2LTSA

Solution structure of rde-4(150-235)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
NDDSIPTSAEFPPGISPTENWVGKLQEKSQKSKLQAPIYEDSKNERTERFLVICTMCNQKTRGIRSKKKDAKNLAAWLMWKALEDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein RDE-4
publication title Structure of RDE-4 dsRBDs and mutational studies provide insights into dsRNA recognition in the Caenorhabditis elegans RNAi pathway.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ltsA00
2JY9A 1UILA 2UUAE 2NA2A 2YT4A 4B3RE 4JI5E 1X49A 4LFBE 4JI1E 4LF8E 2L2KB 4K0KE 2DIXA 2B7VA 1RC7A 2ZM6E 4B3TE 4DV5E 4LF5E 1YYKA 1PKPA 4JI8E 3OTOE 4DUZE 1IBME 4DR4E 4GKKE 4DV1E 4DV3E 4DV7E 2NUGA 2RS7A 1GQEA 4DR6E 2IHR1 2E5LE 1HR0E 2B7TA 1N33E 1ZBTA 4JV5E 2B3TB 2UXCE 1HNZE 1O0WA 4LF9E 2N3GA 4GKJE 4YHHE 1FKAE 2HHHE 1QU6A 2L3CA 2VQEE 3C4BA 4DR2E 4LF6E 3T1YE 1STUA 3LLHA 4X8WA 1T4LB 1XMQE 2L2MA 4DKKA 2UXDE 4OX9E 4X66E 4M30A 4LF4E 2LJHA 2MDRA 2LTRA 4JI3E 2KHXA 4JI6E 4JI2E 5IWAE 1HNWE 4OOGC 1X47A 1I94E 2LUPB 1N34E 2UUCE 1YZ9A 1J5EE 4DR3E 4DV4E 4DR7E 4DUYE 1T4OA 2JVAA 1FJGE 1IBKE 2L33A 4JYAE 2N3HA 1IBLE 4X64E 2DB2A 1T4NA 2LTSA 2RS6A 1EKZA 4NXME 3ADJA 4X62E 3ADIA 2UXBE 2L3JA 3ADLA 2NUEA 2LRSA 1XMOE 4DV6E 4JI0E 3P1XA 4DR5E 4JI7E 1WHQA 1XNQE 2VQFE 3HTXA 1X48A 4DR1E 2UUBE 4KHPE 4WFTA 5CFFE 4B3SE 2L2NA 1J26A 4LF7E 5LMNE 2CPNA 4YY3E 5BR8E 3T1HE 2F4VE 3VYXA 4X65E 1UHZA 2EZ6A 1DI2A 2RSMA 4DV2E 1N36E 3ADGA 1YYWA 4NXNE 2LBSB 4WYQB 2DMYA 4LFCE 1RQ0A 3C4TA 5LMUE 2NUFA 1YYOA 4LFAE 1WHNA 2UU9E 1XNRE 4M2ZA 4DV0E 4AQYE 3VYYA 1N32E 2RTXA 1HNXE 4B3ME 4JI4E 3J7Yp 2LUQA
chains in the Genus database with same CATH superfamily
2MKNA 4P78A 2NA2A 2EOXA 2EOYA 2EQ1A 5KL3A 3EPJA 4LFBE 3QG5C 3MHHC 2EL6A 1A1LA 1IQSA 5KL6A 2M7QA 2L2KB 5DNYA 2YU8A 1RC7A 4DV5E 2EJ4A 2EN2A 1PKPA 2EPUA 2YTNA 2EOIA 4F9BB 5AE3A 4DR4E 2EOQA 4FK5C 5AC5A 4DV1E 4DV3E 2NUGA 2YPNA 2RS7A 2YWQA 2IHR1 3J7AG 4TUGA 1ZBTA 4JV5E 4X9JA 2UXCE 2EMKA 2EPLX 1IMUA 4GKJE 4YHHE 5FLXC 1QU6A 2L3CA 2E1MA 1P47A 4DR2E 3C6MA 4KZSA 2K4VA 4L5NC 2MDGA 4R2CA 4R03A 3IWBA 2F8BA 1ZU1A 2EMHA 2LE2A 4M30A 4M9VC 2V88A 4JI3E 2KHXA 3C6KA 4JI2E 2FV4B 5ADZA 2EOOA 3DF6A 1X47A 5F3WA 2JP9A 2EOZA 2ODRC 5AE2A 2EMLA 2FTXB 4DR3E 4DR7E 4F54A 1T4OA 2CT1A 2EOMA 2EMZA 1IBKE 2L33A 3BGHA 3BF2A 2RS6A 2L3JA 2EPMX 2LRSA 2EMIA 2EMGA 2EN7A 4DV6E 4JI0E 3TQMA 2JR1A 2G7HA 2HGHA 3VK6A 4GZNC 4ZYEA 2UUBE 4MLQA 1UBDC 1UN6B 2V8QB 1JK2A 4LF7E 2EP3A 1NEIA 1DGCA 2DGCA 1X6HA 2EQ3A 1SFEA 4ZYGA 1DI2A 1LLMC 2HC5A 4Q35B 1AH5A 4WXCA 2V87A 4TUIA 3JU0A 2UU9E 4M2ZA 4DV0E 3M99B 2EM3A 2ENHA 1UILA 1A1IA 4WXDA 2ENCA 3DJWA 1B69A 4DMIA 2EM9A 4RH8A 1DQ3A 1X6EA 4BS9A 2B7VA 2H36X 4IS1C 2EPPA 1BBGA 2VRDA 3J81C 4LF5E 1YYKA 4BHCA 2YTIA 4BMJA 2YSPA 3OTOE 1YUJA 2YTQA 2RQLA 2YTDA 2B7TA 2GPIA 2V85A 2WZOA 1MEYC 1ZR9A 2LMZA 2NABA 4LF9E 2DLKA 1FKAE 4NZVA 1MGTA 2EM4A 4BHBA 2DMIA 1X3CA 2RSIA 4ZYDA 4R2DA 1T39A 2B9DA 2EPNA 2EMBA 4X66E 4LF4E 2MDRA 1G2DC 2BB8A 1A1HA 5KL2A 1HNWE 4O24A 4BC7A 3RMPA 2Q8UA 2LV2A 2EPOA 4R8OA 2EN3A 2JWOA 2JXPA 1WRJA 2L92A 5A6KA 4DUYE 1IBLE 4X64E 2YTFA 2L6MA 2EN8A 2M1SA 2LTSA 1EKZA 4I8OA 3ADIA 4X62E 2UXBE 3ADLA 2NUEA 4N4RB 1YPNA 4DR5E 1XNQE 3HPSA 1BBOA 2EOJA 4O5GA 2L2NA 5LMNE 2CPNA 4MLVA 5BR8E 4YY3E 3T1HE 2F4VE 4ZYHA 2DLQA 4X65E 3VYXA 1UHZA 3IWDA 1EH6A 1PJQA 2RSMA 5A6AA 1YYWA 2J7JA 1KJKA 4WYQB 1RQ0A 2EM0A 1RMDA 5LMUE 2NUFA 4LFAE 1WHNA 4HTGA 4AQYE 2VF1A 2RTXA 1QNTA 2MC6A 3F6GA 4R2PA 3J7Yp 3UK3C 2I9IA 2JY9A 5KL4A 4RHBB 2UUAE 1TN9A 5A6BA 2R76A 2YT4A 2EMYA 4BCAA 3THNA 2GLIA 2D9HA 2DIXA 2WBTA 2EOSA 5IV8B 4LU9A 5LL6R 3K6QA 4JI8E 4WSPA 2EL5A 1X5WA 2YRMA 2EM5A 4R2RA 2EOHA 2DRPA 4KWYA 1GQEA 2EMXA 4Q28A 2E5LE 1N33E 2EORA 4IJDA 2ADRA 3JAMC 1O0WA 1JK1A 3HXLA 4R2AA 1IQOA 3THOB 3H09A 2EMAA 2VQEE 3AV0A 2EE8A 2EWLA 3T1YE 3ECRA 1STUA 1T4LB 4DKKA 2UXDE 4GEQB 4O43A 4F2JC 2LTRA 4O4KA 1YFHA 3EPHA 4R2QA 2M4IA 4JI6E 1PJTA 2V89A 1X6FA 5A6BD 2YTEA 2JOBA 2LT7A 4OOGC 3FIGA 1I94E 2KONA 4F9CB 1N34E 2UUCE 1YZ9A 1AAYA 5IXMB 1YSAC 4DV4E 5A69A 1WXRA 2VE7C 2EPAA 2YRKA 4LTYA 4JYAE 2N3HA 2DB2A 4WSGA 1T4NA 2EM2A 2EMWA 4NXME 3AUZA 1XMOE 5AC4A 2R1FA 2ENAA 1X48A 2LO3A 4R2SA 4B3SE 2YRHA 2LJUA 1A1JA 1J26A 5T6JA 5KL5A 1ZAAC 5KL7A 2EM8A 4DV2E 1N36E 3ADGA 2N8XA 2DMYA 4LFCE 2EQ0A 3KZZA 1YYOA 2CSHA 3KZYA 2RPCA 1NCSA 4WX9A 3J80C 1N32E 2EN1A 4F6MA 2I13A 2BBGA 2EM7A 3EPLA 4BC9A 2LUQA 2YTGA 2DSYA 2YU5A 4B3RE 4JI5E 1X49A 2EPZA 2E72A 4JI1E 1SR9A 5A6JA 2EPRA 4LF8E 4K0KE 2ZM6E 2YZTA 2K7IA 1EH8A 1T38A 4B3TE 4L8NA 2YTOA 4DUZE 3JTZA 4F9AB 1IBME 4GKKE 4DV7E 4R2EA 4DR6E 1GZ6A 2ELYA 1HR0E 1N3GA 3EQ1A 2B3TB 2EMFA 2EOFA 4M0VA 2MKDA 2EM6A 2YTJA 1HNZE 3MSWA 2N3GA 3F6HA 2WCC3 4HEIA 2L8TA 5IT9C 1F2IG 2HHHE 2A25A 2EN6A 1WJPA 2CTDA 2EMCA 2EPKX 3C4BA 1TF3A 4LF6E 2HJJA 2V86A 2JPAA 3MHSC 3IWCA 2V83A 5AASA 3LLHA 4X8WA 2YTPA 1ZBQA 2L2MA 1XMQE 4OX9E 2EPCA 1EH7A 2JOXA 2LJHA 3LMLA 2EL4A 3HPZA 4F6NA 4J8ZA 1KYQA 5IWAE 1A1FA 4NHRA 2EN4A 2LUPB 2WBSA 1A1KA 1GTKA 1J5EE 4BBYA 1PJSA 2ODRD 2EOEA 2JVAA 3BIDA 3EPKA 1FJGE 3KWRA 4WPYA 5TSEA 3ADJA 2KOUA 3HQ1A 1L4SA 2LCEA 2WBUA 3VHTB 5A2QC 1YUIA 3P1XA 2EPXA 4JI7E 2M9AA 2MC5A 1WHQA 1TF6A 2VQFE 3HTXA 2FGGA 2GHFA 4DR1E 1PDAA 4KHPE 4WFTA 5CFFE 1BB8A 3ZOQB 5LLQA 2YSOA 2PRTA 2EZ6A 3OMLA 3BBGA 4NXNE 2LBSB 2ELZA 3C4TA 3L00A 1XNRE 2LVHA 1Z1BA 3VYYA 1G2FC 2JYAA 1HNXE 4P7DA 4B3ME 5AE1A 4JI4E 1A1GA
chains in the Genus database with same CATH topology
2JY9A 1UILA 4P78A 2DSYA 2NA2A 2UUAE 2YT4A 4B3RE 4BCAA 4JI5E 1X49A 3DJWA 4LFBE 4JI1E 4DMIA 1SR9A 1DQ3A 2M7QA 4LF8E 2L2KB 4BS9A 4K0KE 5DNYA 2DIXA 2B7VA 2H36X 2ZM6E 2YZTA 1RC7A 4B3TE 4LU9A 4L8NA 4DV5E 3J81C 4LF5E 5LL6R 1YYKA 3K6QA 1PKPA 4JI8E 3JTZA 4BMJA 4F9AB 3OTOE 4DUZE 4WSPA 1IBME 4F9BB 5AE3A 4DR4E 4GKKE 4DV1E 4DV3E 4DV7E 2NUGA 2RS7A 1GQEA 4DR6E 1GZ6A 4Q28A 2IHR1 3J7AG 2E5LE 1HR0E 2B7TA 2V85A 2WZOA 4TUGA 1ZBTA 1N33E 4JV5E 2B3TB 4M0VA 3JAMC 2LMZA 2UXCE 1HNZE 3MSWA 1O0WA 4LF9E 2N3GA 3HXLA 3F6HA 5IT9C 4GKJE 2L8TA 4YHHE 1FKAE 2HHHE 5FLXC 1QU6A 3H09A 2L3CA 2VQEE 2E1MA 3AV0A 3C4BA 4DR2E 4LF6E 2V86A 4KZSA 2EWLA 3IWCA 3T1YE 2V83A 5AASA 1STUA 2K4VA 3LLHA 4X8WA 4L5NC 4R03A 1T4LB 3IWBA 2F8BA 1ZBQA 2B9DA 2L2MA 4DKKA 2LE2A 4GEQB 1XMQE 4OX9E 2UXDE 4X66E 2JOXA 4M30A 4LF4E 2LJHA 2MDRA 2LTRA 2V88A 3HPZA 3LMLA 4JI3E 2KHXA 2M4IA 4J8ZA 4JI6E 2V89A 4JI2E 5IWAE 1HNWE 2FV4B 5ADZA 2JOBA 3DF6A 4BC7A 4OOGC 1X47A 3FIGA 1I94E 2KONA 4F9CB 2LUPB 3RMPA 5F3WA 1N34E 2UUCE 1YZ9A 2ODRC 4R8OA 5AE2A 1J5EE 2FTXB 4DR3E 4BBYA 4DV4E 4DR7E 2JWOA 2L92A 4F54A 4DUYE 2ODRD 1T4OA 1WXRA 2JVAA 2VE7C 1FJGE 1IBKE 2L33A 4LTYA 4JYAE 2N3HA 1IBLE 4X64E 3KWRA 2L6MA 2M1SA 2DB2A 4WPYA 1T4NA 2LTSA 2RS6A 1EKZA 4I8OA 4NXME 3ADJA 4X62E 3ADIA 2UXBE 2L3JA 3ADLA 2KOUA 2NUEA 3HQ1A 2LRSA 3AUZA 1XMOE 4DV6E 5A2QC 4JI0E 3P1XA 4DR5E 4JI7E 2MC5A 2JR1A 1WHQA 2G7HA 1XNQE 2VQFE 3HTXA 2FGGA 3HPSA 3VK6A 1X48A 4DR1E 2UUBE 4KHPE 4WFTA 2V8QB 5CFFE 4B3SE 2L2NA 1J26A 4LF7E 5T6JA 5LMNE 2CPNA 4YY3E 5BR8E 3T1HE 2F4VE 3VYXA 4X65E 3ZOQB 1UHZA 3IWDA 2EZ6A 1DI2A 2RSMA 3OMLA 4DV2E 1N36E 3ADGA 1YYWA 4NXNE 2LBSB 4WYQB 2DMYA 4LFCE 1RQ0A 2V87A 3C4TA 5LMUE 2NUFA 4TUIA 1YYOA 4LFAE 3JU0A 1WHNA 2UU9E 1XNRE 4M2ZA 4DV0E 4AQYE 2VF1A 3VYYA 1N32E 3J80C 2RTXA 1HNXE 4P7DA 4B3ME 2MC6A 5AE1A 4JI4E 3F6GA 3J7Yp 4BC9A 2LUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY9 A;  1UIL A;  2UUA E;  2NA2 A;  2YT4 A;  4B3R E;  4JI5 E;  1X49 A;  4LFB E;  4JI1 E;  4LF8 E;  2L2K B;  4K0K E;  2DIX A;  2B7V A;  1RC7 A;  2ZM6 E;  4B3T E;  4DV5 E;  4LF5 E;  1YYK A;  1PKP A;  4JI8 E;  3OTO E;  4DUZ E;  1IBM E;  4DR4 E;  4GKK E;  4DV1 E;  4DV3 E;  4DV7 E;  2NUG A;  2RS7 A;  1GQE A;  4DR6 E;  2IHR 1;  2E5L E;  1HR0 E;  2B7T A;  1N33 E;  1ZBT A;  4JV5 E;  2B3T B;  2UXC E;  1HNZ E;  1O0W A;  4LF9 E;  2N3G A;  4GKJ E;  4YHH E;  1FKA E;  2HHH E;  1QU6 A;  2L3C A;  2VQE E;  3C4B A;  4DR2 E;  4LF6 E;  3T1Y E;  1STU A;  3LLH A;  4X8W A;  1T4L B;  1XMQ E;  2L2M A;  4DKK A;  2UXD E;  4OX9 E;  4X66 E;  4M30 A;  4LF4 E;  2LJH A;  2MDR A;  2LTR A;  4JI3 E;  2KHX A;  4JI6 E;  4JI2 E;  5IWA E;  1HNW E;  4OOG C;  1X47 A;  1I94 E;  2LUP B;  1N34 E;  2UUC E;  1YZ9 A;  1J5E E;  4DR3 E;  4DV4 E;  4DR7 E;  4DUY E;  1T4O A;  2JVA A;  1FJG E;  1IBK E;  2L33 A;  4JYA E;  2N3H A;  1IBL E;  4X64 E;  2DB2 A;  1T4N A;  2LTS A;  2RS6 A;  1EKZ A;  4NXM E;  3ADJ A;  4X62 E;  3ADI A;  2UXB E;  2L3J A;  3ADL A;  2NUE A;  2LRS A;  1XMO E;  4DV6 E;  4JI0 E;  3P1X A;  4DR5 E;  4JI7 E;  1WHQ A;  1XNQ E;  2VQF E;  3HTX A;  1X48 A;  4DR1 E;  2UUB E;  4KHP E;  4WFT A;  5CFF E;  4B3S E;  2L2N A;  1J26 A;  4LF7 E;  5LMN E;  2CPN A;  4YY3 E;  5BR8 E;  3T1H E;  2F4V E;  3VYX A;  4X65 E;  1UHZ A;  2EZ6 A;  1DI2 A;  2RSM A;  4DV2 E;  1N36 E;  3ADG A;  1YYW A;  4NXN E;  2LBS B;  4WYQ B;  2DMY A;  4LFC E;  1RQ0 A;  3C4T A;  5LMU E;  2NUF A;  1YYO A;  4LFA E;  1WHN A;  2UU9 E;  1XNR E;  4M2Z A;  4DV0 E;  4AQY E;  3VYY A;  1N32 E;  2RTX A;  1HNX E;  4B3M E;  4JI4 E;  3J7Y p;  2LUQ A; 
#chains in the Genus database with same CATH topology
 2MKN A;  4P78 A;  2NA2 A;  2EOX A;  2EOY A;  2EQ1 A;  5KL3 A;  3EPJ A;  4LFB E;  3QG5 C;  3MHH C;  2EL6 A;  1A1L A;  1IQS A;  5KL6 A;  2M7Q A;  2L2K B;  5DNY A;  2YU8 A;  1RC7 A;  4DV5 E;  2EJ4 A;  2EN2 A;  1PKP A;  2EPU A;  2YTN A;  2EOI A;  4F9B B;  5AE3 A;  4DR4 E;  2EOQ A;  4FK5 C;  5AC5 A;  4DV1 E;  4DV3 E;  2NUG A;  2YPN A;  2RS7 A;  2YWQ A;  2IHR 1;  3J7A G;  4TUG A;  1ZBT A;  4JV5 E;  4X9J A;  2UXC E;  2EMK A;  2EPL X;  1IMU A;  4GKJ E;  4YHH E;  5FLX C;  1QU6 A;  2L3C A;  2E1M A;  1P47 A;  4DR2 E;  3C6M A;  4KZS A;  2K4V A;  4L5N C;  2MDG A;  4R2C A;  4R03 A;  3IWB A;  2F8B A;  1ZU1 A;  2EMH A;  2LE2 A;  4M30 A;  4M9V C;  2V88 A;  4JI3 E;  2KHX A;  3C6K A;  4JI2 E;  2FV4 B;  5ADZ A;  2EOO A;  3DF6 A;  1X47 A;  5F3W A;  2JP9 A;  2EOZ A;  2ODR C;  5AE2 A;  2EML A;  2FTX B;  4DR3 E;  4DR7 E;  4F54 A;  1T4O A;  2CT1 A;  2EOM A;  2EMZ A;  1IBK E;  2L33 A;  3BGH A;  3BF2 A;  2RS6 A;  2L3J A;  2EPM X;  2LRS A;  2EMI A;  2EMG A;  2EN7 A;  4DV6 E;  4JI0 E;  3TQM A;  2JR1 A;  2G7H A;  2HGH A;  3VK6 A;  4GZN C;  4ZYE A;  2UUB E;  4MLQ A;  1UBD C;  1UN6 B;  2V8Q B;  1JK2 A;  4LF7 E;  2EP3 A;  1NEI A;  1DGC A;  2DGC A;  1X6H A;  2EQ3 A;  1SFE A;  4ZYG A;  1DI2 A;  1LLM C;  2HC5 A;  4Q35 B;  1AH5 A;  4WXC A;  2V87 A;  4TUI A;  3JU0 A;  2UU9 E;  4M2Z A;  4DV0 E;  3M99 B;  2EM3 A;  2ENH A;  1UIL A;  1A1I A;  4WXD A;  2ENC A;  3DJW A;  1B69 A;  4DMI A;  2EM9 A;  4RH8 A;  1DQ3 A;  1X6E A;  4BS9 A;  2B7V A;  2H36 X;  4IS1 C;  2EPP A;  1BBG A;  2VRD A;  3J81 C;  4LF5 E;  1YYK A;  4BHC A;  2YTI A;  4BMJ A;  2YSP A;  3OTO E;  1YUJ A;  2YTQ A;  2RQL A;  2YTD A;  2B7T A;  2GPI A;  2V85 A;  2WZO A;  1MEY C;  1ZR9 A;  2LMZ A;  2NAB A;  4LF9 E;  2DLK A;  1FKA E;  4NZV A;  1MGT A;  2EM4 A;  4BHB A;  2DMI A;  1X3C A;  2RSI A;  4ZYD A;  4R2D A;  1T39 A;  2B9D A;  2EPN A;  2EMB A;  4X66 E;  4LF4 E;  2MDR A;  1G2D C;  2BB8 A;  1A1H A;  5KL2 A;  1HNW E;  4O24 A;  4BC7 A;  3RMP A;  2Q8U A;  2LV2 A;  2EPO A;  4R8O A;  2EN3 A;  2JWO A;  2JXP A;  1WRJ A;  2L92 A;  5A6K A;  4DUY E;  1IBL E;  4X64 E;  2YTF A;  2L6M A;  2EN8 A;  2M1S A;  2LTS A;  1EKZ A;  4I8O A;  3ADI A;  4X62 E;  2UXB E;  3ADL A;  2NUE A;  4N4R B;  1YPN A;  4DR5 E;  1XNQ E;  3HPS A;  1BBO A;  2EOJ A;  4O5G A;  2L2N A;  5LMN E;  2CPN A;  4MLV A;  5BR8 E;  4YY3 E;  3T1H E;  2F4V E;  4ZYH A;  2DLQ A;  4X65 E;  3VYX A;  1UHZ A;  3IWD A;  1EH6 A;  1PJQ A;  2RSM A;  5A6A A;  1YYW A;  2J7J A;  1KJK A;  4WYQ B;  1RQ0 A;  2EM0 A;  1RMD A;  5LMU E;  2NUF A;  4LFA E;  1WHN A;  4HTG A;  4AQY E;  2VF1 A;  2RTX A;  1QNT A;  2MC6 A;  3F6G A;  4R2P A;  3J7Y p;  3UK3 C;  2I9I A;  2JY9 A;  5KL4 A;  4RHB B;  2UUA E;  1TN9 A;  5A6B A;  2R76 A;  2YT4 A;  2EMY A;  4BCA A;  3THN A;  2GLI A;  2D9H A;  2DIX A;  2WBT A;  2EOS A;  5IV8 B;  4LU9 A;  5LL6 R;  3K6Q A;  4JI8 E;  4WSP A;  2EL5 A;  1X5W A;  2YRM A;  2EM5 A;  4R2R A;  2EOH A;  2DRP A;  4KWY A;  1GQE A;  2EMX A;  4Q28 A;  2E5L E;  1N33 E;  2EOR A;  4IJD A;  2ADR A;  3JAM C;  1O0W A;  1JK1 A;  3HXL A;  4R2A A;  1IQO A;  3THO B;  3H09 A;  2EMA A;  2VQE E;  3AV0 A;  2EE8 A;  2EWL A;  3T1Y E;  3ECR A;  1STU A;  1T4L B;  4DKK A;  2UXD E;  4GEQ B;  4O43 A;  4F2J C;  2LTR A;  4O4K A;  1YFH A;  3EPH A;  4R2Q A;  2M4I A;  4JI6 E;  1PJT A;  2V89 A;  1X6F A;  5A6B D;  2YTE A;  2JOB A;  2LT7 A;  4OOG C;  3FIG A;  1I94 E;  2KON A;  4F9C B;  1N34 E;  2UUC E;  1YZ9 A;  1AAY A;  5IXM B;  1YSA C;  4DV4 E;  5A69 A;  1WXR A;  2VE7 C;  2EPA A;  2YRK A;  4LTY A;  4JYA E;  2N3H A;  2DB2 A;  4WSG A;  1T4N A;  2EM2 A;  2EMW A;  4NXM E;  3AUZ A;  1XMO E;  5AC4 A;  2R1F A;  2ENA A;  1X48 A;  2LO3 A;  4R2S A;  4B3S E;  2YRH A;  2LJU A;  1A1J A;  1J26 A;  5T6J A;  5KL5 A;  1ZAA C;  5KL7 A;  2EM8 A;  4DV2 E;  1N36 E;  3ADG A;  2N8X A;  2DMY A;  4LFC E;  2EQ0 A;  3KZZ A;  1YYO A;  2CSH A;  3KZY A;  2RPC A;  1NCS A;  4WX9 A;  3J80 C;  1N32 E;  2EN1 A;  4F6M A;  2I13 A;  2BBG A;  2EM7 A;  3EPL A;  4BC9 A;  2LUQ A;  2YTG A;  2DSY A;  2YU5 A;  4B3R E;  4JI5 E;  1X49 A;  2EPZ A;  2E72 A;  4JI1 E;  1SR9 A;  5A6J A;  2EPR A;  4LF8 E;  4K0K E;  2ZM6 E;  2YZT A;  2K7I A;  1EH8 A;  1T38 A;  4B3T E;  4L8N A;  2YTO A;  4DUZ E;  3JTZ A;  4F9A B;  1IBM E;  4GKK E;  4DV7 E;  4R2E A;  4DR6 E;  1GZ6 A;  2ELY A;  1HR0 E;  1N3G A;  3EQ1 A;  2B3T B;  2EMF A;  2EOF A;  4M0V A;  2MKD A;  2EM6 A;  2YTJ A;  1HNZ E;  3MSW A;  2N3G A;  3F6H A;  2WCC 3;  4HEI A;  2L8T A;  5IT9 C;  1F2I G;  2HHH E;  2A25 A;  2EN6 A;  1WJP A;  2CTD A;  2EMC A;  2EPK X;  3C4B A;  1TF3 A;  4LF6 E;  2HJJ A;  2V86 A;  2JPA A;  3MHS C;  3IWC A;  2V83 A;  5AAS A;  3LLH A;  4X8W A;  2YTP A;  1ZBQ A;  2L2M A;  1XMQ E;  4OX9 E;  2EPC A;  1EH7 A;  2JOX A;  2LJH A;  3LML A;  2EL4 A;  3HPZ A;  4F6N A;  4J8Z A;  1KYQ A;  5IWA E;  1A1F A;  4NHR A;  2EN4 A;  2LUP B;  2WBS A;  1A1K A;  1GTK A;  1J5E E;  4BBY A;  1PJS A;  2ODR D;  2EOE A;  2JVA A;  3BID A;  3EPK A;  1FJG E;  3KWR A;  4WPY A;  5TSE A;  3ADJ A;  2KOU A;  3HQ1 A;  1L4S A;  2LCE A;  2WBU A;  3VHT B;  5A2Q C;  1YUI A;  3P1X A;  2EPX A;  4JI7 E;  2M9A A;  2MC5 A;  1WHQ A;  1TF6 A;  2VQF E;  3HTX A;  2FGG A;  2GHF A;  4DR1 E;  1PDA A;  4KHP E;  4WFT A;  5CFF E;  1BB8 A;  3ZOQ B;  5LLQ A;  2YSO A;  2PRT A;  2EZ6 A;  3OML A;  3BBG A;  4NXN E;  2LBS B;  2ELZ A;  3C4T A;  3L00 A;  1XNR E;  2LVH A;  1Z1B A;  3VYY A;  1G2F C;  2JYA A;  1HNX E;  4P7D A;  4B3M E;  5AE1 A;  4JI4 E;  1A1G A; 
#chains in the Genus database with same CATH homology
 2JY9 A;  1UIL A;  4P78 A;  2DSY A;  2NA2 A;  2UUA E;  2YT4 A;  4B3R E;  4BCA A;  4JI5 E;  1X49 A;  3DJW A;  4LFB E;  4JI1 E;  4DMI A;  1SR9 A;  1DQ3 A;  2M7Q A;  4LF8 E;  2L2K B;  4BS9 A;  4K0K E;  5DNY A;  2DIX A;  2B7V A;  2H36 X;  2ZM6 E;  2YZT A;  1RC7 A;  4B3T E;  4LU9 A;  4L8N A;  4DV5 E;  3J81 C;  4LF5 E;  5LL6 R;  1YYK A;  3K6Q A;  1PKP A;  4JI8 E;  3JTZ A;  4BMJ A;  4F9A B;  3OTO E;  4DUZ E;  4WSP A;  1IBM E;  4F9B B;  5AE3 A;  4DR4 E;  4GKK E;  4DV1 E;  4DV3 E;  4DV7 E;  2NUG A;  2RS7 A;  1GQE A;  4DR6 E;  1GZ6 A;  4Q28 A;  2IHR 1;  3J7A G;  2E5L E;  1HR0 E;  2B7T A;  2V85 A;  2WZO A;  4TUG A;  1ZBT A;  1N33 E;  4JV5 E;  2B3T B;  4M0V A;  3JAM C;  2LMZ A;  2UXC E;  1HNZ E;  3MSW A;  1O0W A;  4LF9 E;  2N3G A;  3HXL A;  3F6H A;  5IT9 C;  4GKJ E;  2L8T A;  4YHH E;  1FKA E;  2HHH E;  5FLX C;  1QU6 A;  3H09 A;  2L3C A;  2VQE E;  2E1M A;  3AV0 A;  3C4B A;  4DR2 E;  4LF6 E;  2V86 A;  4KZS A;  2EWL A;  3IWC A;  3T1Y E;  2V83 A;  5AAS A;  1STU A;  2K4V A;  3LLH A;  4X8W A;  4L5N C;  4R03 A;  1T4L B;  3IWB A;  2F8B A;  1ZBQ A;  2B9D A;  2L2M A;  4DKK A;  2LE2 A;  4GEQ B;  1XMQ E;  4OX9 E;  2UXD E;  4X66 E;  2JOX A;  4M30 A;  4LF4 E;  2LJH A;  2MDR A;  2LTR A;  2V88 A;  3HPZ A;  3LML A;  4JI3 E;  2KHX A;  2M4I A;  4J8Z A;  4JI6 E;  2V89 A;  4JI2 E;  5IWA E;  1HNW E;  2FV4 B;  5ADZ A;  2JOB A;  3DF6 A;  4BC7 A;  4OOG C;  1X47 A;  3FIG A;  1I94 E;  2KON A;  4F9C B;  2LUP B;  3RMP A;  5F3W A;  1N34 E;  2UUC E;  1YZ9 A;  2ODR C;  4R8O A;  5AE2 A;  1J5E E;  2FTX B;  4DR3 E;  4BBY A;  4DV4 E;  4DR7 E;  2JWO A;  2L92 A;  4F54 A;  4DUY E;  2ODR D;  1T4O A;  1WXR A;  2JVA A;  2VE7 C;  1FJG E;  1IBK E;  2L33 A;  4LTY A;  4JYA E;  2N3H A;  1IBL E;  4X64 E;  3KWR A;  2L6M A;  2M1S A;  2DB2 A;  4WPY A;  1T4N A;  2LTS A;  2RS6 A;  1EKZ A;  4I8O A;  4NXM E;  3ADJ A;  4X62 E;  3ADI A;  2UXB E;  2L3J A;  3ADL A;  2KOU A;  2NUE A;  3HQ1 A;  2LRS A;  3AUZ A;  1XMO E;  4DV6 E;  5A2Q C;  4JI0 E;  3P1X A;  4DR5 E;  4JI7 E;  2MC5 A;  2JR1 A;  1WHQ A;  2G7H A;  1XNQ E;  2VQF E;  3HTX A;  2FGG A;  3HPS A;  3VK6 A;  1X48 A;  4DR1 E;  2UUB E;  4KHP E;  4WFT A;  2V8Q B;  5CFF E;  4B3S E;  2L2N A;  1J26 A;  4LF7 E;  5T6J A;  5LMN E;  2CPN A;  4YY3 E;  5BR8 E;  3T1H E;  2F4V E;  3VYX A;  4X65 E;  3ZOQ B;  1UHZ A;  3IWD A;  2EZ6 A;  1DI2 A;  2RSM A;  3OML A;  4DV2 E;  1N36 E;  3ADG A;  1YYW A;  4NXN E;  2LBS B;  4WYQ B;  2DMY A;  4LFC E;  1RQ0 A;  2V87 A;  3C4T A;  5LMU E;  2NUF A;  4TUI A;  1YYO A;  4LFA E;  3JU0 A;  1WHN A;  2UU9 E;  1XNR E;  4M2Z A;  4DV0 E;  4AQY E;  2VF1 A;  3VYY A;  1N32 E;  3J80 C;  2RTX A;  1HNX E;  4P7D A;  4B3M E;  2MC6 A;  5AE1 A;  4JI4 E;  3F6G A;  3J7Y p;  4BC9 A;  2LUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...