2LTSA

Solution structure of rde-4(150-235)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
NDDSIPTSAEFPPGISPTENWVGKLQEKSQKSKLQAPIYEDSKNERTERFLVICTMCNQKTRGIRSKKKDAKNLAAWLMWKALEDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of RDE-4 dsRBDs and mutational studies provide insights into dsRNA recognition in the Caenorhabditis elegans RNAi pathway.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
molecule keywords Protein RDE-4
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ltsA00
3VYXA 1RQ0A 4X8WA 2N3HA 1J5EE 4LF8E 2B7TA 4DR7E 2L33A 1WHQA 5CFFE 4YY3E 4K0KE 2CPNA 4DR1E 1IBME 4B3RE 4JI8E 2UUCE 1N36E 2LRSA 5IWAE 2NUFA 2L2KB 2UUAE 4YHHE 4LF6E 1STUA 4DV3E 2JY9A 4GKKE 1J26A 4JI2E 4B3TE 1XMOE 2YT4A 2MDRA 2UXDE 1T4NA 1YYKA 2NUGA 2VQEE 1XMQE 4JI1E 4AQYE 4LFBE 4JI6E 2DIXA 2UUBE 2LUQA 4NXME 2VQFE 4DV2E 4NXNE 4M2ZA 3ADJA 1O0WA 4DV5E 1X49A 4DUYE 4B3ME 2L2MA 4DV0E 2ZM6E 1UILA 3VYYA 4WFTA 1N34E 2E5LE 3HTXA 1IBLE 4LF9E 4X64E 1GQEA 1T4OA 2NA2A 2L2NA 1IBKE 1XNRE 4JV5E 2LTSA 4DR4E 3ADGA 1N32E 4JYAE 1WHNA 3T1HE 1N33E 4X62E 2RTXA 4M30A 4DV4E 2IHR1 3J7Yp 4WYQB 1RC7A 4KHPE 1YYOA 2L3CA 5LMNE 4DV1E 1EKZA 1ZBTA 4GKJE 2UXBE 1QU6A 2EZ6A 3ADLA 4DR6E 2L3JA 4LF4E 1HNWE 2LJHA 2KHXA 3ADIA 4JI3E 3T1YE 4LFCE 1YYWA 4LF7E 4DUZE 5BR8E 4X66E 4JI5E 3P1XA 2LTRA 4DR5E 1HR0E 2LBSB 4DV6E 2LUPB 5LMUE 4OX9E 2JVAA 2B7VA 4B3SE 4JI0E 2RSMA 2DB2A 1YZ9A 1I94E 2RS7A 2DMYA 4LF5E 4JI7E 2RS6A 3C4BA 4DR2E 4X65E 2B3TB 1T4LB 1PKPA 4DKKA 2F4VE 4LFAE 2N3GA 1HNXE 1X47A 4DR3E 2UXCE 2UU9E 1XNQE 4JI4E 1UHZA 3LLHA 4OOGC 1HNZE 1X48A 3C4TA 3OTOE 1FKAE 1FJGE 2HHHE 1DI2A 2NUEA 4DV7E
chains in the Genus database with same CATH superfamily
3J81C 2YU8A 2FV4B 2L92A 2N3HA 2B7TA 1A1GA 4DR7E 2DLKA 4F9AB 2EPKX 4L5NC 3EPJA 4WXDA 5IWAE 2YZTA 3AUZA 1KYQA 2LV2A 4O5GA 3F6HA 4LF6E 3UK3C 2I9IA 2VF1A 2ENCA 2EM6A 2EOEA 3AV0A 4LFBE 2VRDA 4R2AA 3IWCA 4HEIA 4DV5E 5AASA 5KL2A 2EOJA 2EQ1A 1X3CA 4R2RA 2L2MA 1PJQA 1YPNA 5ADZA 1UILA 2BB8A 3VYYA 1WXRA 1N34E 4F9BB 3HTXA 3ZOQB 4JV5E 2GHFA 2LTSA 2EN6A 2YPNA 4F9CB 4P7DA 2JWOA 2EORA 4JYAE 2ENHA 1WHNA 2ADRA 3BF2A 2RTXA 3RMPA 2EL6A 1Z1BA 2IHR1 4KHPE 1ZAAC 1DGCA 3OMLA 4ZYDA 1A1FA 1A1IA 3TQMA 2EPLX 2LJHA 5KL5A 2EMZA 3T1YE 3HPSA 2HJJA 5BR8E 2LTRA 2F8BA 2GPIA 4O4KA 3C6KA 2MKDA 3LMLA 3C6MA 5LMUE 2JVAA 5AC4A 2B7VA 2K4VA 1X6HA 2CTDA 3BIDA 1JK1A 2RSMA 2JOXA 2H36X 2YU5A 2EE8A 2EOSA 5IT9C 2EOXA 1X5WA 3VHTB 3C4BA 4X65E 4O24A 4LFAE 3EPKA 2LMZA 2GLIA 2YTPA 4DR3E 2UXCE 1EH8A 1GTKA 3JTZA 4OOGC 3C4TA 1FKAE 1DI2A 2CT1A 2YRMA 3VYXA 2EPAA 3FIGA 2EQ0A 2EPNA 1IQOA 2K7IA 3EQ1A 2V87A 2CPNA 4K0KE 4JI8E 1UN6B 1N36E 4ZYEA 2EP3A 4R8OA 4GKKE 1AH5A 1WRJA 2DLQA 2YT4A 2ODRC 2UXDE 2B9DA 4TUIA 2NUGA 4JI1E 4FK5C 3JU0A 2DIXA 2VE7C 4JI6E 2UUBE 2JXPA 5AC5A 4DV2E 4NXNE 2DMIA 4M2ZA 5A6JA 1O0WA 2RQLA 5F3WA 4B3ME 3VK6A 1EH6A 4HTGA 4DV0E 5AE1A 4R2SA 3J80C 2PRTA 3J7AG 1GZ6A 2E5LE 4RHBB 2EM4A 1T4OA 1WJPA 1XNRE 2G7HA 1G2DC 1N32E 2V83A 2NABA 2FTXB 4BHBA 1YFHA 2EMIA 3MSWA 1UBDC 5KL4A 2L8TA 2EOIA 1YYOA 2YRKA 2EMGA 1ZBTA 2JR1A 2UXBE 4BBYA 2EZ6A 2EL4A 1TN9A 2I13A 2JYAA 1HNWE 2Q8UA 2EPRA 4P78A 3ADIA 4JI3E 1RMDA 3DF6A 1YYWA 4R2PA 4LF7E 2EPOA 4R2CA 4X66E 3P1XA 4JI5E 3IWDA 1HR0E 2LBSB 1ZBQA 3QG5C 1JK2A 2M7QA 5A6BD 2EN3A 4N4RB 2WBUA 2JPAA 5AE2A 5LLQA 2YTOA 2RSIA 2DRPA 2EN8A 2M1SA 4DMIA 1I94E 2RS7A 1G2FC 4BHCA 2EMLA 1X6EA 2DMYA 2EM8A 4NHRA 1PKPA 2F4VE 2KOUA 2EWLA 1HNXE 2EMFA 1XNQE 1HNZE 3OTOE 4WXCA 4DV7E 1MEYC 4Q35B 2EM0A 1PJTA 2LE2A 1J5EE 3HQ1A 2KONA 3IWBA 2YWQA 4LF8E 1N3GA 4ZYGA 1A1HA 5CFFE 2MC5A 1IBME 2N8XA 4B3RE 2UUCE 1T39A 2LRSA 5A69A 2L2KB 5FLXC 4YHHE 2YTNA 1STUA 4DV3E 2EOHA 2JY9A 2YTJA 2ENAA 3DJWA 1J26A 1XMOE 2MDRA 2WBTA 2VQEE 1XMQE 2V8QB 4AQYE 4L8NA 2LUQA 2EMXA 1KJKA 3L00A 2EMAA 2MC6A 4GEQB 2ZM6E 2EPZA 3BBGA 4WSGA 4F6MA 4MLQA 2EMCA 1YUJA 2V89A 4LF9E 2NA2A 5LL6R 2EPXA 5A6BA 4KWYA 3T1HE 2EOMA 4MLVA 1YUIA 4X62E 2EN4A 4M30A 4DV4E 2EPUA 2EMKA 2M9AA 1L4SA 3JAMC 4BS9A 1LLMC 2EL5A 2EM2A 5KL3A 1EKZA 1P47A 5KL6A 2JP9A 2CSHA 1B69A 2L3JA 4LF4E 2ELYA 1BB8A 2EMHA 2KHXA 2YSOA 2YTQA 4LFCE 2EOZA 3HPZA 4NZVA 4DR5E 2R76A 2J7JA 1PJSA 4LTYA 1TF3A 4DV6E 2RPCA 5A2QC 4LU9A 2LUPB 2FGGA 1SR9A 5AE3A 4B3SE 4JI0E 1A1KA 4BC7A 2EN7A 2EM3A 2DB2A 1YZ9A 2EJ4A 2R1FA 2YTEA 2LJUA 2YTIA 1T38A 4F54A 2RS6A 4RH8A 1PDAA 4DKKA 2M4IA 4I8OA 2N3GA 2WCC3 1ZU1A 1BBGA 2UU9E 4JI4E 3KWRA 1UHZA 4ZYHA 2NUEA 1QNTA 2EOFA 5TSEA 1RQ0A 3KZZA 4X8WA 4O43A 3HXLA 2V86A 2LCEA 2EM7A 2L33A 1WHQA 1SFEA 4YY3E 4DR1E 5IV8B 4F2JC 4KZSA 2YTDA 4Q28A 2NUFA 2ELZA 2UUAE 5IXMB 5A6AA 2E1MA 1BBOA 2YTGA 5T6JA 4IS1C 2ODRD 3THOB 4JI2E 2EMBA 4B3TE 2LVHA 4M9VC 2EMWA 1T4NA 1YYKA 4IJDA 2WBSA 2EQ3A 4NXME 2VQFE 4TUGA 3EPLA 2HGHA 3ADJA 1IMUA 2V88A 2EPCA 1X49A 2DSYA 2L6MA 2EOQA 4DUYE 2A25A 3EPHA 4WFTA 4WSPA 1IBLE 4X64E 1GQEA 4WX9A 2EOYA 2L2NA 2YRHA 1IBKE 1IQSA 1NEIA 4DR4E 3ADGA 2EM9A 2BBGA 1N33E 4J8ZA 1MGTA 2EOOA 3J7Yp 4WYQB 1RC7A 2EN1A 1EH7A 2EMYA 1A1JA 2E72A 5A6KA 2YTFA 2L3CA 5LMNE 4DV1E 3M99B 4R03A 4GKJE 1QU6A 1A1LA 2LO3A 3ADLA 1X6FA 4BCAA 1YSAC 4DR6E 2D9HA 2YSPA 5KL7A 4F6NA 1AAYA 4R2QA 4R2DA 3MHSC 4DUZE 3BGHA 2LT7A 2HC5A 2JOBA 3ECRA 4X9JA 1NCSA 2DGCA 3K6QA 4GZNC 4OX9E 2MDGA 3H09A 4BMJA 5DNYA 1ZR9A 3F6GA 2WZOA 1DQ3A 4M0VA 4BC9A 1TF6A 3THNA 2EPPA 4WPYA 4LF5E 4JI7E 1T4LB 2V85A 2EN2A 2B3TB 4DR2E 1F2IG 1X47A 2EPMX 2MKNA 3KZYA 3LLHA 4R2EA 1X48A 1FJGE 2HHHE 3MHHC 2EM5A
chains in the Genus database with same CATH topology
2LE2A 3J81C 3VYXA 1RQ0A 4X8WA 3FIGA 2FV4B 2L92A 2N3HA 2KONA 3HQ1A 3IWBA 2B7TA 3HXLA 1J5EE 2V86A 4LF8E 4DR7E 2L33A 1WHQA 5CFFE 4YY3E 4F9AB 2MC5A 4K0KE 2V87A 2CPNA 4DR1E 1IBME 4L5NC 4B3RE 4JI8E 2UUCE 4KZSA 1N36E 4Q28A 2LRSA 5IWAE 2NUFA 2YZTA 4R8OA 5FLXC 4YHHE 2L2KB 2UUAE 3AUZA 2E1MA 3F6HA 1STUA 4LF6E 5T6JA 4DV3E 2VF1A 2JY9A 2ODRD 4GKKE 1J26A 4JI2E 3DJWA 4B3TE 1XMOE 2YT4A 2ODRC 2MDRA 2UXDE 2B9DA 4TUIA 1T4NA 1YYKA 2NUGA 2VQEE 1XMQE 3AV0A 2V8QB 4AQYE 4JI1E 3JU0A 2DIXA 2VE7C 4JI6E 4L8NA 2UUBE 4LFBE 2LUQA 4NXME 2VQFE 4DV2E 4NXNE 3IWCA 4TUGA 4M2ZA 3ADJA 1O0WA 2V88A 4DV5E 5AASA 5F3WA 1X49A 2DSYA 2L6MA 3VK6A 2MC6A 4DUYE 4B3ME 2L2MA 4DV0E 4GEQB 5ADZA 5AE1A 2ZM6E 1UILA 3J80C 3VYYA 1WXRA 4WFTA 1N34E 3J7AG 1GZ6A 4F9BB 2V89A 2E5LE 4WSPA 3HTXA 1IBLE 4LF9E 4X64E 1GQEA 2NA2A 1T4OA 2L2NA 3ZOQB 1IBKE 1XNRE 2G7HA 2LTSA 5LL6R 4JV5E 4F9CB 4DR4E 4P7DA 3ADGA 2JWOA 1N32E 4JYAE 1WHNA 3T1HE 1N33E 2V83A 4J8ZA 4X62E 2FTXB 2RTXA 3RMPA 4M30A 3MSWA 2IHR1 4DV4E 3J7Yp 4WYQB 1RC7A 3JAMC 4KHPE 2L8TA 4BS9A 1YYOA 2L3CA 5LMNE 4DV1E 1EKZA 1ZBTA 2JR1A 4R03A 4GKJE 2UXBE 1QU6A 4BBYA 2EZ6A 3OMLA 3ADLA 4DR6E 4BCAA 2L3JA 4LF4E 1HNWE 4P78A 2LJHA 2KHXA 3ADIA 4JI3E 3T1YE 4LFCE 3DF6A 1YYWA 4LF7E 4DUZE 3HPSA 3HPZA 5BR8E 4X66E 3P1XA 2LTRA 4DR5E 4JI5E 2F8BA 2JOBA 3IWDA 1HR0E 2LBSB 4LTYA 4DV6E 1ZBQA 5A2QC 3K6QA 2M7QA 4LU9A 3LMLA 2LUPB 5LMUE 2FGGA 2JVAA 1SR9A 4BMJA 3H09A 5AE3A 5DNYA 4OX9E 2B7VA 5AE2A 4B3SE 4JI0E 3F6GA 2K4VA 4BC7A 2WZOA 1DQ3A 2RSMA 4M0VA 2DB2A 2JOXA 4BC9A 2M1SA 1YZ9A 2H36X 4DMIA 1I94E 2RS7A 4WPYA 2DMYA 5IT9C 4F54A 4LF5E 4JI7E 2RS6A 3C4BA 2V85A 4X65E 2B3TB 4DR2E 1PKPA 4DKKA 1T4LB 2F4VE 2M4IA 2KOUA 2EWLA 2N3GA 4I8OA 1HNXE 2LMZA 1X47A 4LFAE 4DR3E 2UXCE 2UU9E 1XNQE 4JI4E 3JTZA 3KWRA 1UHZA 3LLHA 4OOGC 1HNZE 1X48A 3C4TA 3OTOE 1FKAE 1FJGE 2HHHE 1DI2A 2NUEA 4DV7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYX A;  1RQ0 A;  4X8W A;  2N3H A;  1J5E E;  4LF8 E;  2B7T A;  4DR7 E;  2L33 A;  1WHQ A;  5CFF E;  4YY3 E;  4K0K E;  2CPN A;  4DR1 E;  1IBM E;  4B3R E;  4JI8 E;  2UUC E;  1N36 E;  2LRS A;  5IWA E;  2NUF A;  2L2K B;  2UUA E;  4YHH E;  4LF6 E;  1STU A;  4DV3 E;  2JY9 A;  4GKK E;  1J26 A;  4JI2 E;  4B3T E;  1XMO E;  2YT4 A;  2MDR A;  2UXD E;  1T4N A;  1YYK A;  2NUG A;  2VQE E;  1XMQ E;  4JI1 E;  4AQY E;  4LFB E;  4JI6 E;  2DIX A;  2UUB E;  2LUQ A;  4NXM E;  2VQF E;  4DV2 E;  4NXN E;  4M2Z A;  3ADJ A;  1O0W A;  4DV5 E;  1X49 A;  4DUY E;  4B3M E;  2L2M A;  4DV0 E;  2ZM6 E;  1UIL A;  3VYY A;  4WFT A;  1N34 E;  2E5L E;  3HTX A;  1IBL E;  4LF9 E;  4X64 E;  1GQE A;  1T4O A;  2NA2 A;  2L2N A;  1IBK E;  1XNR E;  4JV5 E;  2LTS A;  4DR4 E;  3ADG A;  1N32 E;  4JYA E;  1WHN A;  3T1H E;  1N33 E;  4X62 E;  2RTX A;  4M30 A;  4DV4 E;  2IHR 1;  3J7Y p;  4WYQ B;  1RC7 A;  4KHP E;  1YYO A;  2L3C A;  5LMN E;  4DV1 E;  1EKZ A;  1ZBT A;  4GKJ E;  2UXB E;  1QU6 A;  2EZ6 A;  3ADL A;  4DR6 E;  2L3J A;  4LF4 E;  1HNW E;  2LJH A;  2KHX A;  3ADI A;  4JI3 E;  3T1Y E;  4LFC E;  1YYW A;  4LF7 E;  4DUZ E;  5BR8 E;  4X66 E;  4JI5 E;  3P1X A;  2LTR A;  4DR5 E;  1HR0 E;  2LBS B;  4DV6 E;  2LUP B;  5LMU E;  4OX9 E;  2JVA A;  2B7V A;  4B3S E;  4JI0 E;  2RSM A;  2DB2 A;  1YZ9 A;  1I94 E;  2RS7 A;  2DMY A;  4LF5 E;  4JI7 E;  2RS6 A;  3C4B A;  4DR2 E;  4X65 E;  2B3T B;  1T4L B;  1PKP A;  4DKK A;  2F4V E;  4LFA E;  2N3G A;  1HNX E;  1X47 A;  4DR3 E;  2UXC E;  2UU9 E;  1XNQ E;  4JI4 E;  1UHZ A;  3LLH A;  4OOG C;  1HNZ E;  1X48 A;  3C4T A;  3OTO E;  1FKA E;  1FJG E;  2HHH E;  1DI2 A;  2NUE A;  4DV7 E; 
#chains in the Genus database with same CATH topology
 3J81 C;  2YU8 A;  2FV4 B;  2L92 A;  2N3H A;  2B7T A;  1A1G A;  4DR7 E;  2DLK A;  4F9A B;  2EPK X;  4L5N C;  3EPJ A;  4WXD A;  5IWA E;  2YZT A;  3AUZ A;  1KYQ A;  2LV2 A;  4O5G A;  3F6H A;  4LF6 E;  3UK3 C;  2I9I A;  2VF1 A;  2ENC A;  2EM6 A;  2EOE A;  3AV0 A;  4LFB E;  2VRD A;  4R2A A;  3IWC A;  4HEI A;  4DV5 E;  5AAS A;  5KL2 A;  2EOJ A;  2EQ1 A;  1X3C A;  4R2R A;  2L2M A;  1PJQ A;  1YPN A;  5ADZ A;  1UIL A;  2BB8 A;  3VYY A;  1WXR A;  1N34 E;  4F9B B;  3HTX A;  3ZOQ B;  4JV5 E;  2GHF A;  2LTS A;  2EN6 A;  2YPN A;  4F9C B;  4P7D A;  2JWO A;  2EOR A;  4JYA E;  2ENH A;  1WHN A;  2ADR A;  3BF2 A;  2RTX A;  3RMP A;  2EL6 A;  1Z1B A;  2IHR 1;  4KHP E;  1ZAA C;  1DGC A;  3OML A;  4ZYD A;  1A1F A;  1A1I A;  3TQM A;  2EPL X;  2LJH A;  5KL5 A;  2EMZ A;  3T1Y E;  3HPS A;  2HJJ A;  5BR8 E;  2LTR A;  2F8B A;  2GPI A;  4O4K A;  3C6K A;  2MKD A;  3LML A;  3C6M A;  5LMU E;  2JVA A;  5AC4 A;  2B7V A;  2K4V A;  1X6H A;  2CTD A;  3BID A;  1JK1 A;  2RSM A;  2JOX A;  2H36 X;  2YU5 A;  2EE8 A;  2EOS A;  5IT9 C;  2EOX A;  1X5W A;  3VHT B;  3C4B A;  4X65 E;  4O24 A;  4LFA E;  3EPK A;  2LMZ A;  2GLI A;  2YTP A;  4DR3 E;  2UXC E;  1EH8 A;  1GTK A;  3JTZ A;  4OOG C;  3C4T A;  1FKA E;  1DI2 A;  2CT1 A;  2YRM A;  3VYX A;  2EPA A;  3FIG A;  2EQ0 A;  2EPN A;  1IQO A;  2K7I A;  3EQ1 A;  2V87 A;  2CPN A;  4K0K E;  4JI8 E;  1UN6 B;  1N36 E;  4ZYE A;  2EP3 A;  4R8O A;  4GKK E;  1AH5 A;  1WRJ A;  2DLQ A;  2YT4 A;  2ODR C;  2UXD E;  2B9D A;  4TUI A;  2NUG A;  4JI1 E;  4FK5 C;  3JU0 A;  2DIX A;  2VE7 C;  4JI6 E;  2UUB E;  2JXP A;  5AC5 A;  4DV2 E;  4NXN E;  2DMI A;  4M2Z A;  5A6J A;  1O0W A;  2RQL A;  5F3W A;  4B3M E;  3VK6 A;  1EH6 A;  4HTG A;  4DV0 E;  5AE1 A;  4R2S A;  3J80 C;  2PRT A;  3J7A G;  1GZ6 A;  2E5L E;  4RHB B;  2EM4 A;  1T4O A;  1WJP A;  1XNR E;  2G7H A;  1G2D C;  1N32 E;  2V83 A;  2NAB A;  2FTX B;  4BHB A;  1YFH A;  2EMI A;  3MSW A;  1UBD C;  5KL4 A;  2L8T A;  2EOI A;  1YYO A;  2YRK A;  2EMG A;  1ZBT A;  2JR1 A;  2UXB E;  4BBY A;  2EZ6 A;  2EL4 A;  1TN9 A;  2I13 A;  2JYA A;  1HNW E;  2Q8U A;  2EPR A;  4P78 A;  3ADI A;  4JI3 E;  1RMD A;  3DF6 A;  1YYW A;  4R2P A;  4LF7 E;  2EPO A;  4R2C A;  4X66 E;  3P1X A;  4JI5 E;  3IWD A;  1HR0 E;  2LBS B;  1ZBQ A;  3QG5 C;  1JK2 A;  2M7Q A;  5A6B D;  2EN3 A;  4N4R B;  2WBU A;  2JPA A;  5AE2 A;  5LLQ A;  2YTO A;  2RSI A;  2DRP A;  2EN8 A;  2M1S A;  4DMI A;  1I94 E;  2RS7 A;  1G2F C;  4BHC A;  2EML A;  1X6E A;  2DMY A;  2EM8 A;  4NHR A;  1PKP A;  2F4V E;  2KOU A;  2EWL A;  1HNX E;  2EMF A;  1XNQ E;  1HNZ E;  3OTO E;  4WXC A;  4DV7 E;  1MEY C;  4Q35 B;  2EM0 A;  1PJT A;  2LE2 A;  1J5E E;  3HQ1 A;  2KON A;  3IWB A;  2YWQ A;  4LF8 E;  1N3G A;  4ZYG A;  1A1H A;  5CFF E;  2MC5 A;  1IBM E;  2N8X A;  4B3R E;  2UUC E;  1T39 A;  2LRS A;  5A69 A;  2L2K B;  5FLX C;  4YHH E;  2YTN A;  1STU A;  4DV3 E;  2EOH A;  2JY9 A;  2YTJ A;  2ENA A;  3DJW A;  1J26 A;  1XMO E;  2MDR A;  2WBT A;  2VQE E;  1XMQ E;  2V8Q B;  4AQY E;  4L8N A;  2LUQ A;  2EMX A;  1KJK A;  3L00 A;  2EMA A;  2MC6 A;  4GEQ B;  2ZM6 E;  2EPZ A;  3BBG A;  4WSG A;  4F6M A;  4MLQ A;  2EMC A;  1YUJ A;  2V89 A;  4LF9 E;  2NA2 A;  5LL6 R;  2EPX A;  5A6B A;  4KWY A;  3T1H E;  2EOM A;  4MLV A;  1YUI A;  4X62 E;  2EN4 A;  4M30 A;  4DV4 E;  2EPU A;  2EMK A;  2M9A A;  1L4S A;  3JAM C;  4BS9 A;  1LLM C;  2EL5 A;  2EM2 A;  5KL3 A;  1EKZ A;  1P47 A;  5KL6 A;  2JP9 A;  2CSH A;  1B69 A;  2L3J A;  4LF4 E;  2ELY A;  1BB8 A;  2EMH A;  2KHX A;  2YSO A;  2YTQ A;  4LFC E;  2EOZ A;  3HPZ A;  4NZV A;  4DR5 E;  2R76 A;  2J7J A;  1PJS A;  4LTY A;  1TF3 A;  4DV6 E;  2RPC A;  5A2Q C;  4LU9 A;  2LUP B;  2FGG A;  1SR9 A;  5AE3 A;  4B3S E;  4JI0 E;  1A1K A;  4BC7 A;  2EN7 A;  2EM3 A;  2DB2 A;  1YZ9 A;  2EJ4 A;  2R1F A;  2YTE A;  2LJU A;  2YTI A;  1T38 A;  4F54 A;  2RS6 A;  4RH8 A;  1PDA A;  4DKK A;  2M4I A;  4I8O A;  2N3G A;  2WCC 3;  1ZU1 A;  1BBG A;  2UU9 E;  4JI4 E;  3KWR A;  1UHZ A;  4ZYH A;  2NUE A;  1QNT A;  2EOF A;  5TSE A;  1RQ0 A;  3KZZ A;  4X8W A;  4O43 A;  3HXL A;  2V86 A;  2LCE A;  2EM7 A;  2L33 A;  1WHQ A;  1SFE A;  4YY3 E;  4DR1 E;  5IV8 B;  4F2J C;  4KZS A;  2YTD A;  4Q28 A;  2NUF A;  2ELZ A;  2UUA E;  5IXM B;  5A6A A;  2E1M A;  1BBO A;  2YTG A;  5T6J A;  4IS1 C;  2ODR D;  3THO B;  4JI2 E;  2EMB A;  4B3T E;  2LVH A;  4M9V C;  2EMW A;  1T4N A;  1YYK A;  4IJD A;  2WBS A;  2EQ3 A;  4NXM E;  2VQF E;  4TUG A;  3EPL A;  2HGH A;  3ADJ A;  1IMU A;  2V88 A;  2EPC A;  1X49 A;  2DSY A;  2L6M A;  2EOQ A;  4DUY E;  2A25 A;  3EPH A;  4WFT A;  4WSP A;  1IBL E;  4X64 E;  1GQE A;  4WX9 A;  2EOY A;  2L2N A;  2YRH A;  1IBK E;  1IQS A;  1NEI A;  4DR4 E;  3ADG A;  2EM9 A;  2BBG A;  1N33 E;  4J8Z A;  1MGT A;  2EOO A;  3J7Y p;  4WYQ B;  1RC7 A;  2EN1 A;  1EH7 A;  2EMY A;  1A1J A;  2E72 A;  5A6K A;  2YTF A;  2L3C A;  5LMN E;  4DV1 E;  3M99 B;  4R03 A;  4GKJ E;  1QU6 A;  1A1L A;  2LO3 A;  3ADL A;  1X6F A;  4BCA A;  1YSA C;  4DR6 E;  2D9H A;  2YSP A;  5KL7 A;  4F6N A;  1AAY A;  4R2Q A;  4R2D A;  3MHS C;  4DUZ E;  3BGH A;  2LT7 A;  2HC5 A;  2JOB A;  3ECR A;  4X9J A;  1NCS A;  2DGC A;  3K6Q A;  4GZN C;  4OX9 E;  2MDG A;  3H09 A;  4BMJ A;  5DNY A;  1ZR9 A;  3F6G A;  2WZO A;  1DQ3 A;  4M0V A;  4BC9 A;  1TF6 A;  3THN A;  2EPP A;  4WPY A;  4LF5 E;  4JI7 E;  1T4L B;  2V85 A;  2EN2 A;  2B3T B;  4DR2 E;  1F2I G;  1X47 A;  2EPM X;  2MKN A;  3KZY A;  3LLH A;  4R2E A;  1X48 A;  1FJG E;  2HHH E;  3MHH C;  2EM5 A; 
#chains in the Genus database with same CATH homology
 2LE2 A;  3J81 C;  3VYX A;  1RQ0 A;  4X8W A;  3FIG A;  2FV4 B;  2L92 A;  2N3H A;  2KON A;  3HQ1 A;  3IWB A;  2B7T A;  3HXL A;  1J5E E;  2V86 A;  4LF8 E;  4DR7 E;  2L33 A;  1WHQ A;  5CFF E;  4YY3 E;  4F9A B;  2MC5 A;  4K0K E;  2V87 A;  2CPN A;  4DR1 E;  1IBM E;  4L5N C;  4B3R E;  4JI8 E;  2UUC E;  4KZS A;  1N36 E;  4Q28 A;  2LRS A;  5IWA E;  2NUF A;  2YZT A;  4R8O A;  5FLX C;  4YHH E;  2L2K B;  2UUA E;  3AUZ A;  2E1M A;  3F6H A;  1STU A;  4LF6 E;  5T6J A;  4DV3 E;  2VF1 A;  2JY9 A;  2ODR D;  4GKK E;  1J26 A;  4JI2 E;  3DJW A;  4B3T E;  1XMO E;  2YT4 A;  2ODR C;  2MDR A;  2UXD E;  2B9D A;  4TUI A;  1T4N A;  1YYK A;  2NUG A;  2VQE E;  1XMQ E;  3AV0 A;  2V8Q B;  4AQY E;  4JI1 E;  3JU0 A;  2DIX A;  2VE7 C;  4JI6 E;  4L8N A;  2UUB E;  4LFB E;  2LUQ A;  4NXM E;  2VQF E;  4DV2 E;  4NXN E;  3IWC A;  4TUG A;  4M2Z A;  3ADJ A;  1O0W A;  2V88 A;  4DV5 E;  5AAS A;  5F3W A;  1X49 A;  2DSY A;  2L6M A;  3VK6 A;  2MC6 A;  4DUY E;  4B3M E;  2L2M A;  4DV0 E;  4GEQ B;  5ADZ A;  5AE1 A;  2ZM6 E;  1UIL A;  3J80 C;  3VYY A;  1WXR A;  4WFT A;  1N34 E;  3J7A G;  1GZ6 A;  4F9B B;  2V89 A;  2E5L E;  4WSP A;  3HTX A;  1IBL E;  4LF9 E;  4X64 E;  1GQE A;  2NA2 A;  1T4O A;  2L2N A;  3ZOQ B;  1IBK E;  1XNR E;  2G7H A;  2LTS A;  5LL6 R;  4JV5 E;  4F9C B;  4DR4 E;  4P7D A;  3ADG A;  2JWO A;  1N32 E;  4JYA E;  1WHN A;  3T1H E;  1N33 E;  2V83 A;  4J8Z A;  4X62 E;  2FTX B;  2RTX A;  3RMP A;  4M30 A;  3MSW A;  2IHR 1;  4DV4 E;  3J7Y p;  4WYQ B;  1RC7 A;  3JAM C;  4KHP E;  2L8T A;  4BS9 A;  1YYO A;  2L3C A;  5LMN E;  4DV1 E;  1EKZ A;  1ZBT A;  2JR1 A;  4R03 A;  4GKJ E;  2UXB E;  1QU6 A;  4BBY A;  2EZ6 A;  3OML A;  3ADL A;  4DR6 E;  4BCA A;  2L3J A;  4LF4 E;  1HNW E;  4P78 A;  2LJH A;  2KHX A;  3ADI A;  4JI3 E;  3T1Y E;  4LFC E;  3DF6 A;  1YYW A;  4LF7 E;  4DUZ E;  3HPS A;  3HPZ A;  5BR8 E;  4X66 E;  3P1X A;  2LTR A;  4DR5 E;  4JI5 E;  2F8B A;  2JOB A;  3IWD A;  1HR0 E;  2LBS B;  4LTY A;  4DV6 E;  1ZBQ A;  5A2Q C;  3K6Q A;  2M7Q A;  4LU9 A;  3LML A;  2LUP B;  5LMU E;  2FGG A;  2JVA A;  1SR9 A;  4BMJ A;  3H09 A;  5AE3 A;  5DNY A;  4OX9 E;  2B7V A;  5AE2 A;  4B3S E;  4JI0 E;  3F6G A;  2K4V A;  4BC7 A;  2WZO A;  1DQ3 A;  2RSM A;  4M0V A;  2DB2 A;  2JOX A;  4BC9 A;  2M1S A;  1YZ9 A;  2H36 X;  4DMI A;  1I94 E;  2RS7 A;  4WPY A;  2DMY A;  5IT9 C;  4F54 A;  4LF5 E;  4JI7 E;  2RS6 A;  3C4B A;  2V85 A;  4X65 E;  2B3T B;  4DR2 E;  1PKP A;  4DKK A;  1T4L B;  2F4V E;  2M4I A;  2KOU A;  2EWL A;  2N3G A;  4I8O A;  1HNX E;  2LMZ A;  1X47 A;  4LFA E;  4DR3 E;  2UXC E;  2UU9 E;  1XNQ E;  4JI4 E;  3JTZ A;  3KWR A;  1UHZ A;  3LLH A;  4OOG C;  1HNZ E;  1X48 A;  3C4T A;  3OTO E;  1FKA E;  1FJG E;  2HHH E;  1DI2 A;  2NUE A;  4DV7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...