2LTSA

Solution structure of rde-4(150-235)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
NDDSIPTSAEFPPGISPTENWVGKLQEKSQKSKLQAPIYEDSKNERTERFLVICTMCNQKTRGIRSKKKDAKNLAAWLMWKALEDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Protein RDE-4
publication title Structure of RDE-4 dsRBDs and mutational studies provide insights into dsRNA recognition in the Caenorhabditis elegans RNAi pathway.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ltsA00
2HHHE 2LUQA 1IBLE 4DV0E 2JY9A 2DMYA 1IBKE 4LF5E 2LBSB 2UXBE 2NUFA 4DV1E 1IBME 2UU9E 5LMNE 3VYYA 3OTOE 4LFCE 1HNXE 1UHZA 1HNZE 1YYOA 4B3TE 2LJHA 2UXCE 4X66E 1N34E 1FJGE 2YT4A 4DR5E 1YZ9A 4X62E 3ADIA 4B3SE 2MDRA 4X65E 4DR4E 1WHQA 4DV7E 4JI6E 4DV5E 1T4NA 2UUBE 2F4VE 2LTSA 5IWAE 4LF4E 3HTXA 2KHXA 1PKPA 2B7TA 3LLHA 1GQEA 3T1YE 1XMOE 4LF9E 4DV2E 1X48A 2NA2A 4JI4E 4OOGC 4LF8E 1DI2A 4DV4E 4JYAE 4WYQB 4DUZE 2RTXA 1RQ0A 2CPNA 3ADGA 1X47A 4KHPE 4JV5E 4GKKE 2L33A 1HNWE 4DV6E 4DV3E 2UXDE 3J7Yp 2L3JA 1XNRE 1X49A 4WFTA 2N3GA 1I94E 2E5LE 2ZM6E 2B7VA 4DUYE 4GKJE 4YHHE 2B3TB 2JVAA 4JI8E 2RS6A 4LFAE 4M2ZA 4X64E 4DR1E 1T4LB 1N36E 4NXNE 2IHR1 4JI7E 1YYKA 3VYXA 2L2KB 2DB2A 4DR6E 4JI5E 1J26A 4B3ME 1EKZA 4OX9E 4JI2E 2UUAE 2VQEE 5CFFE 3T1HE 2UUCE 3ADLA 1QU6A 2DIXA 2NUGA 5LMUE 4X8WA 4NXME 3C4BA 1FKAE 1J5EE 1T4OA 1WHNA 1XNQE 2NUEA 2RS7A 2VQFE 4DR3E 3P1XA 2N3HA 2LTRA 5BR8E 4LF6E 1N33E 1N32E 1YYWA 4B3RE 1XMQE 4LFBE 2L3CA 2L2MA 4DKKA 2LUPB 1O0WA 4JI0E 1UILA 3ADJA 4DR7E 2L2NA 4JI3E 4AQYE 1STUA 1ZBTA 2RSMA 4LF7E 4JI1E 4M30A 4YY3E 3C4TA 4K0KE 1RC7A 1HR0E 2LRSA 2EZ6A 4DR2E
chains in the Genus database with same CATH superfamily
1GTKA 2JXPA 1A1FA 2ADRA 2DMYA 1IBKE 4LF5E 1IBME 4I8OA 3HXLA 4LFCE 3ZOQB 1UHZA 1NEIA 2EMXA 3TQMA 2EM7A 4WXDA 1N34E 2D9HA 2F8BA 2KOUA 5A6JA 4R2AA 1YZ9A 4B3SE 2EPXA 1WHQA 2H36X 3IWBA 1T38A 1PJQA 3EPLA 2UUBE 2F4VE 5IWAE 1PJTA 1YUIA 2WBSA 4P7DA 1WXRA 1PKPA 2B7TA 4F9BB 4M9VC 2DLKA 3THNA 2ELYA 2MKDA 2YTFA 2EMIA 4M0VA 2ODRD 2M9AA 4DV4E 2CT1A 1YSAC 4WYQB 2RTXA 1BB8A 4KHPE 2ENHA 2MC6A 4GKKE 1YPNA 4KZSA 2L33A 3C6KA 4F2JC 2M7QA 4DV3E 3J7Yp 2L3JA 1XNRE 2N3GA 2B7VA 2EORA 4BC9A 2EMKA 3EPKA 1TF3A 4F54A 4R2QA 4DR1E 2J7JA 1T4LB 4NXNE 2EM0A 2EOIA 5KL6A 2YTQA 2JR1A 2LJUA 2JWOA 2DB2A 3MHSC 1A1JA 1KJKA 1KYQA 2EPMX 2EQ3A 3H09A 2MKNA 4OX9E 5KL7A 2V85A 3T1HE 1A1KA 4GEQB 3J81C 3VHTB 3C4BA 2V89A 3QG5C 1YUJA 1WHNA 4IJDA 5TSEA 5AE2A 2RS7A 3P1XA 4R2PA 1T39A 2EPCA 1MGTA 2YSPA 2EP3A 2EMGA 4ZYGA 1UILA 3J80C 3KZYA 4DMIA 2WBTA 2EWLA 4MLQA 4AQYE 4JI3E 3F6HA 3EQ1A 4YY3E 3C4TA 4K0KE 1RC7A 2EMLA 1SR9A 2VF1A 4DR2E 1UN6B 2HHHE 2LUQA 2EOJA 2EPAA 3ECRA 2CSHA 2EOSA 4DV0E 1QNTA 4R2EA 4WX9A 5LMNE 2EN6A 2DGCA 1HNZE 3EPHA 2HGHA 2EPUA 4O4KA 2UXCE 3KZZA 4X66E 3HPSA 2DLQA 5AASA 4TUGA 2PRTA 2GPIA 4X65E 2EPNA 3JAMC 5FLXC 1A1LA 2B9DA 4BCAA 4O24A 2EM5A 4LF4E 3LMLA 1XMOE 2EOFA 4WSPA 5A6AA 4JI4E 2EOXA 1X5WA 4LF8E 4JYAE 3FIGA 2MDGA 1RQ0A 2RQLA 5AC5A 4JV5E 2EE8A 2VRDA 4WPYA 1Z1BA 3IWCA 2EPOA 1ZU1A 4WFTA 1I94E 2JP9A 2JOBA 2YTOA 2EM4A 4DUYE 4GKJE 2JVAA 5AC4A 3MHHC 2RS6A 4LFAE 1EH6A 2LMZA 2Q8UA 5KL2A 4JI7E 2YU5A 2JOXA 3AUZA 1GZ6A 2EMZA 2EPKX 2YTEA 1BBOA 5IXMB 1WRJA 4B3ME 1N3GA 3HPZA 3VK6A 2JYAA 2UUCE 3ADLA 1UBDC 2EM9A 2EPRA 4MLVA 2V8QB 4X8WA 4N4RB 1X6FA 1J5EE 2NUEA 4R8OA 4DR3E 1L4SA 1PDAA 2HC5A 1N32E 4B3RE 4LFBE 5ADZA 2EN1A 3EPJA 4R2SA 2EL5A 2V87A 2EN8A 4L5NC 2L2NA 2RSIA 2YTPA 1X3CA 3MSWA 1STUA 1PJSA 4LF7E 5A69A 4P78A 4O5GA 4R2DA 4BHBA 2EM8A 2EPLX 2EOMA 2YSOA 2EMWA 2LRSA 2EZ6A 5KL5A 4F6NA 4KWYA 1IBLE 5A6BA 5A6BD 2LBSB 2UXBE 5KL3A 1LLMC 2UU9E 2EMHA 1IQOA 1HNXE 2V86A 2WZOA 4B3TE 2LJHA 1JK2A 1FJGE 1AH5A 4DR5E 5IT9C 3OMLA 2MDRA 5LLQA 4DR4E 2EOHA 2E72A 4GZNC 4JI6E 1A1IA 1T4NA 3BGHA 2EMYA 3AV0A 1ZBQA 2YRMA 2LTSA 3M99B 5LL6R 4F9CB 2KHXA 3LLHA 4LF9E 1X48A 3K6QA 2NA2A 1DI2A 4DUZE 2M1SA 1A1GA 2EN3A 2MC5A 1IMUA 2FTXB 1IQSA 3JTZA 2R1FA 4L8NA 4DV6E 2UXDE 4Q28A 2EPZA 1NCSA 2ZM6E 4F6MA 2GHFA 2EOEA 2LO3A 2NABA 5IV8B 2YRKA 4M2ZA 4X64E 1B69A 2L6MA 2YTJA 4R2CA 3BF2A 2LE2A 1N36E 2BBGA 2YTDA 4BS9A 2L2KB 2LCEA 2EM6A 3HQ1A 4RH8A 2RPCA 1X6EA 2EM2A 4DR6E 1G2DC 2EMAA 4JI5E 3F6GA 1J26A 2V88A 1DGCA 2WCC3 2UUAE 2VQEE 2YU8A 1QU6A 4HTGA 1EH8A 2DIXA 2NUGA 2ELZA 2YTGA 5LMUE 1X6HA 1FKAE 1ZR9A 1XNQE 2YPNA 3DF6A 2VQFE 2LTRA 5BR8E 4ZYEA 4LF6E 1N33E 1TN9A 1YYWA 1XMQE 2E1MA 2L3CA 4JI0E 4LTYA 2G7HA 4WXCA 4DR7E 2FGGA 2V83A 4BHCA 4Q35B 1BBGA 4M30A 4ZYDA 3RMPA 1F2IG 2VE7C 1HR0E 1A1HA 2EJ4A 2EQ0A 4R2RA 2EM3A 2EL6A 2I9IA 4FK5C 2EPPA 2EQ1A 4F9AB 2EN7A 3DJWA 2LT7A 4TUIA 2JY9A 2NUFA 4NZVA 4DV1E 4J8ZA 3J7AG 2DSYA 3VYYA 1WJPA 4LU9A 3OTOE 2JPAA 2EMCA 1YYOA 1DQ3A 2YWQA 5T6JA 2EN4A 1TF6A 3THOB 2YT4A 4BBYA 3ADIA 4X62E 1MEYC 2K4VA 1EH7A 4DV7E 2ENAA 4DV5E 2EN2A 2LVHA 2EOQA 3HTXA 1JK1A 2GLIA 1GQEA 3T1YE 2YTIA 4DV2E 2EMFA 4OOGC 2EL4A 2EOZA 2HJJA 2CTDA 2KONA 1G2FC 2CPNA 3BBGA 3ADGA 1X47A 4BMJA 4X9JA 2DRPA 2ENCA 4NHRA 1HNWE 1RMDA 2EOYA 1X49A 2YTNA 2E5LE 1SFEA 3UK3C 2WBUA 3BIDA 2A25A 4O43A 4RHBB 4YHHE 2B3TB 2ODRC 4ZYHA 4JI8E 4IS1C 2FV4B 4BC7A 2IHR1 1YYKA 3VYXA 5DNYA 2R76A 5A6KA 2L8TA 3KWRA 1YFHA 1EKZA 4JI2E 2BB8A 5CFFE 3C6MA 3IWDA 2M4IA 4NXME 2EOOA 1T4OA 1P47A 2YZTA 5F3WA 5A2QC 2N3HA 2K7IA 4WSGA 5KL4A 2N8XA 1ZAAC 1AAYA 2L2MA 3L00A 3JU0A 4DKKA 2LUPB 1O0WA 2LV2A 2L92A 3ADJA 5AE1A 1ZBTA 2RSMA 4JI1E 2EMBA 4R03A 2I13A 2DMIA 2YRHA 4HEIA 5AE3A
chains in the Genus database with same CATH topology
2HHHE 2LUQA 4F9AB 3DJWA 1IBLE 4TUIA 2JY9A 2DMYA 4DV0E 1IBKE 2LBSB 4LF5E 2NUFA 2UXBE 4DV1E 1IBME 4J8ZA 2UU9E 3J7AG 2DSYA 3HXLA 4I8OA 5LMNE 4LU9A 3OTOE 3ZOQB 3VYYA 1UHZA 1HNXE 1HNZE 4LFCE 2V86A 2WZOA 1YYOA 4B3TE 2LJHA 2UXCE 1DQ3A 4X66E 1N34E 3HPSA 5AASA 2F8BA 2KOUA 5T6JA 4TUGA 1FJGE 2YT4A 5IT9C 4DR5E 3OMLA 4BBYA 1YZ9A 4X62E 3ADIA 4B3SE 2MDRA 4X65E 4DR4E 1WHQA 2K4VA 2H36X 3IWBA 3JAMC 5FLXC 4DV7E 4DV5E 4JI6E 2B9DA 1T4NA 4BCAA 3AV0A 2UUBE 1ZBQA 2F4VE 2LTSA 5IWAE 4LF4E 5LL6R 4F9CB 3LMLA 3HTXA 4P7DA 1WXRA 2KHXA 1PKPA 2B7TA 3LLHA 1GQEA 4F9BB 3T1YE 1XMOE 4WSPA 4DV2E 4LF9E 1X48A 3K6QA 2NA2A 4M0VA 4OOGC 4JI4E 2ODRD 4LF8E 1DI2A 4DV4E 3FIGA 4JYAE 4WYQB 2M1SA 2RTXA 2KONA 1RQ0A 2CPNA 3ADGA 2MC5A 1X47A 4BMJA 4KHPE 2FTXB 4JV5E 2MC6A 4GKKE 4KZSA 2L33A 3JTZA 4WPYA 3IWCA 1HNWE 4L8NA 4DV6E 2M7QA 4DV3E 2UXDE 3J7Yp 2L3JA 1XNRE 4Q28A 1X49A 4WFTA 2N3GA 1I94E 2JOBA 2E5LE 2ZM6E 2B7VA 4DUYE 4GKJE 4YHHE 2B3TB 2ODRC 2JVAA 4JI8E 4BC9A 2RS6A 4LFAE 4M2ZA 2FV4B 2LMZA 4X64E 4F54A 4DR1E 2L6MA 1T4LB 1N36E 4BC7A 2IHR1 2LE2A 4NXNE 4JI7E 2JR1A 1YYKA 3VYXA 2JOXA 2JWOA 4BS9A 4DUZE 3AUZA 2L2KB 1GZ6A 2DB2A 3HQ1A 5DNYA 2L8TA 3KWRA 4DR6E 3H09A 4JI5E 3F6GA 1J26A 4B3ME 2V88A 3HPZA 1EKZA 4JI2E 3VK6A 4OX9E 2V85A 2UUAE 2VQEE 5CFFE 3T1HE 2UUCE 3ADLA 1QU6A 3IWDA 4GEQB 2M4IA 2DIXA 2NUGA 5LMUE 2V8QB 4X8WA 3J81C 3C4BA 2V89A 4NXME 1FKAE 1J5EE 1T4OA 1WHNA 1XNQE 3DF6A 5AE2A 2NUEA 2RS7A 2VQFE 4R8OA 4DR3E 3P1XA 2YZTA 5F3WA 5A2QC 2N3HA 2LTRA 5BR8E 4LF6E 1N33E 1N32E 1YYWA 4B3RE 1XMQE 4LFBE 5ADZA 2E1MA 2L3CA 2L2MA 4DKKA 3JU0A 2LUPB 2V87A 1O0WA 4JI0E 1UILA 2G7HA 4LTYA 2L92A 3ADJA 3J80C 4L5NC 2L2NA 4DMIA 5AE1A 2FGGA 2V83A 3MSWA 4JI3E 2EWLA 4DR7E 4AQYE 1STUA 1ZBTA 2RSMA 3F6HA 4LF7E 4P78A 4JI1E 4M30A 4YY3E 3C4TA 4R03A 3RMPA 4K0KE 2VE7C 1RC7A 1HR0E 1SR9A 5AE3A 2LRSA 2EZ6A 2VF1A 4DR2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH E;  2LUQ A;  1IBL E;  4DV0 E;  2JY9 A;  2DMY A;  1IBK E;  4LF5 E;  2LBS B;  2UXB E;  2NUF A;  4DV1 E;  1IBM E;  2UU9 E;  5LMN E;  3VYY A;  3OTO E;  4LFC E;  1HNX E;  1UHZ A;  1HNZ E;  1YYO A;  4B3T E;  2LJH A;  2UXC E;  4X66 E;  1N34 E;  1FJG E;  2YT4 A;  4DR5 E;  1YZ9 A;  4X62 E;  3ADI A;  4B3S E;  2MDR A;  4X65 E;  4DR4 E;  1WHQ A;  4DV7 E;  4JI6 E;  4DV5 E;  1T4N A;  2UUB E;  2F4V E;  2LTS A;  5IWA E;  4LF4 E;  3HTX A;  2KHX A;  1PKP A;  2B7T A;  3LLH A;  1GQE A;  3T1Y E;  1XMO E;  4LF9 E;  4DV2 E;  1X48 A;  2NA2 A;  4JI4 E;  4OOG C;  4LF8 E;  1DI2 A;  4DV4 E;  4JYA E;  4WYQ B;  4DUZ E;  2RTX A;  1RQ0 A;  2CPN A;  3ADG A;  1X47 A;  4KHP E;  4JV5 E;  4GKK E;  2L33 A;  1HNW E;  4DV6 E;  4DV3 E;  2UXD E;  3J7Y p;  2L3J A;  1XNR E;  1X49 A;  4WFT A;  2N3G A;  1I94 E;  2E5L E;  2ZM6 E;  2B7V A;  4DUY E;  4GKJ E;  4YHH E;  2B3T B;  2JVA A;  4JI8 E;  2RS6 A;  4LFA E;  4M2Z A;  4X64 E;  4DR1 E;  1T4L B;  1N36 E;  4NXN E;  2IHR 1;  4JI7 E;  1YYK A;  3VYX A;  2L2K B;  2DB2 A;  4DR6 E;  4JI5 E;  1J26 A;  4B3M E;  1EKZ A;  4OX9 E;  4JI2 E;  2UUA E;  2VQE E;  5CFF E;  3T1H E;  2UUC E;  3ADL A;  1QU6 A;  2DIX A;  2NUG A;  5LMU E;  4X8W A;  4NXM E;  3C4B A;  1FKA E;  1J5E E;  1T4O A;  1WHN A;  1XNQ E;  2NUE A;  2RS7 A;  2VQF E;  4DR3 E;  3P1X A;  2N3H A;  2LTR A;  5BR8 E;  4LF6 E;  1N33 E;  1N32 E;  1YYW A;  4B3R E;  1XMQ E;  4LFB E;  2L3C A;  2L2M A;  4DKK A;  2LUP B;  1O0W A;  4JI0 E;  1UIL A;  3ADJ A;  4DR7 E;  2L2N A;  4JI3 E;  4AQY E;  1STU A;  1ZBT A;  2RSM A;  4LF7 E;  4JI1 E;  4M30 A;  4YY3 E;  3C4T A;  4K0K E;  1RC7 A;  1HR0 E;  2LRS A;  2EZ6 A;  4DR2 E; 
#chains in the Genus database with same CATH topology
 1GTK A;  2JXP A;  1A1F A;  2ADR A;  2DMY A;  1IBK E;  4LF5 E;  1IBM E;  4I8O A;  3HXL A;  4LFC E;  3ZOQ B;  1UHZ A;  1NEI A;  2EMX A;  3TQM A;  2EM7 A;  4WXD A;  1N34 E;  2D9H A;  2F8B A;  2KOU A;  5A6J A;  4R2A A;  1YZ9 A;  4B3S E;  2EPX A;  1WHQ A;  2H36 X;  3IWB A;  1T38 A;  1PJQ A;  3EPL A;  2UUB E;  2F4V E;  5IWA E;  1PJT A;  1YUI A;  2WBS A;  4P7D A;  1WXR A;  1PKP A;  2B7T A;  4F9B B;  4M9V C;  2DLK A;  3THN A;  2ELY A;  2MKD A;  2YTF A;  2EMI A;  4M0V A;  2ODR D;  2M9A A;  4DV4 E;  2CT1 A;  1YSA C;  4WYQ B;  2RTX A;  1BB8 A;  4KHP E;  2ENH A;  2MC6 A;  4GKK E;  1YPN A;  4KZS A;  2L33 A;  3C6K A;  4F2J C;  2M7Q A;  4DV3 E;  3J7Y p;  2L3J A;  1XNR E;  2N3G A;  2B7V A;  2EOR A;  4BC9 A;  2EMK A;  3EPK A;  1TF3 A;  4F54 A;  4R2Q A;  4DR1 E;  2J7J A;  1T4L B;  4NXN E;  2EM0 A;  2EOI A;  5KL6 A;  2YTQ A;  2JR1 A;  2LJU A;  2JWO A;  2DB2 A;  3MHS C;  1A1J A;  1KJK A;  1KYQ A;  2EPM X;  2EQ3 A;  3H09 A;  2MKN A;  4OX9 E;  5KL7 A;  2V85 A;  3T1H E;  1A1K A;  4GEQ B;  3J81 C;  3VHT B;  3C4B A;  2V89 A;  3QG5 C;  1YUJ A;  1WHN A;  4IJD A;  5TSE A;  5AE2 A;  2RS7 A;  3P1X A;  4R2P A;  1T39 A;  2EPC A;  1MGT A;  2YSP A;  2EP3 A;  2EMG A;  4ZYG A;  1UIL A;  3J80 C;  3KZY A;  4DMI A;  2WBT A;  2EWL A;  4MLQ A;  4AQY E;  4JI3 E;  3F6H A;  3EQ1 A;  4YY3 E;  3C4T A;  4K0K E;  1RC7 A;  2EML A;  1SR9 A;  2VF1 A;  4DR2 E;  1UN6 B;  2HHH E;  2LUQ A;  2EOJ A;  2EPA A;  3ECR A;  2CSH A;  2EOS A;  4DV0 E;  1QNT A;  4R2E A;  4WX9 A;  5LMN E;  2EN6 A;  2DGC A;  1HNZ E;  3EPH A;  2HGH A;  2EPU A;  4O4K A;  2UXC E;  3KZZ A;  4X66 E;  3HPS A;  2DLQ A;  5AAS A;  4TUG A;  2PRT A;  2GPI A;  4X65 E;  2EPN A;  3JAM C;  5FLX C;  1A1L A;  2B9D A;  4BCA A;  4O24 A;  2EM5 A;  4LF4 E;  3LML A;  1XMO E;  2EOF A;  4WSP A;  5A6A A;  4JI4 E;  2EOX A;  1X5W A;  4LF8 E;  4JYA E;  3FIG A;  2MDG A;  1RQ0 A;  2RQL A;  5AC5 A;  4JV5 E;  2EE8 A;  2VRD A;  4WPY A;  1Z1B A;  3IWC A;  2EPO A;  1ZU1 A;  4WFT A;  1I94 E;  2JP9 A;  2JOB A;  2YTO A;  2EM4 A;  4DUY E;  4GKJ E;  2JVA A;  5AC4 A;  3MHH C;  2RS6 A;  4LFA E;  1EH6 A;  2LMZ A;  2Q8U A;  5KL2 A;  4JI7 E;  2YU5 A;  2JOX A;  3AUZ A;  1GZ6 A;  2EMZ A;  2EPK X;  2YTE A;  1BBO A;  5IXM B;  1WRJ A;  4B3M E;  1N3G A;  3HPZ A;  3VK6 A;  2JYA A;  2UUC E;  3ADL A;  1UBD C;  2EM9 A;  2EPR A;  4MLV A;  2V8Q B;  4X8W A;  4N4R B;  1X6F A;  1J5E E;  2NUE A;  4R8O A;  4DR3 E;  1L4S A;  1PDA A;  2HC5 A;  1N32 E;  4B3R E;  4LFB E;  5ADZ A;  2EN1 A;  3EPJ A;  4R2S A;  2EL5 A;  2V87 A;  2EN8 A;  4L5N C;  2L2N A;  2RSI A;  2YTP A;  1X3C A;  3MSW A;  1STU A;  1PJS A;  4LF7 E;  5A69 A;  4P78 A;  4O5G A;  4R2D A;  4BHB A;  2EM8 A;  2EPL X;  2EOM A;  2YSO A;  2EMW A;  2LRS A;  2EZ6 A;  5KL5 A;  4F6N A;  4KWY A;  1IBL E;  5A6B A;  5A6B D;  2LBS B;  2UXB E;  5KL3 A;  1LLM C;  2UU9 E;  2EMH A;  1IQO A;  1HNX E;  2V86 A;  2WZO A;  4B3T E;  2LJH A;  1JK2 A;  1FJG E;  1AH5 A;  4DR5 E;  5IT9 C;  3OML A;  2MDR A;  5LLQ A;  4DR4 E;  2EOH A;  2E72 A;  4GZN C;  4JI6 E;  1A1I A;  1T4N A;  3BGH A;  2EMY A;  3AV0 A;  1ZBQ A;  2YRM A;  2LTS A;  3M99 B;  5LL6 R;  4F9C B;  2KHX A;  3LLH A;  4LF9 E;  1X48 A;  3K6Q A;  2NA2 A;  1DI2 A;  4DUZ E;  2M1S A;  1A1G A;  2EN3 A;  2MC5 A;  1IMU A;  2FTX B;  1IQS A;  3JTZ A;  2R1F A;  4L8N A;  4DV6 E;  2UXD E;  4Q28 A;  2EPZ A;  1NCS A;  2ZM6 E;  4F6M A;  2GHF A;  2EOE A;  2LO3 A;  2NAB A;  5IV8 B;  2YRK A;  4M2Z A;  4X64 E;  1B69 A;  2L6M A;  2YTJ A;  4R2C A;  3BF2 A;  2LE2 A;  1N36 E;  2BBG A;  2YTD A;  4BS9 A;  2L2K B;  2LCE A;  2EM6 A;  3HQ1 A;  4RH8 A;  2RPC A;  1X6E A;  2EM2 A;  4DR6 E;  1G2D C;  2EMA A;  4JI5 E;  3F6G A;  1J26 A;  2V88 A;  1DGC A;  2WCC 3;  2UUA E;  2VQE E;  2YU8 A;  1QU6 A;  4HTG A;  1EH8 A;  2DIX A;  2NUG A;  2ELZ A;  2YTG A;  5LMU E;  1X6H A;  1FKA E;  1ZR9 A;  1XNQ E;  2YPN A;  3DF6 A;  2VQF E;  2LTR A;  5BR8 E;  4ZYE A;  4LF6 E;  1N33 E;  1TN9 A;  1YYW A;  1XMQ E;  2E1M A;  2L3C A;  4JI0 E;  4LTY A;  2G7H A;  4WXC A;  4DR7 E;  2FGG A;  2V83 A;  4BHC A;  4Q35 B;  1BBG A;  4M30 A;  4ZYD A;  3RMP A;  1F2I G;  2VE7 C;  1HR0 E;  1A1H A;  2EJ4 A;  2EQ0 A;  4R2R A;  2EM3 A;  2EL6 A;  2I9I A;  4FK5 C;  2EPP A;  2EQ1 A;  4F9A B;  2EN7 A;  3DJW A;  2LT7 A;  4TUI A;  2JY9 A;  2NUF A;  4NZV A;  4DV1 E;  4J8Z A;  3J7A G;  2DSY A;  3VYY A;  1WJP A;  4LU9 A;  3OTO E;  2JPA A;  2EMC A;  1YYO A;  1DQ3 A;  2YWQ A;  5T6J A;  2EN4 A;  1TF6 A;  3THO B;  2YT4 A;  4BBY A;  3ADI A;  4X62 E;  1MEY C;  2K4V A;  1EH7 A;  4DV7 E;  2ENA A;  4DV5 E;  2EN2 A;  2LVH A;  2EOQ A;  3HTX A;  1JK1 A;  2GLI A;  1GQE A;  3T1Y E;  2YTI A;  4DV2 E;  2EMF A;  4OOG C;  2EL4 A;  2EOZ A;  2HJJ A;  2CTD A;  2KON A;  1G2F C;  2CPN A;  3BBG A;  3ADG A;  1X47 A;  4BMJ A;  4X9J A;  2DRP A;  2ENC A;  4NHR A;  1HNW E;  1RMD A;  2EOY A;  1X49 A;  2YTN A;  2E5L E;  1SFE A;  3UK3 C;  2WBU A;  3BID A;  2A25 A;  4O43 A;  4RHB B;  4YHH E;  2B3T B;  2ODR C;  4ZYH A;  4JI8 E;  4IS1 C;  2FV4 B;  4BC7 A;  2IHR 1;  1YYK A;  3VYX A;  5DNY A;  2R76 A;  5A6K A;  2L8T A;  3KWR A;  1YFH A;  1EKZ A;  4JI2 E;  2BB8 A;  5CFF E;  3C6M A;  3IWD A;  2M4I A;  4NXM E;  2EOO A;  1T4O A;  1P47 A;  2YZT A;  5F3W A;  5A2Q C;  2N3H A;  2K7I A;  4WSG A;  5KL4 A;  2N8X A;  1ZAA C;  1AAY A;  2L2M A;  3L00 A;  3JU0 A;  4DKK A;  2LUP B;  1O0W A;  2LV2 A;  2L92 A;  3ADJ A;  5AE1 A;  1ZBT A;  2RSM A;  4JI1 E;  2EMB A;  4R03 A;  2I13 A;  2DMI A;  2YRH A;  4HEI A;  5AE3 A; 
#chains in the Genus database with same CATH homology
 2HHH E;  2LUQ A;  4F9A B;  3DJW A;  1IBL E;  4TUI A;  2JY9 A;  2DMY A;  4DV0 E;  1IBK E;  2LBS B;  4LF5 E;  2NUF A;  2UXB E;  4DV1 E;  1IBM E;  4J8Z A;  2UU9 E;  3J7A G;  2DSY A;  3HXL A;  4I8O A;  5LMN E;  4LU9 A;  3OTO E;  3ZOQ B;  3VYY A;  1UHZ A;  1HNX E;  1HNZ E;  4LFC E;  2V86 A;  2WZO A;  1YYO A;  4B3T E;  2LJH A;  2UXC E;  1DQ3 A;  4X66 E;  1N34 E;  3HPS A;  5AAS A;  2F8B A;  2KOU A;  5T6J A;  4TUG A;  1FJG E;  2YT4 A;  5IT9 C;  4DR5 E;  3OML A;  4BBY A;  1YZ9 A;  4X62 E;  3ADI A;  4B3S E;  2MDR A;  4X65 E;  4DR4 E;  1WHQ A;  2K4V A;  2H36 X;  3IWB A;  3JAM C;  5FLX C;  4DV7 E;  4DV5 E;  4JI6 E;  2B9D A;  1T4N A;  4BCA A;  3AV0 A;  2UUB E;  1ZBQ A;  2F4V E;  2LTS A;  5IWA E;  4LF4 E;  5LL6 R;  4F9C B;  3LML A;  3HTX A;  4P7D A;  1WXR A;  2KHX A;  1PKP A;  2B7T A;  3LLH A;  1GQE A;  4F9B B;  3T1Y E;  1XMO E;  4WSP A;  4DV2 E;  4LF9 E;  1X48 A;  3K6Q A;  2NA2 A;  4M0V A;  4OOG C;  4JI4 E;  2ODR D;  4LF8 E;  1DI2 A;  4DV4 E;  3FIG A;  4JYA E;  4WYQ B;  2M1S A;  2RTX A;  2KON A;  1RQ0 A;  2CPN A;  3ADG A;  2MC5 A;  1X47 A;  4BMJ A;  4KHP E;  2FTX B;  4JV5 E;  2MC6 A;  4GKK E;  4KZS A;  2L33 A;  3JTZ A;  4WPY A;  3IWC A;  1HNW E;  4L8N A;  4DV6 E;  2M7Q A;  4DV3 E;  2UXD E;  3J7Y p;  2L3J A;  1XNR E;  4Q28 A;  1X49 A;  4WFT A;  2N3G A;  1I94 E;  2JOB A;  2E5L E;  2ZM6 E;  2B7V A;  4DUY E;  4GKJ E;  4YHH E;  2B3T B;  2ODR C;  2JVA A;  4JI8 E;  4BC9 A;  2RS6 A;  4LFA E;  4M2Z A;  2FV4 B;  2LMZ A;  4X64 E;  4F54 A;  4DR1 E;  2L6M A;  1T4L B;  1N36 E;  4BC7 A;  2IHR 1;  2LE2 A;  4NXN E;  4JI7 E;  2JR1 A;  1YYK A;  3VYX A;  2JOX A;  2JWO A;  4BS9 A;  4DUZ E;  3AUZ A;  2L2K B;  1GZ6 A;  2DB2 A;  3HQ1 A;  5DNY A;  2L8T A;  3KWR A;  4DR6 E;  3H09 A;  4JI5 E;  3F6G A;  1J26 A;  4B3M E;  2V88 A;  3HPZ A;  1EKZ A;  4JI2 E;  3VK6 A;  4OX9 E;  2V85 A;  2UUA E;  2VQE E;  5CFF E;  3T1H E;  2UUC E;  3ADL A;  1QU6 A;  3IWD A;  4GEQ B;  2M4I A;  2DIX A;  2NUG A;  5LMU E;  2V8Q B;  4X8W A;  3J81 C;  3C4B A;  2V89 A;  4NXM E;  1FKA E;  1J5E E;  1T4O A;  1WHN A;  1XNQ E;  3DF6 A;  5AE2 A;  2NUE A;  2RS7 A;  2VQF E;  4R8O A;  4DR3 E;  3P1X A;  2YZT A;  5F3W A;  5A2Q C;  2N3H A;  2LTR A;  5BR8 E;  4LF6 E;  1N33 E;  1N32 E;  1YYW A;  4B3R E;  1XMQ E;  4LFB E;  5ADZ A;  2E1M A;  2L3C A;  2L2M A;  4DKK A;  3JU0 A;  2LUP B;  2V87 A;  1O0W A;  4JI0 E;  1UIL A;  2G7H A;  4LTY A;  2L92 A;  3ADJ A;  3J80 C;  4L5N C;  2L2N A;  4DMI A;  5AE1 A;  2FGG A;  2V83 A;  3MSW A;  4JI3 E;  2EWL A;  4DR7 E;  4AQY E;  1STU A;  1ZBT A;  2RSM A;  3F6H A;  4LF7 E;  4P78 A;  4JI1 E;  4M30 A;  4YY3 E;  3C4T A;  4R03 A;  3RMP A;  4K0K E;  2VE7 C;  1RC7 A;  1HR0 E;  1SR9 A;  5AE3 A;  2LRS A;  2EZ6 A;  2VF1 A;  4DR2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...