2LTSA

Solution structure of rde-4(150-235)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
b'NDDSIPTSAEFPPGISPTENWVGKLQEKSQKSKLQAPIYEDSKNERTERFLVICTMCNQKTRGIRSKKKDAKNLAAWLMWKALEDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein RDE-4
molecule tags Rna binding protein
source organism Caenorhabditis elegans
publication title Structure of RDE-4 dsRBDs and mutational studies provide insights into dsRNA recognition in the Caenorhabditis elegans RNAi pathway.
pubmed doi rcsb
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ltsA00
2JY9A 4DR1E 3C4BA 2NUFA 4JI3E 2LTRA 2CPNA 4DUYE 1HNZE 1N32E 4DR2E 1HNXE 1J26A 1STUA 4NXME 4YY3E 4LF8E 1X49A 4LF4E 1YZ9A 4X64E 4NXNE 4X66E 4DR3E 2L3CA 2L33A 2L2MA 1O0WA 1T4NA 4LF7E 4JI5E 1XNRE 4X62E 2NUGA 3C4TA 3J7Yp 4LFAE 3P1XA 1YYKA 1FJGE 2LRSA 2B3TB 2UXCE 2UUCE 2MDRA 1FKAE 1QU6A 4DV6E 2F4VE 4LF9E 4AQYE 1IBLE 4DV5E 4M30A 2DMYA 3ADGA 1ZBTA 2UUAE 2NUEA 2RS6A 1IBME 2KHXA 4X65E 4LF6E 4DV4E 2L2NA 2B7TA 2N3GA 1N34E 2DB2A 1XMQE 5IWAE 4DV0E 2L2KB 4JI1E 2EZ6A 3T1YE 2RSMA 2B7VA 3LLHA 3HTXA 4JYAE 4KHPE 4GKJE 4X8WA 1N36E 4LF5E 5LMUE 4JI8E 2LJHA 1UILA 2UUBE 2LUQA 1N33E 1IBKE 4YHHE 1WHQA 4DV3E 4B3TE 4DV1E 3T1HE 4WYQB 1UHZA 2L3JA 1EKZA 4OOGC 1YYWA 1WHNA 2N3HA 4GKKE 2DIXA 2YT4A 4DUZE 5CFFE 2ZM6E 4M2ZA 4DR4E 2E5LE 2LBSB 1X47A 4DR7E 1DI2A 1I94E 1J5EE 4JI4E 5LMNE 2HHHE 1GQEA 3OTOE 4JI7E 2VQFE 3VYXA 4DV7E 1PKPA 2IHR1 4B3SE 2UXDE 4LFBE 4DR5E 2RTXA 3ADJA 1RQ0A 3ADLA 1XNQE 4JI0E 4LFCE 2LUPB 4JI2E 4JI6E 5BR8E 4B3RE 1RC7A 1T4OA 2JVAA 4WFTA 2LTSA 1YYOA 2NA2A 4DKKA 1HR0E 3ADIA 4DR6E 4OX9E 2VQEE 1T4LB 2UU9E 2RS7A 4DV2E 1XMOE 4B3ME 4JV5E 1HNWE 3VYYA 1X48A 2UXBE 4K0KE
chains in the Genus database with same CATH superfamily
3ZOQB 2EPCA 2YPNA 1A1GA 1TF3A 2EM6A 4WX9A 2EMIA 1HNXE 3QG5C 2EOMA 3BF2A 5IT9C 1X6EA 2EPKX 4X64E 4LTYA 4X66E 4MLQA 4X9JA 4O4KA 1WRJA 4M9VC 2EMWA 2EN3A 4BCAA 2EMBA 2GPIA 2NABA 2NUGA 2VRDA 1UBDC 3BIDA 2EM7A 3P1XA 2YTGA 1FJGE 1YUIA 2UXCE 2UUCE 2MDRA 3BGHA 2F4VE 2E1MA 1IBLE 4BMJA 4DV5E 1KYQA 1AH5A 2N8XA 2KHXA 4LF6E 4HTGA 5FLXC 4DV4E 2EQ0A 2L2NA 2V86A 4F9AB 4NHRA 5AE3A 3J80C 1TF6A 2JOXA 3T1YE 2B7VA 2EM9A 3LLHA 5KL4A 2EMFA 4LF5E 3HPZA 2LJHA 4JI8E 1UILA 3DJWA 1IBKE 2EMHA 4DV1E 4MLVA 2ADRA 3UK3C 4WYQB 1GZ6A 2EM0A 1A1FA 2CT1A 1YYWA 1PJSA 2DIXA 2YT4A 2LJUA 2YSOA 4F54A 2ZM6E 2EMCA 2EN1A 2MKNA 2EOHA 4L8NA 1I94E 1A1KA 1DQ3A 5LMNE 3DF6A 4FK5C 4IS1C 1ZBQA 2M9AA 4BHCA 2JPAA 1EH6A 5AC4A 4WSGA 4LFBE 2EMZA 1NCSA 2LT7A 3EPHA 2EPZA 1JK2A 2EMKA 2LMZA 3F6HA 2R1FA 1AAYA 4LFCE 2MC5A 3K6QA 5BR8E 4B3RE 2RPCA 5KL3A 1RMDA 4WFTA 2LTSA 2YTNA 3ADIA 1DGCA 2EPXA 4OX9E 1ZU1A 4WSPA 4DV2E 2LV2A 4R2SA 2LUPB 4JI6E 2EZ6A 5T6JA 1UN6B 2EE8A 5IV8B 2NUFA 2ELZA 2EN7A 4KWYA 2EOYA 1BBOA 2EPMX 2LTRA 2WZOA 4DUYE 2YRKA 4R2CA 4DR2E 2EOOA 2M4IA 3EPKA 4YY3E 2EP3A 2VE7C 1X49A 1YZ9A 2LE2A 1YSAC 4NXNE 2EPRA 3J81C 2F8BA 4DMIA 2LVHA 4R2DA 1XNRE 4GEQB 4X62E 1EH8A 3C4TA 4TUGA 4LFAE 2RQLA 2WBTA 2CSHA 2EOXA 2WBUA 2V83A 1FKAE 1QU6A 4LF9E 4AQYE 2UUAE 1ZBTA 2EPOA 2NUEA 1IBME 4X65E 2EMXA 2GLIA 2B7TA 2EOJA 2KOUA 1X3CA 3AUZA 3F6GA 2YTFA 2JYAA 2EWLA 1XMQE 1MEYC 4DV0E 4JYAE 4O24A 5LMUE 2J7JA 2YZTA 3IWDA 2MDGA 2YRHA 4B3TE 4ZYEA 1G2FC 2L3JA 2K4VA 3TQMA 3KZYA 1X6FA 3KZZA 4P78A 1Z1BA 2HGHA 5ADZA 2N3HA 4GKKE 2M7QA 4M2ZA 1WJPA 2EMLA 2EOIA 2JR1A 5LL6R 4ZYGA 2L6MA 4N4RB 2E5LE 4DR4E 5A6KA 4DR7E 3THOB 4JI4E 3JAMC 4WPYA 2HHHE 2EPNA 4DV7E 2EORA 2IHR1 1QNTA 3JTZA 2UXDE 4BBYA 4DR5E 2RTXA 3IWCA 2EOQA 4ZYDA 3ADLA 2EM3A 2MC6A 2EN4A 3IWBA 4F2JC 4BHBA 1RC7A 1MGTA 2JVAA 5A69A 2E72A 2ODRD 2YU8A 1T4LB 2KONA 5A6BD 2DLQA 2CTDA 2RS7A 3H09A 4I8OA 1EH7A 4M0VA 4JV5E 1HNWE 2LCEA 1KJKA 2JY9A 4DR1E 3C4BA 2EN8A 4BC7A 2GHFA 1JK1A 2BB8A 2V85A 3VHTB 1STUA 2YWQA 2BBGA 4LF8E 2DSYA 1T39A 4F6MA 2EN2A 2EQ1A 3EQ1A 2EMAA 4DR3E 3HPSA 2L33A 2YSPA 1O0WA 2H36X 1IQSA 4JI5E 2PRTA 5F3WA 1YYKA 4R2EA 2B3TB 2RSIA 2WCC3 1N3GA 2DMYA 2YRMA 2RS6A 2HC5A 2YTIA 3RMPA 5AASA 2N3GA 2EPPA 4ZYHA 2JWOA 1N34E 2DB2A 2JP9A 4NZVA 5KL2A 4O5GA 5IWAE 2L2KB 4KHPE 1WXRA 3HTXA 3FIGA 4R8OA 2FV4B 4GZNC 4GKJE 1N36E 2YTPA 4IJDA 4BS9A 5A6AA 2MKDA 4WXDA 4YHHE 2K7IA 1WHQA 1ZR9A 4DV3E 3T1HE 2L92A 5KL5A 1A1JA 4Q28A 2I13A 1UHZA 4OOGC 1LLMC 2ENCA 2JXPA 4DUZE 1B69A 1X5WA 4F9BB 5DNYA 1GQEA 3VK6A 4JI7E 2VQFE 2EPUA 4RHBB 2YU5A 2YTOA 1T38A 2DLKA 5AE1A 3AV0A 4B3SE 3THNA 2ODRC 1RQ0A 2EOSA 2V88A 3HQ1A 3L00A 4JI0E 2EJ4A 2DMIA 2EM8A 2I9IA 2L8TA 1YFHA 1T4OA 1A1IA 5A2QC 2ELYA 4R2QA 1YYOA 4R03A 1YPNA 2LO3A 3MHHC 2HJJA 2YTJA 4DR6E 2VQEE 1SR9A 2EPLX 3BBGA 2DRPA 4B3ME 2UXBE 3VYYA 1X48A 2EN6A 4JI3E 2EM5A 2G7HA 4R2RA 2CPNA 1HNZE 5LLQA 2WBSA 4RH8A 1N32E 1J26A 4NXME 1GTKA 3J7AG 4LF4E 5KL7A 4R2AA 1IQOA 2L3CA 2FGGA 2L2MA 2DGCA 1A1LA 4HEIA 2YTEA 4WXCA 5A6BA 1T4NA 1X6HA 4LF7E 2YTQA 3C6MA 5TSEA 2EQ3A 2YTDA 4P7DA 1L4SA 3J7Yp 1SFEA 2EM4A 2LRSA 2M1SA 1P47A 1NEIA 5IXMB 2EOZA 4DV6E 5AC5A 2JOBA 3KWRA 4M30A 3ADGA 2EMGA 2EL5A 5A6JA 3MHSC 3C6KA 2EOEA 3JU0A 3OMLA 2ENHA 2EOFA 1PJQA 4LU9A 4JI1E 2RSMA 1YUJA 1PDAA 4X8WA 2UUBE 1F2IG 2LUQA 3EPLA 1N33E 1PJTA 1BB8A 2FTXB 2V89A 3M99B 2VF1A 1ZAAC 2EL4A 4L5NC 1EKZA 1TN9A 3ECRA 1WHNA 5CFFE 2V87A 2LBSB 1X47A 1DI2A 1J5EE 2EM2A 2R76A 4O43A 1G2DC 4Q35B 4F6NA 3OTOE 3VYXA 1PKPA 4TUIA 2D9HA 3ADJA 3LMLA 3HXLA 3EPJA 4J8ZA 2EMYA 1XNQE 1A1HA 4BC9A 4JI2E 1IMUA 4R2PA 5AE2A 1BBGA 3MSWA 2V8QB 2A25A 5KL6A 2NA2A 4DKKA 2B9DA 1HR0E 2ENAA 2EL6A 2Q8UA 2UU9E 1XMOE 4KZSA 2EPAA 4K0KE 4F9CB
chains in the Genus database with same CATH topology
3ZOQB 2JY9A 4DR1E 3C4BA 2G7HA 2NUFA 4JI3E 4BC7A 2LTRA 2CPNA 2WZOA 4DUYE 1HNZE 2V85A 1N32E 4DR2E 1HNXE 1J26A 2M4IA 1STUA 4NXME 4B3ME 4YY3E 4LF8E 2VE7C 4KHPE 1X49A 5IT9C 2DSYA 4LF4E 1YZ9A 2LE2A 3J7AG 4X64E 4LTYA 4NXNE 4X66E 3J81C 2F8BA 4DR3E 2L3CA 4DMIA 2FGGA 3HPSA 2L33A 2L2MA 1O0WA 2H36X 4BCAA 1T4NA 4LF7E 4JI5E 1XNRE 4GEQB 4X62E 2NUGA 5F3WA 3C4TA 4P7DA 4TUGA 3J7Yp 4LFAE 3P1XA 1YYKA 1FJGE 2LRSA 2M1SA 2B3TB 2UXCE 2UUCE 2MDRA 1FKAE 2V83A 4JYAE 1QU6A 4DV6E 2F4VE 4LF9E 2E1MA 4AQYE 1IBLE 2JOBA 4BMJA 3KWRA 4M30A 2DMYA 3ADGA 1ZBTA 4DV5E 2UUAE 2NUEA 2RS6A 1IBME 2KHXA 4X65E 4LF6E 3RMPA 5AASA 5FLXC 4DV4E 2L2NA 2V86A 2B7TA 2KOUA 2JWOA 2N3GA 3AUZA 3F6GA 2DB2A 2EWLA 3JU0A 3OMLA 1XMQE 4F9AB 5AE3A 5IWAE 3J80C 4DV0E 2JOXA 4LU9A 1WXRA 2L2KB 2RSMA 2B7VA 3LLHA 3T1YE 4JI1E 2EZ6A 3FIGA 4R8OA 2FV4B 4GKJE 4X8WA 1N36E 4LF5E 3HPZA 5LMUE 2LJHA 4JI8E 1UILA 2UUBE 3HTXA 2LUQA 2YZTA 3DJWA 4BS9A 1N33E 1IBKE 4YHHE 3IWDA 1WHQA 4DV3E 4B3TE 4DV1E 2FTXB 2V89A 3T1HE 2L92A 4WYQB 4Q28A 1UHZA 1GZ6A 2VF1A 2L3JA 4L5NC 1EKZA 2K4VA 4OOGC 4P78A 1YYWA 5ADZA 1WHNA 2N3HA 4GKKE 2DIXA 2YT4A 4DUZE 1N34E 4F54A 5CFFE 2M7QA 2ZM6E 5LL6R 4F9BB 2JR1A 4M2ZA 4DR4E 2L6MA 2V87A 2E5LE 2LBSB 4L8NA 1X47A 4DR7E 1DI2A 1I94E 1J5EE 5DNYA 1DQ3A 3JAMC 5LMNE 3DF6A 4WPYA 2HHHE 4JI4E 1GQEA 3VK6A 4JI7E 3OTOE 2VQFE 1ZBQA 4DV7E 1PKPA 3VYXA 2IHR1 5AE1A 3AV0A 4TUIA 3JTZA 4B3SE 4BBYA 2UXDE 2ODRC 4DR5E 2RTXA 3ADJA 3IWCA 4LFBE 1RQ0A 3ADLA 2MC6A 2V88A 3HXLA 3LMLA 4J8ZA 3HQ1A 1XNQE 2LMZA 3F6HA 3IWBA 4JI0E 4LFCE 2LUPB 2L8TA 4BC9A 4JI2E 4JI6E 2MC5A 3K6QA 5BR8E 2UXBE 5AE2A 1RC7A 4B3RE 1T4OA 3MSWA 2JVAA 2V8QB 5A2QC 4WFTA 2LTSA 1YYOA 2NA2A 4DKKA 4R03A 2B9DA 1HR0E 3ADIA 2ODRD 4DR6E 4OX9E 2VQEE 1T4LB 2KONA 1SR9A 2UU9E 3H09A 2RS7A 4I8OA 4M0VA 4WSPA 4DV2E 4KZSA 3VYYA 1X48A 1XMOE 5T6JA 4JV5E 1HNWE 4K0KE 4F9CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY9 A;  4DR1 E;  3C4B A;  2NUF A;  4JI3 E;  2LTR A;  2CPN A;  4DUY E;  1HNZ E;  1N32 E;  4DR2 E;  1HNX E;  1J26 A;  1STU A;  4NXM E;  4YY3 E;  4LF8 E;  1X49 A;  4LF4 E;  1YZ9 A;  4X64 E;  4NXN E;  4X66 E;  4DR3 E;  2L3C A;  2L33 A;  2L2M A;  1O0W A;  1T4N A;  4LF7 E;  4JI5 E;  1XNR E;  4X62 E;  2NUG A;  3C4T A;  3J7Y p;  4LFA E;  3P1X A;  1YYK A;  1FJG E;  2LRS A;  2B3T B;  2UXC E;  2UUC E;  2MDR A;  1FKA E;  1QU6 A;  4DV6 E;  2F4V E;  4LF9 E;  4AQY E;  1IBL E;  4DV5 E;  4M30 A;  2DMY A;  3ADG A;  1ZBT A;  2UUA E;  2NUE A;  2RS6 A;  1IBM E;  2KHX A;  4X65 E;  4LF6 E;  4DV4 E;  2L2N A;  2B7T A;  2N3G A;  1N34 E;  2DB2 A;  1XMQ E;  5IWA E;  4DV0 E;  2L2K B;  4JI1 E;  2EZ6 A;  3T1Y E;  2RSM A;  2B7V A;  3LLH A;  3HTX A;  4JYA E;  4KHP E;  4GKJ E;  4X8W A;  1N36 E;  4LF5 E;  5LMU E;  4JI8 E;  2LJH A;  1UIL A;  2UUB E;  2LUQ A;  1N33 E;  1IBK E;  4YHH E;  1WHQ A;  4DV3 E;  4B3T E;  4DV1 E;  3T1H E;  4WYQ B;  1UHZ A;  2L3J A;  1EKZ A;  4OOG C;  1YYW A;  1WHN A;  2N3H A;  4GKK E;  2DIX A;  2YT4 A;  4DUZ E;  5CFF E;  2ZM6 E;  4M2Z A;  4DR4 E;  2E5L E;  2LBS B;  1X47 A;  4DR7 E;  1DI2 A;  1I94 E;  1J5E E;  4JI4 E;  5LMN E;  2HHH E;  1GQE A;  3OTO E;  4JI7 E;  2VQF E;  3VYX A;  4DV7 E;  1PKP A;  2IHR 1;  4B3S E;  2UXD E;  4LFB E;  4DR5 E;  2RTX A;  3ADJ A;  1RQ0 A;  3ADL A;  1XNQ E;  4JI0 E;  4LFC E;  2LUP B;  4JI2 E;  4JI6 E;  5BR8 E;  4B3R E;  1RC7 A;  1T4O A;  2JVA A;  4WFT A;  2LTS A;  1YYO A;  2NA2 A;  4DKK A;  1HR0 E;  3ADI A;  4DR6 E;  4OX9 E;  2VQE E;  1T4L B;  2UU9 E;  2RS7 A;  4DV2 E;  1XMO E;  4B3M E;  4JV5 E;  1HNW E;  3VYY A;  1X48 A;  2UXB E;  4K0K E; 
#chains in the Genus database with same CATH topology
 3ZOQ B;  2EPC A;  2YPN A;  1A1G A;  1TF3 A;  2EM6 A;  4WX9 A;  2EMI A;  1HNX E;  3QG5 C;  2EOM A;  3BF2 A;  5IT9 C;  1X6E A;  2EPK X;  4X64 E;  4LTY A;  4X66 E;  4MLQ A;  4X9J A;  4O4K A;  1WRJ A;  4M9V C;  2EMW A;  2EN3 A;  4BCA A;  2EMB A;  2GPI A;  2NAB A;  2NUG A;  2VRD A;  1UBD C;  3BID A;  2EM7 A;  3P1X A;  2YTG A;  1FJG E;  1YUI A;  2UXC E;  2UUC E;  2MDR A;  3BGH A;  2F4V E;  2E1M A;  1IBL E;  4BMJ A;  4DV5 E;  1KYQ A;  1AH5 A;  2N8X A;  2KHX A;  4LF6 E;  4HTG A;  5FLX C;  4DV4 E;  2EQ0 A;  2L2N A;  2V86 A;  4F9A B;  4NHR A;  5AE3 A;  3J80 C;  1TF6 A;  2JOX A;  3T1Y E;  2B7V A;  2EM9 A;  3LLH A;  5KL4 A;  2EMF A;  4LF5 E;  3HPZ A;  2LJH A;  4JI8 E;  1UIL A;  3DJW A;  1IBK E;  2EMH A;  4DV1 E;  4MLV A;  2ADR A;  3UK3 C;  4WYQ B;  1GZ6 A;  2EM0 A;  1A1F A;  2CT1 A;  1YYW A;  1PJS A;  2DIX A;  2YT4 A;  2LJU A;  2YSO A;  4F54 A;  2ZM6 E;  2EMC A;  2EN1 A;  2MKN A;  2EOH A;  4L8N A;  1I94 E;  1A1K A;  1DQ3 A;  5LMN E;  3DF6 A;  4FK5 C;  4IS1 C;  1ZBQ A;  2M9A A;  4BHC A;  2JPA A;  1EH6 A;  5AC4 A;  4WSG A;  4LFB E;  2EMZ A;  1NCS A;  2LT7 A;  3EPH A;  2EPZ A;  1JK2 A;  2EMK A;  2LMZ A;  3F6H A;  2R1F A;  1AAY A;  4LFC E;  2MC5 A;  3K6Q A;  5BR8 E;  4B3R E;  2RPC A;  5KL3 A;  1RMD A;  4WFT A;  2LTS A;  2YTN A;  3ADI A;  1DGC A;  2EPX A;  4OX9 E;  1ZU1 A;  4WSP A;  4DV2 E;  2LV2 A;  4R2S A;  2LUP B;  4JI6 E;  2EZ6 A;  5T6J A;  1UN6 B;  2EE8 A;  5IV8 B;  2NUF A;  2ELZ A;  2EN7 A;  4KWY A;  2EOY A;  1BBO A;  2EPM X;  2LTR A;  2WZO A;  4DUY E;  2YRK A;  4R2C A;  4DR2 E;  2EOO A;  2M4I A;  3EPK A;  4YY3 E;  2EP3 A;  2VE7 C;  1X49 A;  1YZ9 A;  2LE2 A;  1YSA C;  4NXN E;  2EPR A;  3J81 C;  2F8B A;  4DMI A;  2LVH A;  4R2D A;  1XNR E;  4GEQ B;  4X62 E;  1EH8 A;  3C4T A;  4TUG A;  4LFA E;  2RQL A;  2WBT A;  2CSH A;  2EOX A;  2WBU A;  2V83 A;  1FKA E;  1QU6 A;  4LF9 E;  4AQY E;  2UUA E;  1ZBT A;  2EPO A;  2NUE A;  1IBM E;  4X65 E;  2EMX A;  2GLI A;  2B7T A;  2EOJ A;  2KOU A;  1X3C A;  3AUZ A;  3F6G A;  2YTF A;  2JYA A;  2EWL A;  1XMQ E;  1MEY C;  4DV0 E;  4JYA E;  4O24 A;  5LMU E;  2J7J A;  2YZT A;  3IWD A;  2MDG A;  2YRH A;  4B3T E;  4ZYE A;  1G2F C;  2L3J A;  2K4V A;  3TQM A;  3KZY A;  1X6F A;  3KZZ A;  4P78 A;  1Z1B A;  2HGH A;  5ADZ A;  2N3H A;  4GKK E;  2M7Q A;  4M2Z A;  1WJP A;  2EML A;  2EOI A;  2JR1 A;  5LL6 R;  4ZYG A;  2L6M A;  4N4R B;  2E5L E;  4DR4 E;  5A6K A;  4DR7 E;  3THO B;  4JI4 E;  3JAM C;  4WPY A;  2HHH E;  2EPN A;  4DV7 E;  2EOR A;  2IHR 1;  1QNT A;  3JTZ A;  2UXD E;  4BBY A;  4DR5 E;  2RTX A;  3IWC A;  2EOQ A;  4ZYD A;  3ADL A;  2EM3 A;  2MC6 A;  2EN4 A;  3IWB A;  4F2J C;  4BHB A;  1RC7 A;  1MGT A;  2JVA A;  5A69 A;  2E72 A;  2ODR D;  2YU8 A;  1T4L B;  2KON A;  5A6B D;  2DLQ A;  2CTD A;  2RS7 A;  3H09 A;  4I8O A;  1EH7 A;  4M0V A;  4JV5 E;  1HNW E;  2LCE A;  1KJK A;  2JY9 A;  4DR1 E;  3C4B A;  2EN8 A;  4BC7 A;  2GHF A;  1JK1 A;  2BB8 A;  2V85 A;  3VHT B;  1STU A;  2YWQ A;  2BBG A;  4LF8 E;  2DSY A;  1T39 A;  4F6M A;  2EN2 A;  2EQ1 A;  3EQ1 A;  2EMA A;  4DR3 E;  3HPS A;  2L33 A;  2YSP A;  1O0W A;  2H36 X;  1IQS A;  4JI5 E;  2PRT A;  5F3W A;  1YYK A;  4R2E A;  2B3T B;  2RSI A;  2WCC 3;  1N3G A;  2DMY A;  2YRM A;  2RS6 A;  2HC5 A;  2YTI A;  3RMP A;  5AAS A;  2N3G A;  2EPP A;  4ZYH A;  2JWO A;  1N34 E;  2DB2 A;  2JP9 A;  4NZV A;  5KL2 A;  4O5G A;  5IWA E;  2L2K B;  4KHP E;  1WXR A;  3HTX A;  3FIG A;  4R8O A;  2FV4 B;  4GZN C;  4GKJ E;  1N36 E;  2YTP A;  4IJD A;  4BS9 A;  5A6A A;  2MKD A;  4WXD A;  4YHH E;  2K7I A;  1WHQ A;  1ZR9 A;  4DV3 E;  3T1H E;  2L92 A;  5KL5 A;  1A1J A;  4Q28 A;  2I13 A;  1UHZ A;  4OOG C;  1LLM C;  2ENC A;  2JXP A;  4DUZ E;  1B69 A;  1X5W A;  4F9B B;  5DNY A;  1GQE A;  3VK6 A;  4JI7 E;  2VQF E;  2EPU A;  4RHB B;  2YU5 A;  2YTO A;  1T38 A;  2DLK A;  5AE1 A;  3AV0 A;  4B3S E;  3THN A;  2ODR C;  1RQ0 A;  2EOS A;  2V88 A;  3HQ1 A;  3L00 A;  4JI0 E;  2EJ4 A;  2DMI A;  2EM8 A;  2I9I A;  2L8T A;  1YFH A;  1T4O A;  1A1I A;  5A2Q C;  2ELY A;  4R2Q A;  1YYO A;  4R03 A;  1YPN A;  2LO3 A;  3MHH C;  2HJJ A;  2YTJ A;  4DR6 E;  2VQE E;  1SR9 A;  2EPL X;  3BBG A;  2DRP A;  4B3M E;  2UXB E;  3VYY A;  1X48 A;  2EN6 A;  4JI3 E;  2EM5 A;  2G7H A;  4R2R A;  2CPN A;  1HNZ E;  5LLQ A;  2WBS A;  4RH8 A;  1N32 E;  1J26 A;  4NXM E;  1GTK A;  3J7A G;  4LF4 E;  5KL7 A;  4R2A A;  1IQO A;  2L3C A;  2FGG A;  2L2M A;  2DGC A;  1A1L A;  4HEI A;  2YTE A;  4WXC A;  5A6B A;  1T4N A;  1X6H A;  4LF7 E;  2YTQ A;  3C6M A;  5TSE A;  2EQ3 A;  2YTD A;  4P7D A;  1L4S A;  3J7Y p;  1SFE A;  2EM4 A;  2LRS A;  2M1S A;  1P47 A;  1NEI A;  5IXM B;  2EOZ A;  4DV6 E;  5AC5 A;  2JOB A;  3KWR A;  4M30 A;  3ADG A;  2EMG A;  2EL5 A;  5A6J A;  3MHS C;  3C6K A;  2EOE A;  3JU0 A;  3OML A;  2ENH A;  2EOF A;  1PJQ A;  4LU9 A;  4JI1 E;  2RSM A;  1YUJ A;  1PDA A;  4X8W A;  2UUB E;  1F2I G;  2LUQ A;  3EPL A;  1N33 E;  1PJT A;  1BB8 A;  2FTX B;  2V89 A;  3M99 B;  2VF1 A;  1ZAA C;  2EL4 A;  4L5N C;  1EKZ A;  1TN9 A;  3ECR A;  1WHN A;  5CFF E;  2V87 A;  2LBS B;  1X47 A;  1DI2 A;  1J5E E;  2EM2 A;  2R76 A;  4O43 A;  1G2D C;  4Q35 B;  4F6N A;  3OTO E;  3VYX A;  1PKP A;  4TUI A;  2D9H A;  3ADJ A;  3LML A;  3HXL A;  3EPJ A;  4J8Z A;  2EMY A;  1XNQ E;  1A1H A;  4BC9 A;  4JI2 E;  1IMU A;  4R2P A;  5AE2 A;  1BBG A;  3MSW A;  2V8Q B;  2A25 A;  5KL6 A;  2NA2 A;  4DKK A;  2B9D A;  1HR0 E;  2ENA A;  2EL6 A;  2Q8U A;  2UU9 E;  1XMO E;  4KZS A;  2EPA A;  4K0K E;  4F9C B; 
#chains in the Genus database with same CATH homology
 3ZOQ B;  2JY9 A;  4DR1 E;  3C4B A;  2G7H A;  2NUF A;  4JI3 E;  4BC7 A;  2LTR A;  2CPN A;  2WZO A;  4DUY E;  1HNZ E;  2V85 A;  1N32 E;  4DR2 E;  1HNX E;  1J26 A;  2M4I A;  1STU A;  4NXM E;  4B3M E;  4YY3 E;  4LF8 E;  2VE7 C;  4KHP E;  1X49 A;  5IT9 C;  2DSY A;  4LF4 E;  1YZ9 A;  2LE2 A;  3J7A G;  4X64 E;  4LTY A;  4NXN E;  4X66 E;  3J81 C;  2F8B A;  4DR3 E;  2L3C A;  4DMI A;  2FGG A;  3HPS A;  2L33 A;  2L2M A;  1O0W A;  2H36 X;  4BCA A;  1T4N A;  4LF7 E;  4JI5 E;  1XNR E;  4GEQ B;  4X62 E;  2NUG A;  5F3W A;  3C4T A;  4P7D A;  4TUG A;  3J7Y p;  4LFA E;  3P1X A;  1YYK A;  1FJG E;  2LRS A;  2M1S A;  2B3T B;  2UXC E;  2UUC E;  2MDR A;  1FKA E;  2V83 A;  4JYA E;  1QU6 A;  4DV6 E;  2F4V E;  4LF9 E;  2E1M A;  4AQY E;  1IBL E;  2JOB A;  4BMJ A;  3KWR A;  4M30 A;  2DMY A;  3ADG A;  1ZBT A;  4DV5 E;  2UUA E;  2NUE A;  2RS6 A;  1IBM E;  2KHX A;  4X65 E;  4LF6 E;  3RMP A;  5AAS A;  5FLX C;  4DV4 E;  2L2N A;  2V86 A;  2B7T A;  2KOU A;  2JWO A;  2N3G A;  3AUZ A;  3F6G A;  2DB2 A;  2EWL A;  3JU0 A;  3OML A;  1XMQ E;  4F9A B;  5AE3 A;  5IWA E;  3J80 C;  4DV0 E;  2JOX A;  4LU9 A;  1WXR A;  2L2K B;  2RSM A;  2B7V A;  3LLH A;  3T1Y E;  4JI1 E;  2EZ6 A;  3FIG A;  4R8O A;  2FV4 B;  4GKJ E;  4X8W A;  1N36 E;  4LF5 E;  3HPZ A;  5LMU E;  2LJH A;  4JI8 E;  1UIL A;  2UUB E;  3HTX A;  2LUQ A;  2YZT A;  3DJW A;  4BS9 A;  1N33 E;  1IBK E;  4YHH E;  3IWD A;  1WHQ A;  4DV3 E;  4B3T E;  4DV1 E;  2FTX B;  2V89 A;  3T1H E;  2L92 A;  4WYQ B;  4Q28 A;  1UHZ A;  1GZ6 A;  2VF1 A;  2L3J A;  4L5N C;  1EKZ A;  2K4V A;  4OOG C;  4P78 A;  1YYW A;  5ADZ A;  1WHN A;  2N3H A;  4GKK E;  2DIX A;  2YT4 A;  4DUZ E;  1N34 E;  4F54 A;  5CFF E;  2M7Q A;  2ZM6 E;  5LL6 R;  4F9B B;  2JR1 A;  4M2Z A;  4DR4 E;  2L6M A;  2V87 A;  2E5L E;  2LBS B;  4L8N A;  1X47 A;  4DR7 E;  1DI2 A;  1I94 E;  1J5E E;  5DNY A;  1DQ3 A;  3JAM C;  5LMN E;  3DF6 A;  4WPY A;  2HHH E;  4JI4 E;  1GQE A;  3VK6 A;  4JI7 E;  3OTO E;  2VQF E;  1ZBQ A;  4DV7 E;  1PKP A;  3VYX A;  2IHR 1;  5AE1 A;  3AV0 A;  4TUI A;  3JTZ A;  4B3S E;  4BBY A;  2UXD E;  2ODR C;  4DR5 E;  2RTX A;  3ADJ A;  3IWC A;  4LFB E;  1RQ0 A;  3ADL A;  2MC6 A;  2V88 A;  3HXL A;  3LML A;  4J8Z A;  3HQ1 A;  1XNQ E;  2LMZ A;  3F6H A;  3IWB A;  4JI0 E;  4LFC E;  2LUP B;  2L8T A;  4BC9 A;  4JI2 E;  4JI6 E;  2MC5 A;  3K6Q A;  5BR8 E;  2UXB E;  5AE2 A;  1RC7 A;  4B3R E;  1T4O A;  3MSW A;  2JVA A;  2V8Q B;  5A2Q C;  4WFT A;  2LTS A;  1YYO A;  2NA2 A;  4DKK A;  4R03 A;  2B9D A;  1HR0 E;  3ADI A;  2ODR D;  4DR6 E;  4OX9 E;  2VQE E;  1T4L B;  2KON A;  1SR9 A;  2UU9 E;  3H09 A;  2RS7 A;  4I8O A;  4M0V A;  4WSP A;  4DV2 E;  4KZS A;  3VYY A;  1X48 A;  1XMO E;  5T6J A;  4JV5 E;  1HNW E;  4K0K E;  4F9C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...