3P1XA

Crystal structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords Interleukin enhancer-binding factor 3
publication title Crystal structure of DRBM 2 domain of Interleukin enhancer-binding factor 3 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4527E
rcsb
total genus 11
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3p1xA00
4JI8E 3T1YE 4NXNE 2LUPB 4B3TE 3T1HE 2LBSB 1X49A 1ZBTA 1YYOA 4X65E 3HTXA 1HNWE 2KHXA 4DV4E 1O0WA 4JV5E 1WHNA 4DV2E 4DR6E 4DR2E 2N3HA 2E5LE 4X62E 3J7Yp 3LLHA 2YT4A 4LFCE 2JY9A 1RC7A 4M30A 4DR7E 4WYQB 4B3SE 4LF4E 1T4NA 1STUA 2LTSA 4JI5E 2B7TA 1HR0E 1QU6A 2NUFA 4LFBE 1IBLE 2LJHA 1X47A 4NXME 2DIXA 1UILA 1N33E 2MDRA 1N34E 3P1XA 1YYKA 2HHHE 1XNQE 2UUBE 2NUGA 4JI2E 4X8WA 1J26A 2UXCE 2EZ6A 4AQYE 1PKPA 4JI0E 4DUYE 5LMNE 1X48A 2LUQA 2ZM6E 4X64E 2NUEA 3ADJA 4DUZE 2UXDE 2L2NA 5IWAE 1T4OA 4LF8E 3ADIA 4DV7E 4DV0E 4JI3E 2VQFE 4KHPE 1HNZE 2UU9E 1FKAE 2L2MA 2B7VA 3C4BA 4LF5E 1J5EE 4JI4E 2UUCE 2RS6A 2LRSA 1XMOE 5LMUE 4DV3E 1RQ0A 1WHQA 4GKKE 1GQEA 4GKJE 4LF6E 2DB2A 4DR5E 4JYAE 2UXBE 2RTXA 4OX9E 4JI1E 3VYYA 1XMQE 1HNXE 1FJGE 3C4TA 1T4LB 1IBKE 2L33A 3OTOE 2UUAE 3ADGA 2L2KB 4JI6E 4JI7E 4DR3E 4B3ME 4DV1E 4YHHE 2RSMA 1EKZA 2F4VE 4YY3E 3VYXA 2CPNA 2DMYA 4K0KE 4LF9E 2LTRA 2B3TB 1N36E 2L3CA 2NA2A 4OOGC 4DR1E 4WFTA 2VQEE 5BR8E 4X66E 4LFAE 1N32E 4LF7E 4DR4E 2RS7A 3ADLA 4DV6E 2N3GA 5CFFE 1I94E 2JVAA 1UHZA 1IBME 1YYWA 4DKKA 1YZ9A 4DV5E 4B3RE 1XNRE 2IHR1 1DI2A 4M2ZA 2L3JA
chains in the Genus database with same CATH superfamily
2V8QB 4NXNE 3T1HE 1X49A 1YYOA 1DGCA 1HNWE 2DLQA 4BHBA 1SFEA 2EMAA 2JXPA 5F3WA 2EOHA 4DR2E 4X62E 4BCAA 2JWOA 2MDGA 3LLHA 2DSYA 3MSWA 2YT4A 2YTFA 4LFCE 2EM8A 2EMBA 4B3SE 4F9CB 1T4NA 4BC9A 2YTOA 3ZOQB 4JI5E 2JR1A 2LCEA 4O24A 3IWBA 1HR0E 4LFBE 1QU6A 3IWCA 2YTJA 1TN9A 5AC4A 3HXLA 1IBLE 1X47A 2DIXA 2V89A 2MDRA 2I9IA 3F6HA 4FK5C 2EOJA 1A1LA 2YSOA 2LE2A 1WJPA 4R03A 1RMDA 5LMNE 2K4VA 1T39A 2NUEA 3ADJA 1UBDC 2L2NA 5IWAE 2WBTA 2YU8A 3ADIA 4DV7E 3KZYA 2UU9E 1FKAE 2L2MA 5AE3A 1A1JA 5KL3A 2M1SA 1MGTA 3EPJA 4KZSA 2KOUA 4ZYDA 1B69A 1X5WA 2ODRC 2R76A 1RQ0A 4ZYEA 2EMWA 1GQEA 4KWYA 4DMIA 1A1IA 4WSPA 4JYAE 4JI1E 3BF2A 3H09A 3VYYA 4IJDA 2EORA 2JOBA 2UUAE 3KWRA 1T38A 3AV0A 5KL5A 3VYXA 2F4VE 4WPYA 4YY3E 3IWDA 2CPNA 4K0KE 2EPPA 4F54A 3BIDA 1TF3A 4GEQB 1TF6A 1N36E 2L3CA 1MEYC 2NA2A 4WFTA 4WSGA 1N32E 1ZBQA 2EM0A 3MHSC 2EPOA 4TUIA 2N3GA 4BMJA 4R2DA 1I94E 1UHZA 5KL7A 2BB8A 4Q35B 2D9HA 4F6NA 2EOIA 4F9AB 4M2ZA 2E72A 2EL4A 2ELYA 2L3JA 4JI8E 4M9VC 2LJUA 2LBSB 2EN8A 2R1FA 1ZAAC 3HTXA 1O0WA 2LMZA 4MLVA 3KZZA 4JV5E 3EPKA 2ENCA 5FLXC 2E5LE 1ZU1A 2YTNA 2B9DA 2YSPA 5KL6A 1BB8A 5IXMB 2JYAA 4GZNC 4DR7E 5AASA 2DMIA 2RPCA 1YUJA 3QG5C 1AH5A 4L8NA 4O43A 3BBGA 2NUFA 2DGCA 2EM5A 2YU5A 1UILA 2EQ3A 1YYKA 2JP9A 3DJWA 4JI2E 1P47A 3HPZA 2ODRD 3AUZA 2WBSA 2EMXA 1PJTA 2EMKA 2ADRA 3JU0A 1PKPA 4F6MA 2LUQA 2ZM6E 1BBGA 2YRHA 2RQLA 4RHBB 4DV0E 2EMCA 4JI3E 2EE8A 3RMPA 2L92A 2EM7A 4JI4E 2UUCE 1A1HA 1XMOE 5A6KA 4IS1C 4P78A 2YTPA 1DQ3A 1A1FA 4GKKE 3F6GA 1ZR9A 4GKJE 2DB2A 2DRPA 4DR5E 4TUGA 3EQ1A 2EMLA 2EN3A 4OX9E 4BBYA 3VK6A 4X9JA 1FJGE 2EN2A 1IBKE 3J7AG 4JI6E 2M4IA 4WX9A 2EOQA 4B3ME 4DV1E 4YHHE 2V88A 1X6EA 2E1MA 1WXRA 1A1KA 1GTKA 2FGGA 4DR1E 2EOZA 2RS7A 3THOB 1UN6B 4DV6E 4Q28A 2LV2A 2KONA 2JVAA 1YYWA 2GPIA 1YZ9A 2MC6A 1XNRE 2IHR1 2PRTA 2GHFA 2HJJA 5IT9C 2EPZA 4B3TE 1ZBTA 2EMYA 2EOYA 2KHXA 5KL2A 4NZVA 2L8TA 4DV2E 4DR6E 1X6HA 2V86A 2WZOA 2N3HA 2EWLA 2NABA 1PJSA 5LL6R 2EL5A 4WXDA 1RC7A 4WYQB 2FTXB 1F2IG 4O5GA 1NEIA 2EMIA 2LT7A 2MC5A 3K6QA 2B7TA 3HQ1A 3DF6A 2ENAA 2EMFA 3L00A 1N33E 2EM3A 4R2QA 1N34E 2HHHE 5KL4A 2UUBE 2NUGA 3OMLA 5LLQA 1JK1A 2EM9A 2EPXA 1J26A 1G2DC 2YTDA 2UXCE 4ZYGA 4ZYHA 2EL6A 2EPCA 2WBUA 1QNTA 1NCSA 3JTZA 2VRDA 4X64E 5A6JA 1WRJA 2CT1A 4R2SA 4RH8A 2UXDE 1T4OA 2L6MA 4HTGA 3LMLA 2VQFE 1JK2A 4J8ZA 1HNZE 4WXCA 2JOXA 2EOOA 2DLKA 2B7VA 4LF5E 2MKDA 2RS6A 2LRSA 3ECRA 1SR9A 1EH7A 5AE1A 4R2EA 4LF6E 1AAYA 2EPKX 1YUIA 2EN6A 2YTIA 2RTXA 2V83A 2V87A 4HEIA 3FIGA 2EOXA 1HNXE 3C4TA 1T4LB 3OTOE 3ADGA 2L2KB 2ENHA 4BHCA 5A2QC 2MKNA 4NHRA 4DR3E 1PDAA 3M99B 1EH6A 1GZ6A 1YFHA 2HGHA 1BBOA 5A6BD 2DMYA 4LF9E 1PJQA 2LTRA 2EN4A 3BGHA 4OOGC 2VQEE 1G2FC 5BR8E 4X66E 2VE7C 5A6BA 3ADLA 2HC5A 2GLIA 2EMHA 1KJKA 2YRMA 2YRKA 1YPNA 2EMZA 2G7HA 4R2PA 2F8BA 4BS9A 5A6AA 5A69A 3T1YE 2LUPB 4O4KA 4X65E 2EM6A 2EPRA 2BBGA 2YZTA 4DV4E 5DNYA 4F2JC 4L5NC 2CSHA 1Z1BA 3HPSA 1WHNA 2V85A 2EM2A 2EOSA 2A25A 2EN7A 2VF1A 2CTDA 1IQSA 3J7Yp 2EOFA 2JY9A 2YTQA 4N4RB 4M30A 4LF4E 3J81C 1STUA 5AC5A 2LTSA 5TSEA 2EOMA 1IQOA 4I8OA 1KYQA 2LJHA 4NXME 3C6KA 2N8XA 3P1XA 1XNQE 2EN1A 4MLQA 1X3CA 4X8WA 1LLMC 2LO3A 2H36X 4R2RA 3EPHA 3VHTB 2EZ6A 4AQYE 2Q8UA 4JI0E 2EQ0A 2FV4B 5AE2A 4DUYE 4R8OA 1X48A 1L4SA 3J80C 2YWQA 2J7JA 2EPMX 2RSIA 4DUZE 4R2CA 4LF8E 1YSAC 2YPNA 4BC7A 5IV8B 2EJ4A 4KHPE 2LVHA 3UK3C 3TQMA 3EPLA 2EOEA 4R2AA 3C6MA 3C4BA 1J5EE 4M0VA 4LU9A 4LTYA 5LMUE 4DV3E 1WHQA 3THNA 5ADZA 2M9AA 1A1GA 2UXBE 2YTEA 1XMQE 2WCC3 2EPUA 1IMUA 2EPAA 2L33A 3MHHC 5T6JA 2EQ1A 4JI7E 1EKZA 2RSMA 1N3GA 2EP3A 1X6FA 2B3TB 2M7QA 2EPLX 2I13A 2EM4A 4LFAE 2EMGA 4LF7E 4DR4E 2EPNA 5CFFE 1IBME 2ELZA 4DKKA 3JAMC 4P7DA 4DV5E 2K7IA 4B3RE 4F9BB 1EH8A 2JPAA 1DI2A 2YTGA
chains in the Genus database with same CATH topology
2V8QB 4JI8E 3T1YE 4NXNE 2LUPB 4B3TE 3T1HE 2LBSB 1X49A 1ZBTA 1YYOA 4X65E 3HTXA 1HNWE 2KHXA 2YZTA 4DV4E 5DNYA 1O0WA 4L5NC 2LMZA 3HPSA 4JV5E 1WHNA 5F3WA 2V85A 2L8TA 4DV2E 5FLXC 4DR6E 2V86A 2WZOA 4DR2E 2N3HA 2E5LE 2EWLA 4X62E 4BCAA 2JWOA 2VF1A 3J7Yp 3LLHA 2DSYA 3MSWA 5LL6R 2YT4A 2B9DA 2JY9A 4LFCE 1RC7A 4M30A 4DR7E 5AASA 4WYQB 4B3SE 2FTXB 1T4NA 1STUA 4BC9A 4F9CB 3J81C 2LTSA 4LF4E 3ZOQB 4JI5E 4L8NA 2MC5A 2JR1A 3K6QA 3IWBA 2B7TA 1HR0E 1QU6A 3IWCA 3HQ1A 3DF6A 4I8OA 2NUFA 4LFBE 3HXLA 1IBLE 2LJHA 1X47A 4NXME 2DIXA 1UILA 1N33E 2V89A 2MDRA 1N34E 3P1XA 1YYKA 2HHHE 1XNQE 2UUBE 2NUGA 3DJWA 3F6HA 4JI2E 3OMLA 4X8WA 3HPZA 2ODRD 3AUZA 1J26A 2H36X 3VYXA 2UXCE 2EZ6A 4AQYE 2LE2A 3JU0A 1PKPA 4JI0E 2FV4B 4R03A 5AE2A 4DUYE 5LMNE 2K4VA 1X48A 4R8OA 2LUQA 3J80C 3JTZA 2ZM6E 4X64E 2NUEA 3ADJA 4DUZE 2UXDE 2L2NA 5IWAE 1T4OA 4LF8E 2L6MA 3ADIA 4DV7E 4DV0E 4BC7A 4JI3E 3LMLA 2VQFE 4KHPE 4J8ZA 1HNZE 2JOXA 3RMPA 2L92A 2UU9E 1FKAE 2L2MA 5AE3A 2B7VA 3C4BA 4LF5E 1J5EE 4M0VA 2UUCE 2M1SA 2RS6A 2LRSA 4JI4E 4KZSA 4LU9A 2KOUA 4LTYA 1XMOE 5LMUE 2ODRC 4DV3E 1SR9A 1RQ0A 4P78A 1DQ3A 1WHQA 5AE1A 4GKKE 1GQEA 3F6GA 5ADZA 4LF6E 2DB2A 4GKJE 4DMIA 4DR5E 4WSPA 4TUGA 4JYAE 2UXBE 2RTXA 2V83A 4OX9E 2V87A 4BBYA 3VK6A 3FIGA 4JI1E 3H09A 3VYYA 1XMQE 1HNXE 2JOBA 3C4TA 1T4LB 1IBKE 2L33A 3OTOE 2UUAE 3ADGA 2L2KB 3J7AG 5T6JA 4JI6E 3KWRA 1FJGE 5A2QC 2M4IA 4JI7E 4DR3E 3AV0A 4B3ME 4DV1E 4YHHE 1GZ6A 2RSMA 4WPYA 4YY3E 3IWDA 1EKZA 2CPNA 2V88A 2F4VE 2DMYA 4K0KE 4LF9E 4F54A 2LTRA 2B3TB 4GEQB 2M7QA 2E1MA 1WXRA 1N36E 2L3CA 2FGGA 2NA2A 4OOGC 4DR1E 4WFTA 2VQEE 5BR8E 4X66E 4LFAE 1N32E 2VE7C 1ZBQA 4LF7E 4DR4E 2RS7A 3ADLA 4DV6E 4TUIA 2N3GA 4Q28A 4BMJA 2KONA 5CFFE 1I94E 2JVAA 1UHZA 1IBME 1YYWA 4DKKA 3JAMC 4P7DA 4M2ZA 4DV5E 1YZ9A 4B3RE 2MC6A 2G7HA 4F9BB 4F9AB 2IHR1 1XNRE 1DI2A 2F8BA 4BS9A 2L3JA 5IT9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 E;  3T1Y E;  4NXN E;  2LUP B;  4B3T E;  3T1H E;  2LBS B;  1X49 A;  1ZBT A;  1YYO A;  4X65 E;  3HTX A;  1HNW E;  2KHX A;  4DV4 E;  1O0W A;  4JV5 E;  1WHN A;  4DV2 E;  4DR6 E;  4DR2 E;  2N3H A;  2E5L E;  4X62 E;  3J7Y p;  3LLH A;  2YT4 A;  4LFC E;  2JY9 A;  1RC7 A;  4M30 A;  4DR7 E;  4WYQ B;  4B3S E;  4LF4 E;  1T4N A;  1STU A;  2LTS A;  4JI5 E;  2B7T A;  1HR0 E;  1QU6 A;  2NUF A;  4LFB E;  1IBL E;  2LJH A;  1X47 A;  4NXM E;  2DIX A;  1UIL A;  1N33 E;  2MDR A;  1N34 E;  3P1X A;  1YYK A;  2HHH E;  1XNQ E;  2UUB E;  2NUG A;  4JI2 E;  4X8W A;  1J26 A;  2UXC E;  2EZ6 A;  4AQY E;  1PKP A;  4JI0 E;  4DUY E;  5LMN E;  1X48 A;  2LUQ A;  2ZM6 E;  4X64 E;  2NUE A;  3ADJ A;  4DUZ E;  2UXD E;  2L2N A;  5IWA E;  1T4O A;  4LF8 E;  3ADI A;  4DV7 E;  4DV0 E;  4JI3 E;  2VQF E;  4KHP E;  1HNZ E;  2UU9 E;  1FKA E;  2L2M A;  2B7V A;  3C4B A;  4LF5 E;  1J5E E;  4JI4 E;  2UUC E;  2RS6 A;  2LRS A;  1XMO E;  5LMU E;  4DV3 E;  1RQ0 A;  1WHQ A;  4GKK E;  1GQE A;  4GKJ E;  4LF6 E;  2DB2 A;  4DR5 E;  4JYA E;  2UXB E;  2RTX A;  4OX9 E;  4JI1 E;  3VYY A;  1XMQ E;  1HNX E;  1FJG E;  3C4T A;  1T4L B;  1IBK E;  2L33 A;  3OTO E;  2UUA E;  3ADG A;  2L2K B;  4JI6 E;  4JI7 E;  4DR3 E;  4B3M E;  4DV1 E;  4YHH E;  2RSM A;  1EKZ A;  2F4V E;  4YY3 E;  3VYX A;  2CPN A;  2DMY A;  4K0K E;  4LF9 E;  2LTR A;  2B3T B;  1N36 E;  2L3C A;  2NA2 A;  4OOG C;  4DR1 E;  4WFT A;  2VQE E;  5BR8 E;  4X66 E;  4LFA E;  1N32 E;  4LF7 E;  4DR4 E;  2RS7 A;  3ADL A;  4DV6 E;  2N3G A;  5CFF E;  1I94 E;  2JVA A;  1UHZ A;  1IBM E;  1YYW A;  4DKK A;  1YZ9 A;  4DV5 E;  4B3R E;  1XNR E;  2IHR 1;  1DI2 A;  4M2Z A;  2L3J A; 
#chains in the Genus database with same CATH topology
 2V8Q B;  4NXN E;  3T1H E;  1X49 A;  1YYO A;  1DGC A;  1HNW E;  2DLQ A;  4BHB A;  1SFE A;  2EMA A;  2JXP A;  5F3W A;  2EOH A;  4DR2 E;  4X62 E;  4BCA A;  2JWO A;  2MDG A;  3LLH A;  2DSY A;  3MSW A;  2YT4 A;  2YTF A;  4LFC E;  2EM8 A;  2EMB A;  4B3S E;  4F9C B;  1T4N A;  4BC9 A;  2YTO A;  3ZOQ B;  4JI5 E;  2JR1 A;  2LCE A;  4O24 A;  3IWB A;  1HR0 E;  4LFB E;  1QU6 A;  3IWC A;  2YTJ A;  1TN9 A;  5AC4 A;  3HXL A;  1IBL E;  1X47 A;  2DIX A;  2V89 A;  2MDR A;  2I9I A;  3F6H A;  4FK5 C;  2EOJ A;  1A1L A;  2YSO A;  2LE2 A;  1WJP A;  4R03 A;  1RMD A;  5LMN E;  2K4V A;  1T39 A;  2NUE A;  3ADJ A;  1UBD C;  2L2N A;  5IWA E;  2WBT A;  2YU8 A;  3ADI A;  4DV7 E;  3KZY A;  2UU9 E;  1FKA E;  2L2M A;  5AE3 A;  1A1J A;  5KL3 A;  2M1S A;  1MGT A;  3EPJ A;  4KZS A;  2KOU A;  4ZYD A;  1B69 A;  1X5W A;  2ODR C;  2R76 A;  1RQ0 A;  4ZYE A;  2EMW A;  1GQE A;  4KWY A;  4DMI A;  1A1I A;  4WSP A;  4JYA E;  4JI1 E;  3BF2 A;  3H09 A;  3VYY A;  4IJD A;  2EOR A;  2JOB A;  2UUA E;  3KWR A;  1T38 A;  3AV0 A;  5KL5 A;  3VYX A;  2F4V E;  4WPY A;  4YY3 E;  3IWD A;  2CPN A;  4K0K E;  2EPP A;  4F54 A;  3BID A;  1TF3 A;  4GEQ B;  1TF6 A;  1N36 E;  2L3C A;  1MEY C;  2NA2 A;  4WFT A;  4WSG A;  1N32 E;  1ZBQ A;  2EM0 A;  3MHS C;  2EPO A;  4TUI A;  2N3G A;  4BMJ A;  4R2D A;  1I94 E;  1UHZ A;  5KL7 A;  2BB8 A;  4Q35 B;  2D9H A;  4F6N A;  2EOI A;  4F9A B;  4M2Z A;  2E72 A;  2EL4 A;  2ELY A;  2L3J A;  4JI8 E;  4M9V C;  2LJU A;  2LBS B;  2EN8 A;  2R1F A;  1ZAA C;  3HTX A;  1O0W A;  2LMZ A;  4MLV A;  3KZZ A;  4JV5 E;  3EPK A;  2ENC A;  5FLX C;  2E5L E;  1ZU1 A;  2YTN A;  2B9D A;  2YSP A;  5KL6 A;  1BB8 A;  5IXM B;  2JYA A;  4GZN C;  4DR7 E;  5AAS A;  2DMI A;  2RPC A;  1YUJ A;  3QG5 C;  1AH5 A;  4L8N A;  4O43 A;  3BBG A;  2NUF A;  2DGC A;  2EM5 A;  2YU5 A;  1UIL A;  2EQ3 A;  1YYK A;  2JP9 A;  3DJW A;  4JI2 E;  1P47 A;  3HPZ A;  2ODR D;  3AUZ A;  2WBS A;  2EMX A;  1PJT A;  2EMK A;  2ADR A;  3JU0 A;  1PKP A;  4F6M A;  2LUQ A;  2ZM6 E;  1BBG A;  2YRH A;  2RQL A;  4RHB B;  4DV0 E;  2EMC A;  4JI3 E;  2EE8 A;  3RMP A;  2L92 A;  2EM7 A;  4JI4 E;  2UUC E;  1A1H A;  1XMO E;  5A6K A;  4IS1 C;  4P78 A;  2YTP A;  1DQ3 A;  1A1F A;  4GKK E;  3F6G A;  1ZR9 A;  4GKJ E;  2DB2 A;  2DRP A;  4DR5 E;  4TUG A;  3EQ1 A;  2EML A;  2EN3 A;  4OX9 E;  4BBY A;  3VK6 A;  4X9J A;  1FJG E;  2EN2 A;  1IBK E;  3J7A G;  4JI6 E;  2M4I A;  4WX9 A;  2EOQ A;  4B3M E;  4DV1 E;  4YHH E;  2V88 A;  1X6E A;  2E1M A;  1WXR A;  1A1K A;  1GTK A;  2FGG A;  4DR1 E;  2EOZ A;  2RS7 A;  3THO B;  1UN6 B;  4DV6 E;  4Q28 A;  2LV2 A;  2KON A;  2JVA A;  1YYW A;  2GPI A;  1YZ9 A;  2MC6 A;  1XNR E;  2IHR 1;  2PRT A;  2GHF A;  2HJJ A;  5IT9 C;  2EPZ A;  4B3T E;  1ZBT A;  2EMY A;  2EOY A;  2KHX A;  5KL2 A;  4NZV A;  2L8T A;  4DV2 E;  4DR6 E;  1X6H A;  2V86 A;  2WZO A;  2N3H A;  2EWL A;  2NAB A;  1PJS A;  5LL6 R;  2EL5 A;  4WXD A;  1RC7 A;  4WYQ B;  2FTX B;  1F2I G;  4O5G A;  1NEI A;  2EMI A;  2LT7 A;  2MC5 A;  3K6Q A;  2B7T A;  3HQ1 A;  3DF6 A;  2ENA A;  2EMF A;  3L00 A;  1N33 E;  2EM3 A;  4R2Q A;  1N34 E;  2HHH E;  5KL4 A;  2UUB E;  2NUG A;  3OML A;  5LLQ A;  1JK1 A;  2EM9 A;  2EPX A;  1J26 A;  1G2D C;  2YTD A;  2UXC E;  4ZYG A;  4ZYH A;  2EL6 A;  2EPC A;  2WBU A;  1QNT A;  1NCS A;  3JTZ A;  2VRD A;  4X64 E;  5A6J A;  1WRJ A;  2CT1 A;  4R2S A;  4RH8 A;  2UXD E;  1T4O A;  2L6M A;  4HTG A;  3LML A;  2VQF E;  1JK2 A;  4J8Z A;  1HNZ E;  4WXC A;  2JOX A;  2EOO A;  2DLK A;  2B7V A;  4LF5 E;  2MKD A;  2RS6 A;  2LRS A;  3ECR A;  1SR9 A;  1EH7 A;  5AE1 A;  4R2E A;  4LF6 E;  1AAY A;  2EPK X;  1YUI A;  2EN6 A;  2YTI A;  2RTX A;  2V83 A;  2V87 A;  4HEI A;  3FIG A;  2EOX A;  1HNX E;  3C4T A;  1T4L B;  3OTO E;  3ADG A;  2L2K B;  2ENH A;  4BHC A;  5A2Q C;  2MKN A;  4NHR A;  4DR3 E;  1PDA A;  3M99 B;  1EH6 A;  1GZ6 A;  1YFH A;  2HGH A;  1BBO A;  5A6B D;  2DMY A;  4LF9 E;  1PJQ A;  2LTR A;  2EN4 A;  3BGH A;  4OOG C;  2VQE E;  1G2F C;  5BR8 E;  4X66 E;  2VE7 C;  5A6B A;  3ADL A;  2HC5 A;  2GLI A;  2EMH A;  1KJK A;  2YRM A;  2YRK A;  1YPN A;  2EMZ A;  2G7H A;  4R2P A;  2F8B A;  4BS9 A;  5A6A A;  5A69 A;  3T1Y E;  2LUP B;  4O4K A;  4X65 E;  2EM6 A;  2EPR A;  2BBG A;  2YZT A;  4DV4 E;  5DNY A;  4F2J C;  4L5N C;  2CSH A;  1Z1B A;  3HPS A;  1WHN A;  2V85 A;  2EM2 A;  2EOS A;  2A25 A;  2EN7 A;  2VF1 A;  2CTD A;  1IQS A;  3J7Y p;  2EOF A;  2JY9 A;  2YTQ A;  4N4R B;  4M30 A;  4LF4 E;  3J81 C;  1STU A;  5AC5 A;  2LTS A;  5TSE A;  2EOM A;  1IQO A;  4I8O A;  1KYQ A;  2LJH A;  4NXM E;  3C6K A;  2N8X A;  3P1X A;  1XNQ E;  2EN1 A;  4MLQ A;  1X3C A;  4X8W A;  1LLM C;  2LO3 A;  2H36 X;  4R2R A;  3EPH A;  3VHT B;  2EZ6 A;  4AQY E;  2Q8U A;  4JI0 E;  2EQ0 A;  2FV4 B;  5AE2 A;  4DUY E;  4R8O A;  1X48 A;  1L4S A;  3J80 C;  2YWQ A;  2J7J A;  2EPM X;  2RSI A;  4DUZ E;  4R2C A;  4LF8 E;  1YSA C;  2YPN A;  4BC7 A;  5IV8 B;  2EJ4 A;  4KHP E;  2LVH A;  3UK3 C;  3TQM A;  3EPL A;  2EOE A;  4R2A A;  3C6M A;  3C4B A;  1J5E E;  4M0V A;  4LU9 A;  4LTY A;  5LMU E;  4DV3 E;  1WHQ A;  3THN A;  5ADZ A;  2M9A A;  1A1G A;  2UXB E;  2YTE A;  1XMQ E;  2WCC 3;  2EPU A;  1IMU A;  2EPA A;  2L33 A;  3MHH C;  5T6J A;  2EQ1 A;  4JI7 E;  1EKZ A;  2RSM A;  1N3G A;  2EP3 A;  1X6F A;  2B3T B;  2M7Q A;  2EPL X;  2I13 A;  2EM4 A;  4LFA E;  2EMG A;  4LF7 E;  4DR4 E;  2EPN A;  5CFF E;  1IBM E;  2ELZ A;  4DKK A;  3JAM C;  4P7D A;  4DV5 E;  2K7I A;  4B3R E;  4F9B B;  1EH8 A;  2JPA A;  1DI2 A;  2YTG A; 
#chains in the Genus database with same CATH homology
 2V8Q B;  4JI8 E;  3T1Y E;  4NXN E;  2LUP B;  4B3T E;  3T1H E;  2LBS B;  1X49 A;  1ZBT A;  1YYO A;  4X65 E;  3HTX A;  1HNW E;  2KHX A;  2YZT A;  4DV4 E;  5DNY A;  1O0W A;  4L5N C;  2LMZ A;  3HPS A;  4JV5 E;  1WHN A;  5F3W A;  2V85 A;  2L8T A;  4DV2 E;  5FLX C;  4DR6 E;  2V86 A;  2WZO A;  4DR2 E;  2N3H A;  2E5L E;  2EWL A;  4X62 E;  4BCA A;  2JWO A;  2VF1 A;  3J7Y p;  3LLH A;  2DSY A;  3MSW A;  5LL6 R;  2YT4 A;  2B9D A;  2JY9 A;  4LFC E;  1RC7 A;  4M30 A;  4DR7 E;  5AAS A;  4WYQ B;  4B3S E;  2FTX B;  1T4N A;  1STU A;  4BC9 A;  4F9C B;  3J81 C;  2LTS A;  4LF4 E;  3ZOQ B;  4JI5 E;  4L8N A;  2MC5 A;  2JR1 A;  3K6Q A;  3IWB A;  2B7T A;  1HR0 E;  1QU6 A;  3IWC A;  3HQ1 A;  3DF6 A;  4I8O A;  2NUF A;  4LFB E;  3HXL A;  1IBL E;  2LJH A;  1X47 A;  4NXM E;  2DIX A;  1UIL A;  1N33 E;  2V89 A;  2MDR A;  1N34 E;  3P1X A;  1YYK A;  2HHH E;  1XNQ E;  2UUB E;  2NUG A;  3DJW A;  3F6H A;  4JI2 E;  3OML A;  4X8W A;  3HPZ A;  2ODR D;  3AUZ A;  1J26 A;  2H36 X;  3VYX A;  2UXC E;  2EZ6 A;  4AQY E;  2LE2 A;  3JU0 A;  1PKP A;  4JI0 E;  2FV4 B;  4R03 A;  5AE2 A;  4DUY E;  5LMN E;  2K4V A;  1X48 A;  4R8O A;  2LUQ A;  3J80 C;  3JTZ A;  2ZM6 E;  4X64 E;  2NUE A;  3ADJ A;  4DUZ E;  2UXD E;  2L2N A;  5IWA E;  1T4O A;  4LF8 E;  2L6M A;  3ADI A;  4DV7 E;  4DV0 E;  4BC7 A;  4JI3 E;  3LML A;  2VQF E;  4KHP E;  4J8Z A;  1HNZ E;  2JOX A;  3RMP A;  2L92 A;  2UU9 E;  1FKA E;  2L2M A;  5AE3 A;  2B7V A;  3C4B A;  4LF5 E;  1J5E E;  4M0V A;  2UUC E;  2M1S A;  2RS6 A;  2LRS A;  4JI4 E;  4KZS A;  4LU9 A;  2KOU A;  4LTY A;  1XMO E;  5LMU E;  2ODR C;  4DV3 E;  1SR9 A;  1RQ0 A;  4P78 A;  1DQ3 A;  1WHQ A;  5AE1 A;  4GKK E;  1GQE A;  3F6G A;  5ADZ A;  4LF6 E;  2DB2 A;  4GKJ E;  4DMI A;  4DR5 E;  4WSP A;  4TUG A;  4JYA E;  2UXB E;  2RTX A;  2V83 A;  4OX9 E;  2V87 A;  4BBY A;  3VK6 A;  3FIG A;  4JI1 E;  3H09 A;  3VYY A;  1XMQ E;  1HNX E;  2JOB A;  3C4T A;  1T4L B;  1IBK E;  2L33 A;  3OTO E;  2UUA E;  3ADG A;  2L2K B;  3J7A G;  5T6J A;  4JI6 E;  3KWR A;  1FJG E;  5A2Q C;  2M4I A;  4JI7 E;  4DR3 E;  3AV0 A;  4B3M E;  4DV1 E;  4YHH E;  1GZ6 A;  2RSM A;  4WPY A;  4YY3 E;  3IWD A;  1EKZ A;  2CPN A;  2V88 A;  2F4V E;  2DMY A;  4K0K E;  4LF9 E;  4F54 A;  2LTR A;  2B3T B;  4GEQ B;  2M7Q A;  2E1M A;  1WXR A;  1N36 E;  2L3C A;  2FGG A;  2NA2 A;  4OOG C;  4DR1 E;  4WFT A;  2VQE E;  5BR8 E;  4X66 E;  4LFA E;  1N32 E;  2VE7 C;  1ZBQ A;  4LF7 E;  4DR4 E;  2RS7 A;  3ADL A;  4DV6 E;  4TUI A;  2N3G A;  4Q28 A;  4BMJ A;  2KON A;  5CFF E;  1I94 E;  2JVA A;  1UHZ A;  1IBM E;  1YYW A;  4DKK A;  3JAM C;  4P7D A;  4M2Z A;  4DV5 E;  1YZ9 A;  4B3R E;  2MC6 A;  2G7H A;  4F9B B;  4F9A B;  2IHR 1;  1XNR E;  1DI2 A;  2F8B A;  4BS9 A;  2L3J A;  5IT9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...