B3SE 4NXME 2LJHA 2IHR1 2L3CA 1YZ9A 2LUPB 4DV3E 4LF8E 4JI6E 4B3RE 4DR2E 1N36E 4LFCE
chains in the Genus database with same CATH superfamily
1LLMC 1EH6A 4NZVA 3OTOE 1AAYA 1FJGE 4DR3E 2EQ0A 4JI2E 2YTDA 2LRSA 2HC5A 4LU9A 2EOZA 2EPXA 2F4VE 4AQYE 1MEYC 2YTJA 2N8XA 2EPPA 2EM6A 4JI3E 2R76A 1ZBTA 2DIXA 2EORA 4IS1C 5AE3A 1YSAC 4R2CA 2EMKA 5KL7A 3QG5C 5A6KA 2CPNA 2ODRD 3ZOQB 5IT9C 1A1JA 3T1HE 4NHRA 2EPOA 2M9AA 1A1LA 4MLVA 1X48A 2EN4A 2JWOA 4WFTA 2DB2A 4I8OA 2KONA 2UUCE 4O5GA 2BBGA 3ADGA 1WXRA 2EE8A 2EN2A 2N3GA 1WHNA 4LFBE 2YSOA 4M9VC 3DJWA 2YPNA 1Z1BA 2EPMX 1FKAE 2GLIA 2LT7A 5KL4A 1B69A 2EOHA 1XNRE 3DF6A 1A1GA 1YPNA 2V85A 4L8NA 2K4VA 4OOGC 1XMOE 2L33A 2LTSA 1N33E 2JOBA 3EQ1A 4JI0E 2WBTA 1DQ3A 2RSIA 2DMIA 2MKNA 4F2JC 5IXMB 2EJ4A 1MGTA 2G7HA 2FGGA 2FTXB 4DR6E 2YTPA 4K0KE 4X8WA 3HPZA 4NXNE 4Q28A 1EKZA 4KHPE 2LTRA 2LBSB 1GTKA 1IQSA 2YTOA 2EZ6A 4R2DA 5DNYA 2LVHA 4BC9A 4WYQB 4GZNC 4ZYHA 2LO3A 5A6BA 2EM0A 1ZU1A 1L4SA 4JI5E 1QNTA 3JU0A 4DKKA 2ADRA 2CSHA 4DR1E 2H36X 2EMHA 2ENAA 4JI1E 2MC6A 3BBGA 2EQ1A 2IHR1 2VF1A 2L3CA 4JI6E 2EOXA 2EMAA 2EPUA 4F9BB 2DMYA 3MSWA 2RSMA 1UBDC 3KZYA 1PDAA 2VE7C 3H09A 2JYAA 3AV0A 1X3CA 2JOXA 4R2AA 2B9DA 2M4IA 3C4TA 3EPKA 3MHSC 1TF3A 5A6BD 2EMFA 4JYAE 3EPLA 5AC5A 5AE1A 2YSPA 3OMLA 2M7QA 4ZYGA 1WHQA 4X66E 1YYWA 2HGHA 2MKDA 2MC5A 2WBSA 2EMGA 4O4KA 3L00A 1A1IA 2EMIA 2EOYA 4OX9E 1T38A 2YTGA 3AUZA 1RMDA 1IQOA 1XNQE 4R2EA 4TUIA 1JK2A 4N4RB 4JI4E 2LV2A 4R2RA 1T4OA 4BMJA 2EWLA 2YTNA 2YU8A 2B3TB 1WJPA 2ELYA 5A6AA 4DR7E 4JI7E 2E5LE 3TQMA 4F9CB 4WX9A 2RQLA 4DR4E 2YT4A 2GPIA 4DV1E 2YTEA 1T39A 4LF4E 1UILA 4DUZE 2JVAA 3JTZA 1RC7A 1I94E 2EN8A 2L3JA 2NA2A 1DGCA 2DLKA 3F6HA 2EOFA 2B7TA 4IJDA 4LFAE 5KL3A 5F3WA 2UXDE 1X6HA 2EMZA 2JPAA 1N34E 1KJKA 1J26A 2ENHA 3C6KA 2UXBE 1EH7A 2HJJA 1PJSA 3KWRA 1UN6B 2EM8A 2EP3A 4LF6E 2EM9A 4YY3E 3HTXA 2M1SA 5BR8E 1TF6A 2EM5A 2LE2A 4HTGA 2YTIA 3BGHA 1PJTA 2UUBE 2HHHE 2YRMA 2PRTA 2EM7A 5KL6A 4NXME 4WXDA 1YZ9A 4BS9A 2LUPB 3IWBA 4DR2E 2LCEA 1EH8A 2CTDA 2EOJA 2E72A 3IWDA 1F2IG 2DSYA 3ADLA 2V8QB 5T6JA 4X65E 1HNWE 4X62E 3HQ1A 4BHBA 1HNZE 1STUA 1UHZA 4DV2E 2RS7A 1A1HA 4O24A 2VQEE 4B3TE 4BHCA 3BIDA 2EOMA 3VK6A 1G2FC 5IWAE 4B3ME 3HXLA 1YYOA 2KOUA 1YYKA 1BBGA 4FK5C 2VRDA 3J80C 2LMZA 3T1YE 2DLQA 1JK1A 1A1KA 4M0VA 1N3GA 4WSGA 1HNXE 2DRPA 1XMQE 2L2KB 5LMUE 1P47A 4DV5E 1O0WA 2L92A 1BBOA 2ODRC 2EOIA 1N32E 3BF2A 2EM2A 5IV8B 2EPNA 2UUAE 3KZZA 2L2MA 2K7IA 2E1MA 1TN9A 2RS6A 2V86A 1YUJA 2NABA 2JY9A 1YFHA 4ZYDA 4LF5E 1WRJA 1NEIA 5ADZA 2WZOA 1SR9A 1DI2A 3LLHA 2EPCA 3RMPA 3P1XA 4RHBB 2NUFA 2EOQA 3EPHA 4P78A 2EOOA 4J8ZA 4P7DA 2Q8UA 2V88A 3HPSA 4JV5E 4DR5E 2NUEA 4R2PA 1AH5A 2B7VA 4F54A 3J81C 1T4NA 4MLQA 2YTFA 4DV4E 2WBUA 2EPKX 2UU9E 2JR1A 2EMLA 4LTYA 2MDRA 1G2DC 5AE2A 5TSEA 3VYXA 1YUIA 2BB8A 2EOEA 3THOB 4GEQB 5KL5A 4DV7E 1J5EE 2EM3A 4Q35B 4R8OA 4LF7E 5A2QC 2EMWA 2EN6A 3VHTB 2MDGA 2V83A 2LJHA 4LF8E 4DV3E 4BBYA 4B3RE 1IMUA 2EPZA 4WSPA 2EMXA 2I9IA 1X6FA 4YHHE 3F6GA 3M99B 1RQ0A 2EN1A 4F6NA 2EMYA 2WCC3 2I13A 5AC4A 2GHFA 4BCAA 3JAMC 3ECRA 1ZR9A 2ELZA 2EQ3A 1X49A 5KL2A 4DV0E 2RPCA 4KWYA 1T4LB 2D9HA 2YWQA 3EPJA 2VQFE 1NCSA 4R2SA 5LLQA 1IBKE 4R03A 2LJUA 2LUQA 1HR0E 4LF9E 3J7AG 2FV4B 4R2QA 4ZYEA 3K6QA 3MHHC 4GKKE 2EN7A 4KZSA 2EL6A 2V89A 2EPLX 1X47A 3THNA 4L5NC 5A6JA 2A25A 5A69A 2EMBA 2EPAA 4JI8E 2L6MA 1X5WA 4BC7A 4F9AB 4M30A 3LMLA 4X9JA 3IWCA 4DMIA 3FIGA 4DV6E 1IBLE 5AASA 4TUGA 1PKPA 2EOSA 5LL6R 2EMCA 2YRHA 2CT1A 2ENCA 1SFEA 2RTXA 2V87A 2EN3A 1GZ6A 3C6MA 4HEIA 1ZBQA 2F8BA 2NUGA 2KHXA 1GQEA 2EPRA 4O43A 1X6EA 3ADJA 4X64E 4GKJE 2N3HA 2EM4A 4RH8A 2ZM6E 4F6MA 5CFFE 3UK3C 5LMNE 2YU5A 1BB8A 2J7JA 4WPYA 1KYQA 3C4BA 3VYYA 2L8TA 5FLXC 2EL4A 4DUYE 2DGCA 1PJQA 2R1FA 2L2NA 4M2ZA 1IBME 2JXPA 1ZAAC 1QU6A 3J7Yp 3ADIA 2UXCE 4B3SE 2YRKA 2YZTA 4WXCA 1N36E 2JP9A 4LFCE 1A1FA 2YTQA 2EL5A
chains in the Genus database with same CATH topology
2DMYA 4WSPA 3MSWA 2RSMA 3OTOE 2VE7C 3H09A 3IWDA 4YHHE 3AV0A 1FJGE 3F6GA 4DR3E 2JOXA 2DSYA 2B9DA 2M4IA 3C4TA 1RQ0A 3ADLA 2V8QB 5T6JA 4X65E 4JI2E 1HNWE 4X62E 3HQ1A 4JYAE 2LRSA 1HNZE 4LU9A 1STUA 4BCAA 3JAMC 1UHZA 5AE1A 2RS7A 4DV2E 2F4VE 4AQYE 3OMLA 2M7QA 1X49A 1WHQA 2VQEE 4DV0E 4X66E 4B3TE 1YYWA 3VK6A 2MC5A 5IWAE 4B3ME 3HXLA 1YYOA 1T4LB 4JI3E 2KOUA 1YYKA 2VQFE 1ZBTA 2DIXA 1IBKE 5AE3A 4R03A 4OX9E 2LUQA 1HR0E 4LF9E 2CPNA 3AUZA 3J7AG 2ODRD 3J80C 2FV4B 3ZOQB 2LMZA 5IT9C 3T1YE 1XNQE 3T1HE 4TUIA 3K6QA 4GKKE 1X48A 4KZSA 4JI4E 2V89A 1X47A 4M0VA 1HNXE 2JWOA 4L5NC 4WFTA 1T4OA 2DB2A 4BMJA 2L2KB 5LMUE 1XMQE 4KHPE 2EWLA 4I8OA 2KONA 2UUCE 4DV5E 1O0WA 2L92A 4JI8E 2B3TB 2L6MA 2ODRC 4BC7A 4F9AB 4M30A 3ADGA 1WXRA 4JI7E 3LMLA 2E5LE 4DR7E 4F9CB 1N32E 3IWCA 4DMIA 2N3GA 3FIGA 4DV6E 1WHNA 1IBLE 4LFBE 4DR4E 2YT4A 3DJWA 4DV1E 5AASA 4LF4E 1UILA 4TUGA 2UUAE 1PKPA 4DUZE 5LL6R 1FKAE 2L2MA 2JVAA 2RTXA 2V87A 3JTZA 1RC7A 2E1MA 1I94E 1GZ6A 3DF6A 2L3JA 1XNRE 2NA2A 2RS6A 1ZBQA 2F8BA 3F6HA 2V85A 4L8NA 2B7TA 2K4VA 2V86A 4OOGC 2NUGA 1XMOE 2L33A 2LTSA 4LFAE 2JY9A 1N33E 2JOBA 5F3WA 4JI0E 2UXDE 1DQ3A 2KHXA 1GQEA 4LF5E 5ADZA 1DI2A 2WZOA 1SR9A 3LLHA 3ADJA 4X64E 1N34E 4GKJE 2N3HA 3RMPA 3P1XA 1J26A 2NUFA 2ZM6E 4P78A 2G7HA 2FGGA 2UXBE 2FTXB 4J8ZA 4P7DA 5CFFE 4DR6E 3KWRA 5LMNE 2V88A 4K0KE 3HPSA 4JV5E 4DR5E 4X8WA 3HPZA 4NXNE 2B7VA 2NUEA 4LF6E 4Q28A 4F54A 1T4NA 2LTRA 4WPYA 3J81C 3C4BA 3VYYA 4DV4E 2LBSB 2EZ6A 5DNYA 2L8TA 5FLXC 4YY3E 4LFCE 3HTXA 4BC9A 2UU9E 2M1SA 2JR1A 4WYQB 4LTYA 5BR8E 2LE2A 2MDRA 4DUYE 5AE2A 3VYXA 2L2NA 4JI5E 4M2ZA 1IBME 4GEQB 1QU6A 3JU0A 4DV7E 1J5EE 3J7Yp 4DKKA 2UUBE 3ADIA 1EKZA 4DR1E 2HHHE 2H36X 4R8OA 4JI1E 5A2QC 4LF7E 2MC6A 2UXCE 4B3SE 2V83A 4NXME 2LJHA 2IHR1 2VF1A 2YZTA 2L3CA 1YZ9A 4BS9A 4DV3E 2LUPB 4BBYA 4JI6E 3IWBA 4DR2E 4LF8E 4B3RE 1N36E 4F9BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMY A;  2RSM A;  3OTO E;  4YHH E;  1FJG E;  4DR3 E;  3C4T A;  1RQ0 A;  3ADL A;  4X65 E;  4JI2 E;  1HNW E;  4X62 E;  4JYA E;  2LRS A;  1HNZ E;  1STU A;  1UHZ A;  4DV2 E;  2RS7 A;  2F4V E;  4AQY E;  1X49 A;  1WHQ A;  2VQE E;  4DV0 E;  4X66 E;  4B3T E;  1YYW A;  5IWA E;  4B3M E;  1T4L B;  1YYO A;  4JI3 E;  1YYK A;  2VQF E;  1ZBT A;  2DIX A;  1IBK E;  4OX9 E;  2LUQ A;  1HR0 E;  4LF9 E;  2CPN A;  3T1Y E;  1XNQ E;  3T1H E;  4GKK E;  1X48 A;  4JI4 E;  1X47 A;  1HNX E;  4WFT A;  1T4O A;  2DB2 A;  2L2K B;  5LMU E;  1XMQ E;  2UUC E;  4DV5 E;  1O0W A;  4JI8 E;  2B3T B;  4M30 A;  3ADG A;  4DR7 E;  4JI7 E;  2E5L E;  1N32 E;  2N3G A;  4DV6 E;  1WHN A;  1IBL E;  4LFB E;  4DR4 E;  2YT4 A;  4DV1 E;  4LF4 E;  1UIL A;  2UUA E;  1PKP A;  4DUZ E;  1FKA E;  2L2M A;  2JVA A;  2RTX A;  1RC7 A;  1XNR E;  1I94 E;  2L3J A;  2NA2 A;  2RS6 A;  2B7T A;  2NUG A;  4OOG C;  1XMO E;  2L33 A;  2LTS A;  4LFA E;  2JY9 A;  1N33 E;  4JI0 E;  2UXD E;  2KHX A;  1GQE A;  4LF5 E;  1DI2 A;  3LLH A;  3ADJ A;  4X64 E;  1N34 E;  4GKJ E;  2N3H A;  3P1X A;  1J26 A;  2NUF A;  2ZM6 E;  2UXB E;  4DR6 E;  5CFF E;  5LMN E;  4K0K E;  4JV5 E;  4DR5 E;  4X8W A;  4NXN E;  2NUE A;  2B7V A;  4LF6 E;  1EKZ A;  4KHP E;  1T4N A;  2LTR A;  2LBS B;  3C4B A;  3VYY A;  4DV4 E;  2EZ6 A;  4YY3 E;  3HTX A;  2UU9 E;  5BR8 E;  4DUY E;  4WYQ B;  2MDR A;  3VYX A;  2L2N A;  4JI5 E;  4M2Z A;  1IBM E;  1QU6 A;  4DV7 E;  1J5E E;  3J7Y p;  4DKK A;  2UUB E;  3ADI A;  4DR1 E;  2HHH E;  4JI1 E;  4LF7 E;  2UXC E;  4B3S E;  4NXM E;  2LJH A;  2IHR 1;  2L3C A;  1YZ9 A;  2LUP B;  4DV3 E;  4LF8 E;  4JI6 E;  4B3R E;  4DR2 E;  1N36 E;  4LFC E; 
#chains in the Genus database with same CATH topology
 1LLM C;  1EH6 A;  4NZV A;  3OTO E;  1AAY A;  1FJG E;  4DR3 E;  2EQ0 A;  4JI2 E;  2YTD A;  2LRS A;  2HC5 A;  4LU9 A;  2EOZ A;  2EPX A;  2F4V E;  4AQY E;  1MEY C;  2YTJ A;  2N8X A;  2EPP A;  2EM6 A;  4JI3 E;  2R76 A;  1ZBT A;  2DIX A;  2EOR A;  4IS1 C;  5AE3 A;  1YSA C;  4R2C A;  2EMK A;  5KL7 A;  3QG5 C;  5A6K A;  2CPN A;  2ODR D;  3ZOQ B;  5IT9 C;  1A1J A;  3T1H E;  4NHR A;  2EPO A;  2M9A A;  1A1L A;  4MLV A;  1X48 A;  2EN4 A;  2JWO A;  4WFT A;  2DB2 A;  4I8O A;  2KON A;  2UUC E;  4O5G A;  2BBG A;  3ADG A;  1WXR A;  2EE8 A;  2EN2 A;  2N3G A;  1WHN A;  4LFB E;  2YSO A;  4M9V C;  3DJW A;  2YPN A;  1Z1B A;  2EPM X;  1FKA E;  2GLI A;  2LT7 A;  5KL4 A;  1B69 A;  2EOH A;  1XNR E;  3DF6 A;  1A1G A;  1YPN A;  2V85 A;  4L8N A;  2K4V A;  4OOG C;  1XMO E;  2L33 A;  2LTS A;  1N33 E;  2JOB A;  3EQ1 A;  4JI0 E;  2WBT A;  1DQ3 A;  2RSI A;  2DMI A;  2MKN A;  4F2J C;  5IXM B;  2EJ4 A;  1MGT A;  2G7H A;  2FGG A;  2FTX B;  4DR6 E;  2YTP A;  4K0K E;  4X8W A;  3HPZ A;  4NXN E;  4Q28 A;  1EKZ A;  4KHP E;  2LTR A;  2LBS B;  1GTK A;  1IQS A;  2YTO A;  2EZ6 A;  4R2D A;  5DNY A;  2LVH A;  4BC9 A;  4WYQ B;  4GZN C;  4ZYH A;  2LO3 A;  5A6B A;  2EM0 A;  1ZU1 A;  1L4S A;  4JI5 E;  1QNT A;  3JU0 A;  4DKK A;  2ADR A;  2CSH A;  4DR1 E;  2H36 X;  2EMH A;  2ENA A;  4JI1 E;  2MC6 A;  3BBG A;  2EQ1 A;  2IHR 1;  2VF1 A;  2L3C A;  4JI6 E;  2EOX A;  2EMA A;  2EPU A;  4F9B B;  2DMY A;  3MSW A;  2RSM A;  1UBD C;  3KZY A;  1PDA A;  2VE7 C;  3H09 A;  2JYA A;  3AV0 A;  1X3C A;  2JOX A;  4R2A A;  2B9D A;  2M4I A;  3C4T A;  3EPK A;  3MHS C;  1TF3 A;  5A6B D;  2EMF A;  4JYA E;  3EPL A;  5AC5 A;  5AE1 A;  2YSP A;  3OML A;  2M7Q A;  4ZYG A;  1WHQ A;  4X66 E;  1YYW A;  2HGH A;  2MKD A;  2MC5 A;  2WBS A;  2EMG A;  4O4K A;  3L00 A;  1A1I A;  2EMI A;  2EOY A;  4OX9 E;  1T38 A;  2YTG A;  3AUZ A;  1RMD A;  1IQO A;  1XNQ E;  4R2E A;  4TUI A;  1JK2 A;  4N4R B;  4JI4 E;  2LV2 A;  4R2R A;  1T4O A;  4BMJ A;  2EWL A;  2YTN A;  2YU8 A;  2B3T B;  1WJP A;  2ELY A;  5A6A A;  4DR7 E;  4JI7 E;  2E5L E;  3TQM A;  4F9C B;  4WX9 A;  2RQL A;  4DR4 E;  2YT4 A;  2GPI A;  4DV1 E;  2YTE A;  1T39 A;  4LF4 E;  1UIL A;  4DUZ E;  2JVA A;  3JTZ A;  1RC7 A;  1I94 E;  2EN8 A;  2L3J A;  2NA2 A;  1DGC A;  2DLK A;  3F6H A;  2EOF A;  2B7T A;  4IJD A;  4LFA E;  5KL3 A;  5F3W A;  2UXD E;  1X6H A;  2EMZ A;  2JPA A;  1N34 E;  1KJK A;  1J26 A;  2ENH A;  3C6K A;  2UXB E;  1EH7 A;  2HJJ A;  1PJS A;  3KWR A;  1UN6 B;  2EM8 A;  2EP3 A;  4LF6 E;  2EM9 A;  4YY3 E;  3HTX A;  2M1S A;  5BR8 E;  1TF6 A;  2EM5 A;  2LE2 A;  4HTG A;  2YTI A;  3BGH A;  1PJT A;  2UUB E;  2HHH E;  2YRM A;  2PRT A;  2EM7 A;  5KL6 A;  4NXM E;  4WXD A;  1YZ9 A;  4BS9 A;  2LUP B;  3IWB A;  4DR2 E;  2LCE A;  1EH8 A;  2CTD A;  2EOJ A;  2E72 A;  3IWD A;  1F2I G;  2DSY A;  3ADL A;  2V8Q B;  5T6J A;  4X65 E;  1HNW E;  4X62 E;  3HQ1 A;  4BHB A;  1HNZ E;  1STU A;  1UHZ A;  4DV2 E;  2RS7 A;  1A1H A;  4O24 A;  2VQE E;  4B3T E;  4BHC A;  3BID A;  2EOM A;  3VK6 A;  1G2F C;  5IWA E;  4B3M E;  3HXL A;  1YYO A;  2KOU A;  1YYK A;  1BBG A;  4FK5 C;  2VRD A;  3J80 C;  2LMZ A;  3T1Y E;  2DLQ A;  1JK1 A;  1A1K A;  4M0V A;  1N3G A;  4WSG A;  1HNX E;  2DRP A;  1XMQ E;  2L2K B;  5LMU E;  1P47 A;  4DV5 E;  1O0W A;  2L92 A;  1BBO A;  2ODR C;  2EOI A;  1N32 E;  3BF2 A;  2EM2 A;  5IV8 B;  2EPN A;  2UUA E;  3KZZ A;  2L2M A;  2K7I A;  2E1M A;  1TN9 A;  2RS6 A;  2V86 A;  1YUJ A;  2NAB A;  2JY9 A;  1YFH A;  4ZYD A;  4LF5 E;  1WRJ A;  1NEI A;  5ADZ A;  2WZO A;  1SR9 A;  1DI2 A;  3LLH A;  2EPC A;  3RMP A;  3P1X A;  4RHB B;  2NUF A;  2EOQ A;  3EPH A;  4P78 A;  2EOO A;  4J8Z A;  4P7D A;  2Q8U A;  2V88 A;  3HPS A;  4JV5 E;  4DR5 E;  2NUE A;  4R2P A;  1AH5 A;  2B7V A;  4F54 A;  3J81 C;  1T4N A;  4MLQ A;  2YTF A;  4DV4 E;  2WBU A;  2EPK X;  2UU9 E;  2JR1 A;  2EML A;  4LTY A;  2MDR A;  1G2D C;  5AE2 A;  5TSE A;  3VYX A;  1YUI A;  2BB8 A;  2EOE A;  3THO B;  4GEQ B;  5KL5 A;  4DV7 E;  1J5E E;  2EM3 A;  4Q35 B;  4R8O A;  4LF7 E;  5A2Q C;  2EMW A;  2EN6 A;  3VHT B;  2MDG A;  2V83 A;  2LJH A;  4LF8 E;  4DV3 E;  4BBY A;  4B3R E;  1IMU A;  2EPZ A;  4WSP A;  2EMX A;  2I9I A;  1X6F A;  4YHH E;  3F6G A;  3M99 B;  1RQ0 A;  2EN1 A;  4F6N A;  2EMY A;  2WCC 3;  2I13 A;  5AC4 A;  2GHF A;  4BCA A;  3JAM C;  3ECR A;  1ZR9 A;  2ELZ A;  2EQ3 A;  1X49 A;  5KL2 A;  4DV0 E;  2RPC A;  4KWY A;  1T4L B;  2D9H A;  2YWQ A;  3EPJ A;  2VQF E;  1NCS A;  4R2S A;  5LLQ A;  1IBK E;  4R03 A;  2LJU A;  2LUQ A;  1HR0 E;  4LF9 E;  3J7A G;  2FV4 B;  4R2Q A;  4ZYE A;  3K6Q A;  3MHH C;  4GKK E;  2EN7 A;  4KZS A;  2EL6 A;  2V89 A;  2EPL X;  1X47 A;  3THN A;  4L5N C;  5A6J A;  2A25 A;  5A69 A;  2EMB A;  2EPA A;  4JI8 E;  2L6M A;  1X5W A;  4BC7 A;  4F9A B;  4M30 A;  3LML A;  4X9J A;  3IWC A;  4DMI A;  3FIG A;  4DV6 E;  1IBL E;  5AAS A;  4TUG A;  1PKP A;  2EOS A;  5LL6 R;  2EMC A;  2YRH A;  2CT1 A;  2ENC A;  1SFE A;  2RTX A;  2V87 A;  2EN3 A;  1GZ6 A;  3C6M A;  4HEI A;  1ZBQ A;  2F8B A;  2NUG A;  2KHX A;  1GQE A;  2EPR A;  4O43 A;  1X6E A;  3ADJ A;  4X64 E;  4GKJ E;  2N3H A;  2EM4 A;  4RH8 A;  2ZM6 E;  4F6M A;  5CFF E;  3UK3 C;  5LMN E;  2YU5 A;  1BB8 A;  2J7J A;  4WPY A;  1KYQ A;  3C4B A;  3VYY A;  2L8T A;  5FLX C;  2EL4 A;  4DUY E;  2DGC A;  1PJQ A;  2R1F A;  2L2N A;  4M2Z A;  1IBM E;  2JXP A;  1ZAA C;  1QU6 A;  3J7Y p;  3ADI A;  2UXC E;  4B3S E;  2YRK A;  2YZT A;  4WXC A;  1N36 E;  2JP9 A;  4LFC E;  1A1F A;  2YTQ A;  2EL5 A; 
#chains in the Genus database with same CATH homology
 2DMY A;  4WSP A;  3MSW A;  2RSM A;  3OTO E;  2VE7 C;  3H09 A;  3IWD A;  4YHH E;  3AV0 A;  1FJG E;  3F6G A;  4DR3 E;  2JOX A;  2DSY A;  2B9D A;  2M4I A;  3C4T A;  1RQ0 A;  3ADL A;  2V8Q B;  5T6J A;  4X65 E;  4JI2 E;  1HNW E;  4X62 E;  3HQ1 A;  4JYA E;  2LRS A;  1HNZ E;  4LU9 A;  1STU A;  4BCA A;  3JAM C;  1UHZ A;  5AE1 A;  2RS7 A;  4DV2 E;  2F4V E;  4AQY E;  3OML A;  2M7Q A;  1X49 A;  1WHQ A;  2VQE E;  4DV0 E;  4X66 E;  4B3T E;  1YYW A;  3VK6 A;  2MC5 A;  5IWA E;  4B3M E;  3HXL A;  1YYO A;  1T4L B;  4JI3 E;  2KOU A;  1YYK A;  2VQF E;  1ZBT A;  2DIX A;  1IBK E;  5AE3 A;  4R03 A;  4OX9 E;  2LUQ A;  1HR0 E;  4LF9 E;  2CPN A;  3AUZ A;  3J7A G;  2ODR D;  3J80 C;  2FV4 B;  3ZOQ B;  2LMZ A;  5IT9 C;  3T1Y E;  1XNQ E;  3T1H E;  4TUI A;  3K6Q A;  4GKK E;  1X48 A;  4KZS A;  4JI4 E;  2V89 A;  1X47 A;  4M0V A;  1HNX E;  2JWO A;  4L5N C;  4WFT A;  1T4O A;  2DB2 A;  4BMJ A;  2L2K B;  5LMU E;  1XMQ E;  4KHP E;  2EWL A;  4I8O A;  2KON A;  2UUC E;  4DV5 E;  1O0W A;  2L92 A;  4JI8 E;  2B3T B;  2L6M A;  2ODR C;  4BC7 A;  4F9A B;  4M30 A;  3ADG A;  1WXR A;  4JI7 E;  3LML A;  2E5L E;  4DR7 E;  4F9C B;  1N32 E;  3IWC A;  4DMI A;  2N3G A;  3FIG A;  4DV6 E;  1WHN A;  1IBL E;  4LFB E;  4DR4 E;  2YT4 A;  3DJW A;  4DV1 E;  5AAS A;  4LF4 E;  1UIL A;  4TUG A;  2UUA E;  1PKP A;  4DUZ E;  5LL6 R;  1FKA E;  2L2M A;  2JVA A;  2RTX A;  2V87 A;  3JTZ A;  1RC7 A;  2E1M A;  1I94 E;  1GZ6 A;  3DF6 A;  2L3J A;  1XNR E;  2NA2 A;  2RS6 A;  1ZBQ A;  2F8B A;  3F6H A;  2V85 A;  4L8N A;  2B7T A;  2K4V A;  2V86 A;  4OOG C;  2NUG A;  1XMO E;  2L33 A;  2LTS A;  4LFA E;  2JY9 A;  1N33 E;  2JOB A;  5F3W A;  4JI0 E;  2UXD E;  1DQ3 A;  2KHX A;  1GQE A;  4LF5 E;  5ADZ A;  1DI2 A;  2WZO A;  1SR9 A;  3LLH A;  3ADJ A;  4X64 E;  1N34 E;  4GKJ E;  2N3H A;  3RMP A;  3P1X A;  1J26 A;  2NUF A;  2ZM6 E;  4P78 A;  2G7H A;  2FGG A;  2UXB E;  2FTX B;  4J8Z A;  4P7D A;  5CFF E;  4DR6 E;  3KWR A;  5LMN E;  2V88 A;  4K0K E;  3HPS A;  4JV5 E;  4DR5 E;  4X8W A;  3HPZ A;  4NXN E;  2B7V A;  2NUE A;  4LF6 E;  4Q28 A;  4F54 A;  1T4N A;  2LTR A;  4WPY A;  3J81 C;  3C4B A;  3VYY A;  4DV4 E;  2LBS B;  2EZ6 A;  5DNY A;  2L8T A;  5FLX C;  4YY3 E;  4LFC E;  3HTX A;  4BC9 A;  2UU9 E;  2M1S A;  2JR1 A;  4WYQ B;  4LTY A;  5BR8 E;  2LE2 A;  2MDR A;  4DUY E;  5AE2 A;  3VYX A;  2L2N A;  4JI5 E;  4M2Z A;  1IBM E;  4GEQ B;  1QU6 A;  3JU0 A;  4DV7 E;  1J5E E;  3J7Y p;  4DKK A;  2UUB E;  3ADI A;  1EKZ A;  4DR1 E;  2HHH E;  2H36 X;  4R8O A;  4JI1 E;  5A2Q C;  4LF7 E;  2MC6 A;  2UXC E;  4B3S E;  2V83 A;  4NXM E;  2LJH A;  2IHR 1;  2VF1 A;  2YZT A;  2L3C A;  1YZ9 A;  4BS9 A;  4DV3 E;  2LUP B;  4BBY A;  4JI6 E;  3IWB A;  4DR2 E;  4LF8 E;  4B3R E;  1N36 E;  4F9B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...