3P1XA

Crystal structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin enhancer-binding factor 3
publication title Crystal structure of DRBM 2 domain of Interleukin enhancer-binding factor 3 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4527E
rcsb
molecule tags Transcription regulator
total genus 11
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3p1xA00
1YZ9A 2RTXA 2LUQA 3HTXA 2UXDE 1XNRE 4JI1E 4OOGC 1GQEA 2CPNA 4DKKA 2IHR1 1UHZA 2UU9E 4DR6E 4JI4E 4X65E 4NXME 2EZ6A 2B7TA 5CFFE 1J5EE 4JYAE 3ADJA 1YYOA 2LBSB 2B7VA 4M2ZA 3ADIA 1WHNA 2MDRA 3C4TA 4X8WA 4B3RE 5LMNE 3OTOE 2VQEE 2E5LE 1STUA 4K0KE 4DV1E 1N34E 4B3TE 2VQFE 2N3HA 4LFCE 2HHHE 2UUCE 4LF7E 3P1XA 1T4OA 5IWAE 2LTRA 4DUYE 5LMUE 4JI8E 2UUBE 4GKKE 2B3TB 1IBME 2RS6A 4DV3E 1N32E 2LJHA 4LF4E 1T4LB 2L2KB 4WYQB 2JVAA 4LFAE 2LTSA 4X62E 1XMOE 4GKJE 4X64E 2NUEA 2LRSA 1PKPA 4JI6E 3J7Yp 1I94E 4LF5E 4YHHE 4JV5E 4DV2E 4WFTA 4JI3E 1EKZA 1IBLE 2UXBE 1ZBTA 1XMQE 4LF9E 2L3CA 1FKAE 3C4BA 1HNXE 1YYKA 1J26A 4LFBE 1N33E 1O0WA 4DR5E 2L3JA 4YY3E 3VYXA 1QU6A 2L33A 1YYWA 4NXNE 1UILA 4KHPE 4JI5E 2UXCE 2YT4A 1RC7A 4JI7E 3VYYA 4AQYE 3T1YE 4X66E 2F4VE 3T1HE 2DB2A 4DR2E 2RSMA 3ADLA 2LUPB 4LF6E 1XNQE 5BR8E 2KHXA 4DV6E 2JY9A 1X47A 3LLHA 1X49A 4B3SE 1WHQA 1DI2A 1X48A 2UUAE 2NUGA 4DR4E 4DV0E 1HR0E 1N36E 4DV7E 4DUZE 2L2MA 2L2NA 1IBKE 1T4NA 2DMYA 3ADGA 4DR7E 1HNWE 1RQ0A 4LF8E 2NA2A 4DR3E 2NUFA 2RS7A 2DIXA 4JI0E 1FJGE 4DR1E 4DV5E 4JI2E 4B3ME 2N3GA 1HNZE 4M30A 4OX9E 4DV4E 2ZM6E
chains in the Genus database with same CATH superfamily
1YZ9A 2HC5A 2HJJA 1XNRE 1HNZE 4JI1E 2NABA 4ZYDA 1G2DC 4OOGC 2YTJA 4O24A 2EOQA 2JPAA 4DKKA 4JI4E 2EOFA 1NEIA 2DMIA 3K6QA 3J7AG 4NZVA 5A69A 1J5EE 1RMDA 3ADJA 4RH8A 5LL6R 5LMNE 3OMLA 2EMCA 2EPKX 2VQEE 2M1SA 1STUA 2EOXA 4K0KE 4DV1E 1AAYA 3HQ1A 3QG5C 2ODRC 2VQFE 2EN2A 4O43A 4LFCE 2D9HA 2A25A 1X3CA 2EOJA 2LTRA 2EN6A 2LMZA 2EN3A 2RS6A 3AV0A 1IBME 1TF3A 3IWBA 1Z1BA 4LU9A 2YSOA 2YTIA 2EJ4A 2Q8UA 2EL6A 4J8ZA 3MSWA 3J7Yp 4BMJA 4BCAA 4WFTA 5AC5A 2EPNA 5KL7A 1ZBTA 4R2PA 2UXBE 2YU5A 1J26A 3THOB 1A1IA 1MEYC 2JOBA 2RPCA 4GZNC 5AASA 1QU6A 1PDAA 1EH8A 4NXNE 4F2JC 2CT1A 5A6KA 1PJQA 2V85A 4JI5E 2DLQA 2EN4A 4R2QA 2LJUA 1A1KA 2B9DA 4JI7E 3VYYA 4X66E 3BIDA 2EN1A 2F4VE 4IS1C 2DB2A 4F54A 4BHCA 2RSMA 4P7DA 4LF6E 4BS9A 1X47A 1NCSA 4F9BB 1WHQA 1TF6A 3TQMA 3C6MA 5T6JA 2UUAE 2EMHA 1B69A 2DMYA 4DR7E 2EQ1A 4M9VC 2YTPA 2EMZA 4KZSA 2MKDA 2PRTA 2L6MA 4R2DA 3H09A 3C6KA 3MHHC 2YWQA 4F6MA 1FJGE 4DV5E 4JI2E 4FK5C 2N3GA 4HEIA 2VE7C 4M30A 4DR5E 1P47A 4X9JA 3HTXA 2YRMA 3HPZA 2V86A 5IV8B 4DMIA 2JR1A 4R2AA 1BBOA 2EOOA 3EQ1A 2EM7A 2RQLA 3J80C 3EPLA 1L4SA 4NXME 3LMLA 2EPMX 2LBSB 3KWRA 3JTZA 1F2IG 5AE2A 2EM9A 2E5LE 2EOIA 2MKNA 1N34E 2WBSA 4B3TE 3EPHA 3THNA 4P78A 1AH5A 4I8OA 1N32E 2LJHA 2LV2A 4LF4E 1T4LB 2L2KB 4WYQB 4O4KA 2EPPA 1PJSA 2LT7A 1DGCA 4LFAE 1IQOA 1BB8A 2LO3A 4N4RB 1A1GA 1PJTA 2YU8A 4O5GA 2I9IA 2ENAA 3F6GA 2EE8A 1N3GA 1I94E 4WX9A 3DJWA 2H36X 4WXCA 5A6BA 4DV2E 4BHBA 4JI3E 1EKZA 2DLKA 2EM5A 2L92A 2CTDA 2EM3A 2EOMA 2L3CA 2JWOA 1FKAE 4LF9E 1YYKA 4LFBE 2YTFA 1YSAC 4WSGA 1YUIA 3VYXA 2M4IA 3BGHA 2L33A 4WSPA 2EOSA 3VHTB 1TN9A 4Q28A 1SFEA 1MGTA 3ECRA 2YTGA 2FTXB 3L00A 2JXPA 3EPJA 2JP9A 2EN7A 4L5NC 2HGHA 1LLMC 4DR2E 1XNQE 5BR8E 5A6BD 3LLHA 3EPKA 2EMKA 4B3SE 2EPLX 1KJKA 2EQ0A 2MC5A 2EPRA 1DI2A 2V88A 2NUGA 2YTQA 1BBGA 4DV0E 1HR0E 2EOYA 4BC7A 3IWCA 4DUZE 4ZYHA 2EMIA 4KWYA 1HNWE 3RMPA 2MDGA 2YTEA 5AE3A 4LF8E 2NA2A 4DR3E 5KL6A 2ENHA 4B3ME 2EMWA 2FV4B 4F6NA 3HPSA 2EPZA 2ENCA 3JAMC 2RTXA 2LUQA 2UXDE 2LVHA 1GTKA 4F9CB 1A1FA 1GQEA 2CPNA 2WBUA 2IHR1 2V83A 2YTNA 1UHZA 4DR6E 1ZR9A 2B7TA 3F6HA 3ADIA 1WHNA 3C4TA 3OTOE 4R2SA 3VK6A 2WZOA 2EPOA 4R8OA 4R2EA 1YFHA 2N3HA 5ADZA 2HHHE 1ZBQA 2UUCE 4LF7E 4BC9A 1SR9A 3MHSC 4DUYE 2EP3A 2KOUA 5LMUE 2EPUA 4TUGA 4Q35B 4IJDA 1WJPA 2CSHA 2JVAA 3FIGA 1X5WA 2EPCA 2EWLA 2LTSA 4X62E 1XMOE 4GKJE 2YRKA 2BB8A 2DSYA 2MC6A 2WCC3 4JI6E 1PKPA 1WXRA 2BBGA 1ZU1A 2R1FA 4JV5E 1IMUA 4MLQA 2EMFA 2YTOA 2DRPA 1IBLE 1KYQA 2EM8A 5KL5A 1N33E 2N8XA 4RHBB 4YY3E 1YYWA 2EMXA 1X6HA 4KHPE 2ADRA 2EN8A 2E1MA 2UXCE 2EMYA 4MLVA 1RC7A 4AQYE 1X6EA 3T1YE 3M99B 2K4VA 4F9AB 3T1HE 2V89A 4ZYEA 2LUPB 2ELZA 2GLIA 2GHFA 2JY9A 4LTYA 4TUIA 4DR4E 2YRHA 2VF1A 1N36E 1QNTA 4DV7E 2L2MA 1YPNA 2L2NA 1IBKE 4WXDA 1T4NA 3ADGA 1YUJA 5AE1A 2EM0A 1RQ0A 2RSIA 1JK2A 5IXMB 2J7JA 3J81C 2EL4A 2EMLA 2F8BA 1X6FA 5A2QC 2E72A 3DF6A 2I13A 4OX9E 4DV4E 2V87A 2ZM6E 2FGGA 4NHRA 2DGCA 2YZTA 1T39A 1IQSA 2UU9E 1WRJA 4X65E 2EZ6A 5DNYA 2EM6A 3ZOQB 5CFFE 1UN6B 3KZYA 3BF2A 4JYAE 1A1JA 1YYOA 2EMBA 2B7VA 4M2ZA 2K7IA 2MDRA 4X8WA 4B3RE 1UBDC 1T38A 5KL2A 4WPYA 5KL3A 1EH7A 3JU0A 5AC4A 3BBGA 2EPAA 3P1XA 2EOEA 1T4OA 5IWAE 2YPNA 4JI8E 2UUBE 2V8QB 4GKKE 2B3TB 2WBTA 4DV3E 1JK1A 2EOZA 2ODRD 2EPXA 4X64E 2NUEA 2EM4A 2LRSA 4BBYA 4LF5E 2EMAA 4YHHE 2EOHA 2M9AA 1XMQE 2EMGA 3C4BA 1HNXE 1O0WA 2EORA 3KZZA 2L3JA 4M0VA 2ELYA 4R03A 2M7QA 1UILA 2YTDA 4GEQB 4ZYGA 2EM2A 2LCEA 5TSEA 2YT4A 2JOXA 5A6JA 2G7HA 4HTGA 5F3WA 3ADLA 2KHXA 3AUZA 4DV6E 3HXLA 1X49A 1X48A 5LLQA 2R76A 1A1HA 3UK3C 1G2FC 4R2CA 1EH6A 2YSPA 2GPIA 2VRDA 1ZAAC 1DQ3A 4R2RA 2LE2A 1A1LA 2EL5A 5IT9C 2KONA 2NUFA 5A6AA 5FLXC 2RS7A 2DIXA 4JI0E 4L8NA 4DR1E 2L8TA 1GZ6A 5KL4A 3IWDA 2EQ3A 2JYAA
chains in the Genus database with same CATH topology
1YZ9A 2FGGA 3JAMC 2RTXA 2LUQA 3HPZA 2V86A 3HTXA 1XNRE 1GZ6A 1HNZE 4JI1E 2UXDE 2YZTA 4F9CB 4OOGC 1GQEA 4DMIA 2JR1A 2CPNA 4DKKA 2IHR1 2V83A 1UHZA 2UU9E 4DR6E 4JI4E 3J80C 4X65E 4NXME 2EZ6A 3K6QA 3LMLA 5DNYA 2B7TA 3F6HA 3ZOQB 5CFFE 3J7AG 1J5EE 4JYAE 3ADJA 1YYOA 2LBSB 2B7VA 5LL6R 4M2ZA 3ADIA 3KWRA 1WHNA 3JTZA 2MDRA 3C4TA 4X8WA 4B3RE 5AE2A 5LMNE 3OMLA 3OTOE 2VQEE 2E5LE 2M1SA 1STUA 4K0KE 4DV1E 4WPYA 1N34E 3VK6A 2WZOA 3HQ1A 3JU0A 4B3TE 4R8OA 2ODRC 2VQFE 2N3HA 5ADZA 4LFCE 4P78A 2HHHE 1ZBQA 2UUCE 4LF7E 3P1XA 1T4OA 4BC9A 1SR9A 5IWAE 2LTRA 4DUYE 2KOUA 2LMZA 4I8OA 4JI8E 5LMUE 2V8QB 2UUBE 4GKKE 2B3TB 1IBME 2RS6A 3AV0A 4TUGA 4DV3E 2LJHA 4LF4E 1N32E 3IWBA 4LU9A 1T4LB 2L2KB 4WYQB 2JVAA 3FIGA 4LFAE 2EWLA 2LTSA 2ODRD 4X62E 1XMOE 4GKJE 4X64E 2DSYA 2MC6A 4J8ZA 2NUEA 3F6GA 4M30A 2LRSA 1PKPA 4BBYA 1WXRA 3MSWA 4JI6E 3J7Yp 1I94E 4LF5E 4YHHE 4BMJA 3DJWA 4BCAA 4JV5E 2H36X 4DV2E 4WFTA 4JI3E 1EKZA 2L92A 1IBLE 2UXBE 1ZBTA 1XMQE 4LF9E 2L3CA 2JWOA 3C4BA 1FKAE 1HNXE 1YYKA 1J26A 4LFBE 1N33E 1O0WA 2JOBA 4DR5E 2L3JA 4YY3E 4M0VA 5AASA 3VYXA 1QU6A 2M4IA 2L33A 4R03A 4WSPA 2M7QA 4NXNE 1YYWA 1UILA 4GEQB 4Q28A 4KHPE 2E1MA 2V85A 4JI5E 2UXCE 2YT4A 1RC7A 2B9DA 4JI7E 3VYYA 2FTXB 4AQYE 4X66E 3T1YE 2F4VE 2K4VA 4F9AB 3T1HE 2JOXA 4L5NC 2DB2A 2G7HA 2V89A 4F54A 4DR2E 2RSMA 4P7DA 2LUPB 5F3WA 4LF6E 1XNQE 3ADLA 5BR8E 2KHXA 3AUZA 2JY9A 3HXLA 1X47A 3LLHA 4BS9A 1X49A 4F9BB 4DV6E 1WHQA 4B3SE 2MC5A 4LTYA 5T6JA 1DI2A 1X48A 4TUIA 2UUAE 2V88A 2NUGA 4DR4E 4DV0E 1HR0E 2VF1A 1N36E 4DV7E 4BC7A 2L2MA 2L2NA 3IWCA 2ZM6E 4DUZE 1IBKE 1T4NA 2DMYA 3ADGA 4DR7E 5AE1A 1DQ3A 1HNWE 1RQ0A 3RMPA 4KZSA 5AE3A 2L6MA 2LE2A 3H09A 3J81C 4LF8E 2NA2A 4DR3E 2KONA 5IT9C 2F8BA 5FLXC 2RS7A 2DIXA 2NUFA 4JI0E 4L8NA 1FJGE 5A2QC 4DR1E 4DV5E 4JI2E 2L8TA 4B3ME 2N3GA 2VE7C 2FV4B 3DF6A 3IWDA 4OX9E 4DV4E 2V87A 3HPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZ9 A;  2RTX A;  2LUQ A;  3HTX A;  2UXD E;  1XNR E;  4JI1 E;  4OOG C;  1GQE A;  2CPN A;  4DKK A;  2IHR 1;  1UHZ A;  2UU9 E;  4DR6 E;  4JI4 E;  4X65 E;  4NXM E;  2EZ6 A;  2B7T A;  5CFF E;  1J5E E;  4JYA E;  3ADJ A;  1YYO A;  2LBS B;  2B7V A;  4M2Z A;  3ADI A;  1WHN A;  2MDR A;  3C4T A;  4X8W A;  4B3R E;  5LMN E;  3OTO E;  2VQE E;  2E5L E;  1STU A;  4K0K E;  4DV1 E;  1N34 E;  4B3T E;  2VQF E;  2N3H A;  4LFC E;  2HHH E;  2UUC E;  4LF7 E;  3P1X A;  1T4O A;  5IWA E;  2LTR A;  4DUY E;  5LMU E;  4JI8 E;  2UUB E;  4GKK E;  2B3T B;  1IBM E;  2RS6 A;  4DV3 E;  1N32 E;  2LJH A;  4LF4 E;  1T4L B;  2L2K B;  4WYQ B;  2JVA A;  4LFA E;  2LTS A;  4X62 E;  1XMO E;  4GKJ E;  4X64 E;  2NUE A;  2LRS A;  1PKP A;  4JI6 E;  3J7Y p;  1I94 E;  4LF5 E;  4YHH E;  4JV5 E;  4DV2 E;  4WFT A;  4JI3 E;  1EKZ A;  1IBL E;  2UXB E;  1ZBT A;  1XMQ E;  4LF9 E;  2L3C A;  1FKA E;  3C4B A;  1HNX E;  1YYK A;  1J26 A;  4LFB E;  1N33 E;  1O0W A;  4DR5 E;  2L3J A;  4YY3 E;  3VYX A;  1QU6 A;  2L33 A;  1YYW A;  4NXN E;  1UIL A;  4KHP E;  4JI5 E;  2UXC E;  2YT4 A;  1RC7 A;  4JI7 E;  3VYY A;  4AQY E;  3T1Y E;  4X66 E;  2F4V E;  3T1H E;  2DB2 A;  4DR2 E;  2RSM A;  3ADL A;  2LUP B;  4LF6 E;  1XNQ E;  5BR8 E;  2KHX A;  4DV6 E;  2JY9 A;  1X47 A;  3LLH A;  1X49 A;  4B3S E;  1WHQ A;  1DI2 A;  1X48 A;  2UUA E;  2NUG A;  4DR4 E;  4DV0 E;  1HR0 E;  1N36 E;  4DV7 E;  4DUZ E;  2L2M A;  2L2N A;  1IBK E;  1T4N A;  2DMY A;  3ADG A;  4DR7 E;  1HNW E;  1RQ0 A;  4LF8 E;  2NA2 A;  4DR3 E;  2NUF A;  2RS7 A;  2DIX A;  4JI0 E;  1FJG E;  4DR1 E;  4DV5 E;  4JI2 E;  4B3M E;  2N3G A;  1HNZ E;  4M30 A;  4OX9 E;  4DV4 E;  2ZM6 E; 
#chains in the Genus database with same CATH topology
 1YZ9 A;  2HC5 A;  2HJJ A;  1XNR E;  1HNZ E;  4JI1 E;  2NAB A;  4ZYD A;  1G2D C;  4OOG C;  2YTJ A;  4O24 A;  2EOQ A;  2JPA A;  4DKK A;  4JI4 E;  2EOF A;  1NEI A;  2DMI A;  3K6Q A;  3J7A G;  4NZV A;  5A69 A;  1J5E E;  1RMD A;  3ADJ A;  4RH8 A;  5LL6 R;  5LMN E;  3OML A;  2EMC A;  2EPK X;  2VQE E;  2M1S A;  1STU A;  2EOX A;  4K0K E;  4DV1 E;  1AAY A;  3HQ1 A;  3QG5 C;  2ODR C;  2VQF E;  2EN2 A;  4O43 A;  4LFC E;  2D9H A;  2A25 A;  1X3C A;  2EOJ A;  2LTR A;  2EN6 A;  2LMZ A;  2EN3 A;  2RS6 A;  3AV0 A;  1IBM E;  1TF3 A;  3IWB A;  1Z1B A;  4LU9 A;  2YSO A;  2YTI A;  2EJ4 A;  2Q8U A;  2EL6 A;  4J8Z A;  3MSW A;  3J7Y p;  4BMJ A;  4BCA A;  4WFT A;  5AC5 A;  2EPN A;  5KL7 A;  1ZBT A;  4R2P A;  2UXB E;  2YU5 A;  1J26 A;  3THO B;  1A1I A;  1MEY C;  2JOB A;  2RPC A;  4GZN C;  5AAS A;  1QU6 A;  1PDA A;  1EH8 A;  4NXN E;  4F2J C;  2CT1 A;  5A6K A;  1PJQ A;  2V85 A;  4JI5 E;  2DLQ A;  2EN4 A;  4R2Q A;  2LJU A;  1A1K A;  2B9D A;  4JI7 E;  3VYY A;  4X66 E;  3BID A;  2EN1 A;  2F4V E;  4IS1 C;  2DB2 A;  4F54 A;  4BHC A;  2RSM A;  4P7D A;  4LF6 E;  4BS9 A;  1X47 A;  1NCS A;  4F9B B;  1WHQ A;  1TF6 A;  3TQM A;  3C6M A;  5T6J A;  2UUA E;  2EMH A;  1B69 A;  2DMY A;  4DR7 E;  2EQ1 A;  4M9V C;  2YTP A;  2EMZ A;  4KZS A;  2MKD A;  2PRT A;  2L6M A;  4R2D A;  3H09 A;  3C6K A;  3MHH C;  2YWQ A;  4F6M A;  1FJG E;  4DV5 E;  4JI2 E;  4FK5 C;  2N3G A;  4HEI A;  2VE7 C;  4M30 A;  4DR5 E;  1P47 A;  4X9J A;  3HTX A;  2YRM A;  3HPZ A;  2V86 A;  5IV8 B;  4DMI A;  2JR1 A;  4R2A A;  1BBO A;  2EOO A;  3EQ1 A;  2EM7 A;  2RQL A;  3J80 C;  3EPL A;  1L4S A;  4NXM E;  3LML A;  2EPM X;  2LBS B;  3KWR A;  3JTZ A;  1F2I G;  5AE2 A;  2EM9 A;  2E5L E;  2EOI A;  2MKN A;  1N34 E;  2WBS A;  4B3T E;  3EPH A;  3THN A;  4P78 A;  1AH5 A;  4I8O A;  1N32 E;  2LJH A;  2LV2 A;  4LF4 E;  1T4L B;  2L2K B;  4WYQ B;  4O4K A;  2EPP A;  1PJS A;  2LT7 A;  1DGC A;  4LFA E;  1IQO A;  1BB8 A;  2LO3 A;  4N4R B;  1A1G A;  1PJT A;  2YU8 A;  4O5G A;  2I9I A;  2ENA A;  3F6G A;  2EE8 A;  1N3G A;  1I94 E;  4WX9 A;  3DJW A;  2H36 X;  4WXC A;  5A6B A;  4DV2 E;  4BHB A;  4JI3 E;  1EKZ A;  2DLK A;  2EM5 A;  2L92 A;  2CTD A;  2EM3 A;  2EOM A;  2L3C A;  2JWO A;  1FKA E;  4LF9 E;  1YYK A;  4LFB E;  2YTF A;  1YSA C;  4WSG A;  1YUI A;  3VYX A;  2M4I A;  3BGH A;  2L33 A;  4WSP A;  2EOS A;  3VHT B;  1TN9 A;  4Q28 A;  1SFE A;  1MGT A;  3ECR A;  2YTG A;  2FTX B;  3L00 A;  2JXP A;  3EPJ A;  2JP9 A;  2EN7 A;  4L5N C;  2HGH A;  1LLM C;  4DR2 E;  1XNQ E;  5BR8 E;  5A6B D;  3LLH A;  3EPK A;  2EMK A;  4B3S E;  2EPL X;  1KJK A;  2EQ0 A;  2MC5 A;  2EPR A;  1DI2 A;  2V88 A;  2NUG A;  2YTQ A;  1BBG A;  4DV0 E;  1HR0 E;  2EOY A;  4BC7 A;  3IWC A;  4DUZ E;  4ZYH A;  2EMI A;  4KWY A;  1HNW E;  3RMP A;  2MDG A;  2YTE A;  5AE3 A;  4LF8 E;  2NA2 A;  4DR3 E;  5KL6 A;  2ENH A;  4B3M E;  2EMW A;  2FV4 B;  4F6N A;  3HPS A;  2EPZ A;  2ENC A;  3JAM C;  2RTX A;  2LUQ A;  2UXD E;  2LVH A;  1GTK A;  4F9C B;  1A1F A;  1GQE A;  2CPN A;  2WBU A;  2IHR 1;  2V83 A;  2YTN A;  1UHZ A;  4DR6 E;  1ZR9 A;  2B7T A;  3F6H A;  3ADI A;  1WHN A;  3C4T A;  3OTO E;  4R2S A;  3VK6 A;  2WZO A;  2EPO A;  4R8O A;  4R2E A;  1YFH A;  2N3H A;  5ADZ A;  2HHH E;  1ZBQ A;  2UUC E;  4LF7 E;  4BC9 A;  1SR9 A;  3MHS C;  4DUY E;  2EP3 A;  2KOU A;  5LMU E;  2EPU A;  4TUG A;  4Q35 B;  4IJD A;  1WJP A;  2CSH A;  2JVA A;  3FIG A;  1X5W A;  2EPC A;  2EWL A;  2LTS A;  4X62 E;  1XMO E;  4GKJ E;  2YRK A;  2BB8 A;  2DSY A;  2MC6 A;  2WCC 3;  4JI6 E;  1PKP A;  1WXR A;  2BBG A;  1ZU1 A;  2R1F A;  4JV5 E;  1IMU A;  4MLQ A;  2EMF A;  2YTO A;  2DRP A;  1IBL E;  1KYQ A;  2EM8 A;  5KL5 A;  1N33 E;  2N8X A;  4RHB B;  4YY3 E;  1YYW A;  2EMX A;  1X6H A;  4KHP E;  2ADR A;  2EN8 A;  2E1M A;  2UXC E;  2EMY A;  4MLV A;  1RC7 A;  4AQY E;  1X6E A;  3T1Y E;  3M99 B;  2K4V A;  4F9A B;  3T1H E;  2V89 A;  4ZYE A;  2LUP B;  2ELZ A;  2GLI A;  2GHF A;  2JY9 A;  4LTY A;  4TUI A;  4DR4 E;  2YRH A;  2VF1 A;  1N36 E;  1QNT A;  4DV7 E;  2L2M A;  1YPN A;  2L2N A;  1IBK E;  4WXD A;  1T4N A;  3ADG A;  1YUJ A;  5AE1 A;  2EM0 A;  1RQ0 A;  2RSI A;  1JK2 A;  5IXM B;  2J7J A;  3J81 C;  2EL4 A;  2EML A;  2F8B A;  1X6F A;  5A2Q C;  2E72 A;  3DF6 A;  2I13 A;  4OX9 E;  4DV4 E;  2V87 A;  2ZM6 E;  2FGG A;  4NHR A;  2DGC A;  2YZT A;  1T39 A;  1IQS A;  2UU9 E;  1WRJ A;  4X65 E;  2EZ6 A;  5DNY A;  2EM6 A;  3ZOQ B;  5CFF E;  1UN6 B;  3KZY A;  3BF2 A;  4JYA E;  1A1J A;  1YYO A;  2EMB A;  2B7V A;  4M2Z A;  2K7I A;  2MDR A;  4X8W A;  4B3R E;  1UBD C;  1T38 A;  5KL2 A;  4WPY A;  5KL3 A;  1EH7 A;  3JU0 A;  5AC4 A;  3BBG A;  2EPA A;  3P1X A;  2EOE A;  1T4O A;  5IWA E;  2YPN A;  4JI8 E;  2UUB E;  2V8Q B;  4GKK E;  2B3T B;  2WBT A;  4DV3 E;  1JK1 A;  2EOZ A;  2ODR D;  2EPX A;  4X64 E;  2NUE A;  2EM4 A;  2LRS A;  4BBY A;  4LF5 E;  2EMA A;  4YHH E;  2EOH A;  2M9A A;  1XMQ E;  2EMG A;  3C4B A;  1HNX E;  1O0W A;  2EOR A;  3KZZ A;  2L3J A;  4M0V A;  2ELY A;  4R03 A;  2M7Q A;  1UIL A;  2YTD A;  4GEQ B;  4ZYG A;  2EM2 A;  2LCE A;  5TSE A;  2YT4 A;  2JOX A;  5A6J A;  2G7H A;  4HTG A;  5F3W A;  3ADL A;  2KHX A;  3AUZ A;  4DV6 E;  3HXL A;  1X49 A;  1X48 A;  5LLQ A;  2R76 A;  1A1H A;  3UK3 C;  1G2F C;  4R2C A;  1EH6 A;  2YSP A;  2GPI A;  2VRD A;  1ZAA C;  1DQ3 A;  4R2R A;  2LE2 A;  1A1L A;  2EL5 A;  5IT9 C;  2KON A;  2NUF A;  5A6A A;  5FLX C;  2RS7 A;  2DIX A;  4JI0 E;  4L8N A;  4DR1 E;  2L8T A;  1GZ6 A;  5KL4 A;  3IWD A;  2EQ3 A;  2JYA A; 
#chains in the Genus database with same CATH homology
 1YZ9 A;  2FGG A;  3JAM C;  2RTX A;  2LUQ A;  3HPZ A;  2V86 A;  3HTX A;  1XNR E;  1GZ6 A;  1HNZ E;  4JI1 E;  2UXD E;  2YZT A;  4F9C B;  4OOG C;  1GQE A;  4DMI A;  2JR1 A;  2CPN A;  4DKK A;  2IHR 1;  2V83 A;  1UHZ A;  2UU9 E;  4DR6 E;  4JI4 E;  3J80 C;  4X65 E;  4NXM E;  2EZ6 A;  3K6Q A;  3LML A;  5DNY A;  2B7T A;  3F6H A;  3ZOQ B;  5CFF E;  3J7A G;  1J5E E;  4JYA E;  3ADJ A;  1YYO A;  2LBS B;  2B7V A;  5LL6 R;  4M2Z A;  3ADI A;  3KWR A;  1WHN A;  3JTZ A;  2MDR A;  3C4T A;  4X8W A;  4B3R E;  5AE2 A;  5LMN E;  3OML A;  3OTO E;  2VQE E;  2E5L E;  2M1S A;  1STU A;  4K0K E;  4DV1 E;  4WPY A;  1N34 E;  3VK6 A;  2WZO A;  3HQ1 A;  3JU0 A;  4B3T E;  4R8O A;  2ODR C;  2VQF E;  2N3H A;  5ADZ A;  4LFC E;  4P78 A;  2HHH E;  1ZBQ A;  2UUC E;  4LF7 E;  3P1X A;  1T4O A;  4BC9 A;  1SR9 A;  5IWA E;  2LTR A;  4DUY E;  2KOU A;  2LMZ A;  4I8O A;  4JI8 E;  5LMU E;  2V8Q B;  2UUB E;  4GKK E;  2B3T B;  1IBM E;  2RS6 A;  3AV0 A;  4TUG A;  4DV3 E;  2LJH A;  4LF4 E;  1N32 E;  3IWB A;  4LU9 A;  1T4L B;  2L2K B;  4WYQ B;  2JVA A;  3FIG A;  4LFA E;  2EWL A;  2LTS A;  2ODR D;  4X62 E;  1XMO E;  4GKJ E;  4X64 E;  2DSY A;  2MC6 A;  4J8Z A;  2NUE A;  3F6G A;  4M30 A;  2LRS A;  1PKP A;  4BBY A;  1WXR A;  3MSW A;  4JI6 E;  3J7Y p;  1I94 E;  4LF5 E;  4YHH E;  4BMJ A;  3DJW A;  4BCA A;  4JV5 E;  2H36 X;  4DV2 E;  4WFT A;  4JI3 E;  1EKZ A;  2L92 A;  1IBL E;  2UXB E;  1ZBT A;  1XMQ E;  4LF9 E;  2L3C A;  2JWO A;  3C4B A;  1FKA E;  1HNX E;  1YYK A;  1J26 A;  4LFB E;  1N33 E;  1O0W A;  2JOB A;  4DR5 E;  2L3J A;  4YY3 E;  4M0V A;  5AAS A;  3VYX A;  1QU6 A;  2M4I A;  2L33 A;  4R03 A;  4WSP A;  2M7Q A;  4NXN E;  1YYW A;  1UIL A;  4GEQ B;  4Q28 A;  4KHP E;  2E1M A;  2V85 A;  4JI5 E;  2UXC E;  2YT4 A;  1RC7 A;  2B9D A;  4JI7 E;  3VYY A;  2FTX B;  4AQY E;  4X66 E;  3T1Y E;  2F4V E;  2K4V A;  4F9A B;  3T1H E;  2JOX A;  4L5N C;  2DB2 A;  2G7H A;  2V89 A;  4F54 A;  4DR2 E;  2RSM A;  4P7D A;  2LUP B;  5F3W A;  4LF6 E;  1XNQ E;  3ADL A;  5BR8 E;  2KHX A;  3AUZ A;  2JY9 A;  3HXL A;  1X47 A;  3LLH A;  4BS9 A;  1X49 A;  4F9B B;  4DV6 E;  1WHQ A;  4B3S E;  2MC5 A;  4LTY A;  5T6J A;  1DI2 A;  1X48 A;  4TUI A;  2UUA E;  2V88 A;  2NUG A;  4DR4 E;  4DV0 E;  1HR0 E;  2VF1 A;  1N36 E;  4DV7 E;  4BC7 A;  2L2M A;  2L2N A;  3IWC A;  2ZM6 E;  4DUZ E;  1IBK E;  1T4N A;  2DMY A;  3ADG A;  4DR7 E;  5AE1 A;  1DQ3 A;  1HNW E;  1RQ0 A;  3RMP A;  4KZS A;  5AE3 A;  2L6M A;  2LE2 A;  3H09 A;  3J81 C;  4LF8 E;  2NA2 A;  4DR3 E;  2KON A;  5IT9 C;  2F8B A;  5FLX C;  2RS7 A;  2DIX A;  2NUF A;  4JI0 E;  4L8N A;  1FJG E;  5A2Q C;  4DR1 E;  4DV5 E;  4JI2 E;  2L8T A;  4B3M E;  2N3G A;  2VE7 C;  2FV4 B;  3DF6 A;  3IWD A;  4OX9 E;  4DV4 E;  2V87 A;  3HPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...