1X6EA

Solution structures of the c2h2 type zinc finger domain of human zinc finger protein 24
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
GSSGSSGIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Zinc finger protein 24
publication title Solution structures of the C2H2 type zinc finger domain of human Zinc finger protein 24
rcsb
source organism Homo sapiens
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6eA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6eA02
4M9VC 2EM4A 1TF6A 2WCC3 2EMYA 2EQ3A 2DLQA 2YTEA 2LT7A 2EMZA 2EPUA 2E72A 1A1HA 2EMAA 4GZNC 2EM9A 1A1KA 1YUIA 2YTOA 1A1FA 2EMXA 2YSPA 3MHHC 2EN3A 2EOEA 2EN7A 3VHTB 3EPKA 1UN6B 1B69A 2NABA 3EPJA 1F2IG 2YTIA 1X6EA 1ZR9A 2EOZA 2EN1A 2CTDA 2VRDA 2EM8A 1X3CA 1JK1A 1A1JA 3EPHA 2EL5A 4IS1C 2EL6A 2EOOA 2LCEA 1TF3A 1ZAAC 2EL4A 4R2DA 2MKNA 2EN8A 1ZU1A 2EM5A 4FK5C 1DGCA 2M9AA 5KL6A 4F2JC 2PRTA 1RMDA 2LV2A 2EM2A 2EJ4A 1BBOA 2EMIA 2YTFA 2EM7A 2EMLA 2EPCA 1A1IA 2ELZA 2EN4A 2YU5A 2EPXA 2DLKA 1X6FA 2EOFA 2EOYA 2MKDA 2EOHA 2EORA 1A1LA 2HGHA 1KJKA 2YSOA 2YTJA 2EOJA 4IJDA 1P47A 3EPLA 2BB8A 1MEYC 4R2QA 4R2AA 2JP9A 2YRHA 2EMHA 4R2RA 2EOXA 1YSAC 2YTQA 5KL4A 2EMBA 1G2DC 2ENAA 1X6HA 2YTDA 1WJPA 2I13A 2RSIA 2A25A 2EPPA 2YTGA 2EMCA 1TN9A 5KL3A 2JPAA 2EOMA 4R2SA 2DMIA 5KL7A 1X5WA 4R2CA 5KL2A 4R2EA 2LO3A 2EN6A 2CT1A 2EPZA 2YRMA 1Z1BA 2J7JA 2R1FA 1UBDC 2WBUA 4R2PA 2EQ0A 2ENHA 2YU8A 2DGCA 1NCSA 2EMGA 2YRKA 2RPCA 2EN2A 4F6NA 3MHSC 2CSHA 2YTNA 2GHFA 2WBSA 2D9HA 5KL5A 2ENCA 2EP3A 1AAYA 1LLMC 2ADRA 2EPRA 1BB8A 2EMFA 2EPAA 2YTPA 2EMKA 2MDGA 2DRPA 4WSGA 2ELYA 1YUJA 1A1GA 2WBTA 3UK3C 2GLIA 2EM6A 2EM3A 3M99B 2LVHA 2EQ1A 2EOQA 2EOSA 1JK2A 1G2FC 2EE8A 4X9JA 2EM0A 2EMWA 4F6MA 2EOIA
chains in the Genus database with same CATH superfamily
4LU9A 2EM4A 2EPMX 2LE2A 2B7TA 3KZYA 4M2ZA 2YTEA 3ZOQB 2RQLA 4GZNC 1YFHA 1YUIA 1A1FA 2YSPA 4MLVA 2EN7A 3VHTB 1I94E 4BC7A 2KOUA 1F2IG 2NUGA 1EH7A 1ZR9A 2EOZA 2F8BA 4R03A 2VRDA 3C6KA 2K4VA 3C6MA 4O5GA 2EL5A 4JI3E 3EQ1A 2EL6A 2V83A 1AH5A 2EL4A 2B7VA 4DKKA 5A6BD 3C4TA 4X66E 2LJHA 4HEIA 1RC7A 2EPLX 4FK5C 2E1MA 3HPZA 5AC4A 2EWLA 5F3WA 4DV2E 2EMIA 4DV7E 2EMLA 2EPCA 2JYAA 3J81C 2HJJA 1XMQE 3HQ1A 3K6QA 3IWCA 2HGHA 4DV5E 2LUPB 5CFFE 2MC6A 2NA2A 4LF5E 2MDRA 1EH8A 4LFCE 2L2KB 4DMIA 2DB2A 4R2QA 2EMHA 3JTZA 4WPYA 4BHCA 1X49A 5KL4A 2UXCE 4B3SE 3HXLA 4JI7E 2JXPA 4R8OA 2YTGA 1IBKE 1ZBQA 4DR2E 1XMOE 1YYOA 2DMIA 2M4IA 5KL7A 2HHHE 2CT1A 2M1SA 1HR0E 2L33A 1WXRA 4WX9A 3BF2A 5AE1A 4WFTA 3VK6A 5AE2A 4WSPA 4BC9A 1HNWE 2YT4A 2ZM6E 2ENCA 3TQMA 2EPRA 1N33E 3RMPA 2YTPA 4N4RB 2DRPA 2ELYA 2MC5A 2EM6A 3FIGA 2EM3A 2I9IA 1WHQA 5LLQA 2EQ1A 2EOQA 2RS6A 1G2FC 5BR8E 4I8OA 2VF1A 1T4NA 4YHHE 4AQYE 2WCC3 5T6JA 2LUQA 2EMZA 1A1HA 1N3GA 1BBGA 3MHHC 2YZTA 4X62E 3C4BA 3EPJA 1N32E 2YTIA 2N3GA 2EPNA 2M7QA 1IQSA 5DNYA 4JI2E 1JK1A 1A1JA 3AUZA 2EPKX 3LLHA 2L6MA 2LCEA 1ZAAC 3MSWA 5LL6R 2MKNA 2EN8A 1ZU1A 2EM5A 3DJWA 1PDAA 1STUA 5KL6A 2N8XA 3LMLA 4GEQB 2YTFA 2EM7A 3F6GA 4B3ME 1X6FA 3H09A 2MKDA 4LFBE 2EOHA 2N3HA 1A1LA 4GKJE 2DMYA 4DUZE 4JI6E 1P47A 2LMZA 4LF8E 2V89A 1MEYC 2WZOA 4WXCA 4ZYHA 2VQEE 4R2AA 4DV1E 2KHXA 2RTXA 4R2RA 1SR9A 5A6JA 2EOXA 4HTGA 3DF6A 2EMBA 4DR4E 2YTDA 2ODRC 4BCAA 1WJPA 2I13A 2A25A 2EPPA 2IHR1 4DV4E 2V85A 5KL3A 2VE7C 4R2SA 1X5WA 5KL2A 4R2EA 2LO3A 4X65E 2ODRD 1YYWA 2V86A 1YPNA 2YRMA 4LTYA 2WBUA 2H36X 2EQ0A 4R2PA 3KWRA 2ENHA 2YU8A 2DGCA 1NCSA 2EN2A 2L2MA 3MHSC 2YTNA 2GHFA 4ZYEA 2D9HA 4KZSA 2EP3A 4RHBB 4NXME 3J80C 2JY9A 4P78A 2EMFA 1GTKA 2KONA 2EPAA 1T4LB 1WHNA 2LJUA 3F6HA 2L3CA 1A1GA 1UILA 4L8NA 4M0VA 3T1HE 3M99B 3THOB 2LTSA 2LVHA 1SFEA 4DV0E 4F9AB 3AV0A 2EOSA 4Q28A 4M30A 1YZ9A 2EMWA 1IBLE 2EOIA 4M9VC 4O43A 1NEIA 2EQ3A 2DLQA 4P7DA 4K0KE 2EMAA 1GQEA 5IV8B 2JOXA 2EMXA 2EOEA 1UN6B 4DV6E 3EPKA 2NABA 2EN1A 3OTOE 2UUCE 2CTDA 2EM8A 3EPHA 4B3RE 1T4OA 2EOOA 1TF3A 4LF7E 3L00A 5A69A 4KHPE 3ECRA 2NUEA 3JU0A 2LBSB 2M9AA 4F2JC 2PRTA 2LV2A 2EM2A 3BGHA 1ZBTA 1A1IA 2EN4A 2YU5A 4DR3E 2EPXA 2DLKA 1WRJA 2EOFA 4DUYE 2EOYA 1DI2A 1KJKA 1XNRE 2JOBA 2YTJA 2EOJA 1YYKA 2BB8A 2JWOA 5A2QC 2FTXB 2JR1A 2JP9A 2YRHA 4TUIA 4JV5E 4JI5E 5TSEA 1RQ0A 2UUBE 4DR7E 1IBME 2YWQA 2YTQA 1O0WA 1IQOA 2JVAA 4WYQB 1G2DC 5A6AA 1X6HA 2UXDE 3ADIA 1KYQA 4TUGA 4LF6E 2L92A 1GZ6A 3BBGA 2EMCA 1PKPA 2V88A 2G7HA 3QG5C 3KZZA 3HTXA 4YY3E 2R1FA 2FV4B 4DV3E 1FJGE 4WXDA 4JI0E 4JI4E 2YRKA 4F54A 2RPCA 2LRSA 1J5EE 5KL5A 1LLMC 1BB8A 3JAMC 4J8ZA 2Q8UA 5AE3A 4ZYDA 3HPSA 1YUJA 2UUAE 2WBTA 2GLIA 3P1XA 1T38A 1JK2A 1X47A 2L2NA 4X9JA 3THNA 4JYAE 4NZVA 2EZ6A 3VYYA 5FLXC 3ADJA 1TF6A 1IMUA 1T39A 2EMYA 2LT7A 2EPUA 2E72A 2EM9A 1A1KA 4O4KA 2V8QB 3J7AG 4X64E 4L5NC 2YTOA 3T1YE 1N34E 2CPNA 4LF4E 3ADLA 2EN3A 4NXNE 4BBYA 2B9DA 4DR5E 1B69A 3OMLA 1FKAE 2L3JA 1X6EA 4DR1E 2NUFA 1X3CA 1PJTA 5IT9C 4IS1C 2F4VE 1EH6A 1DQ3A 5IXMB 4R2DA 4LF9E 2DSYA 2K7IA 1DGCA 2DIXA 1PJSA 4ZYGA 1RMDA 2EJ4A 3IWDA 1BBOA 4RH8A 1HNZE 2ELZA 2FGGA 1X48A 5LMUE 2R76A 4JI8E 2HC5A 3IWBA 1MGTA 4B3TE 2EORA 2UXBE 4BHBA 5IWAE 4GKKE 1L4SA 2YSOA 2YPNA 4IJDA 4NHRA 4OOGC 1UHZA 4LFAE 3EPLA 4X8WA 5A6KA 2RS7A 2GPIA 3BIDA 1YSAC 2E5LE 2ENAA 2B3TB 4JI1E 3VYXA 4KWYA 1J26A 2EPOA 2RSIA 2V87A 1QU6A 1TN9A 2JPAA 3J7Yp 2UU9E 2EOMA 2RSMA 5AC5A 4R2CA 2EN6A 2EPZA 5AASA 1Z1BA 5LMNE 4F9CB 2J7JA 1N36E 1UBDC 1PJQA 4OX9E 2EMGA 4F6NA 2CSHA 2WBSA 2VQFE 2LTRA 1AAYA 1HNXE 2ADRA 3ADGA 5ADZA 2EMKA 2MDGA 4WSGA 4F9BB 3UK3C 4BMJA 4BS9A 4O24A 4Q35B 2BBGA 2EE8A 4DR6E 5A6BA 2EM0A 1QNTA 4MLQA 4F6MA 1XNQE 2L8TA 1EKZA
chains in the Genus database with same CATH topology
4M9VC 2EM4A 1TF6A 2WCC3 2EMYA 2EQ3A 2DLQA 2YTEA 2LT7A 2EMZA 2EPUA 2E72A 1A1HA 2EMAA 4GZNC 2EM9A 1A1KA 1YUIA 2YTOA 1A1FA 2EMXA 2YSPA 3MHHC 2EN3A 2EOEA 2EN7A 3VHTB 3EPKA 1UN6B 1B69A 2NABA 3EPJA 1F2IG 2YTIA 1X6EA 1ZR9A 2EOZA 2EN1A 2CTDA 2VRDA 2EM8A 1X3CA 1JK1A 1A1JA 3EPHA 2EL5A 4IS1C 2EL6A 2EOOA 2LCEA 1TF3A 1ZAAC 2EL4A 4R2DA 2MKNA 2EN8A 1ZU1A 2EM5A 4FK5C 1DGCA 2M9AA 5KL6A 4F2JC 2PRTA 1RMDA 2LV2A 2EM2A 2EJ4A 1BBOA 2EMIA 2YTFA 2EM7A 2EMLA 2EPCA 1A1IA 2ELZA 2EN4A 2YU5A 2EPXA 2DLKA 1X6FA 2EOFA 2EOYA 2MKDA 2EOHA 2EORA 1A1LA 2HGHA 1KJKA 2YSOA 2YTJA 2EOJA 4IJDA 1P47A 3EPLA 2BB8A 1MEYC 4R2QA 4R2AA 2JP9A 2YRHA 2EMHA 4R2RA 2EOXA 1YSAC 2YTQA 5KL4A 2EMBA 1G2DC 2ENAA 1X6HA 2YTDA 1WJPA 2I13A 2RSIA 2A25A 2EPPA 2YTGA 2EMCA 1TN9A 5KL3A 2JPAA 2EOMA 4R2SA 2DMIA 5KL7A 1X5WA 4R2CA 5KL2A 4R2EA 2LO3A 2EN6A 2CT1A 2EPZA 2YRMA 1Z1BA 2J7JA 2R1FA 1UBDC 2WBUA 4R2PA 2EQ0A 2ENHA 2YU8A 2DGCA 1NCSA 2EMGA 2YRKA 2RPCA 2EN2A 4F6NA 3MHSC 2CSHA 2YTNA 2GHFA 2WBSA 2D9HA 5KL5A 2ENCA 2EP3A 1AAYA 1LLMC 2ADRA 2EPRA 1BB8A 2EMFA 2EPAA 2YTPA 2EMKA 2MDGA 2DRPA 4WSGA 2ELYA 1YUJA 1A1GA 2WBTA 3UK3C 2GLIA 2EM6A 2EM3A 3M99B 2LVHA 2EQ1A 2EOQA 2EOSA 1JK2A 1G2FC 2EE8A 4X9JA 2EM0A 2EMWA 4F6MA 2EOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9V C;  2EM4 A;  1TF6 A;  2WCC 3;  2EMY A;  2EQ3 A;  2DLQ A;  2YTE A;  2LT7 A;  2EMZ A;  2EPU A;  2E72 A;  1A1H A;  2EMA A;  4GZN C;  2EM9 A;  1A1K A;  1YUI A;  2YTO A;  1A1F A;  2EMX A;  2YSP A;  3MHH C;  2EN3 A;  2EOE A;  2EN7 A;  3VHT B;  3EPK A;  1UN6 B;  1B69 A;  2NAB A;  3EPJ A;  1F2I G;  2YTI A;  1X6E A;  1ZR9 A;  2EOZ A;  2EN1 A;  2CTD A;  2VRD A;  2EM8 A;  1X3C A;  1JK1 A;  1A1J A;  3EPH A;  2EL5 A;  4IS1 C;  2EL6 A;  2EOO A;  2LCE A;  1TF3 A;  1ZAA C;  2EL4 A;  4R2D A;  2MKN A;  2EN8 A;  1ZU1 A;  2EM5 A;  4FK5 C;  1DGC A;  2M9A A;  5KL6 A;  4F2J C;  2PRT A;  1RMD A;  2LV2 A;  2EM2 A;  2EJ4 A;  1BBO A;  2EMI A;  2YTF A;  2EM7 A;  2EML A;  2EPC A;  1A1I A;  2ELZ A;  2EN4 A;  2YU5 A;  2EPX A;  2DLK A;  1X6F A;  2EOF A;  2EOY A;  2MKD A;  2EOH A;  2EOR A;  1A1L A;  2HGH A;  1KJK A;  2YSO A;  2YTJ A;  2EOJ A;  4IJD A;  1P47 A;  3EPL A;  2BB8 A;  1MEY C;  4R2Q A;  4R2A A;  2JP9 A;  2YRH A;  2EMH A;  4R2R A;  2EOX A;  1YSA C;  2YTQ A;  5KL4 A;  2EMB A;  1G2D C;  2ENA A;  1X6H A;  2YTD A;  1WJP A;  2I13 A;  2RSI A;  2A25 A;  2EPP A;  2YTG A;  2EMC A;  1TN9 A;  5KL3 A;  2JPA A;  2EOM A;  4R2S A;  2DMI A;  5KL7 A;  1X5W A;  4R2C A;  5KL2 A;  4R2E A;  2LO3 A;  2EN6 A;  2CT1 A;  2EPZ A;  2YRM A;  1Z1B A;  2J7J A;  2R1F A;  1UBD C;  2WBU A;  4R2P A;  2EQ0 A;  2ENH A;  2YU8 A;  2DGC A;  1NCS A;  2EMG A;  2YRK A;  2RPC A;  2EN2 A;  4F6N A;  3MHS C;  2CSH A;  2YTN A;  2GHF A;  2WBS A;  2D9H A;  5KL5 A;  2ENC A;  2EP3 A;  1AAY A;  1LLM C;  2ADR A;  2EPR A;  1BB8 A;  2EMF A;  2EPA A;  2YTP A;  2EMK A;  2MDG A;  2DRP A;  4WSG A;  2ELY A;  1YUJ A;  1A1G A;  2WBT A;  3UK3 C;  2GLI A;  2EM6 A;  2EM3 A;  3M99 B;  2LVH A;  2EQ1 A;  2EOQ A;  2EOS A;  1JK2 A;  1G2F C;  2EE8 A;  4X9J A;  2EM0 A;  2EMW A;  4F6M A;  2EOI A; 
#chains in the Genus database with same CATH topology
 4LU9 A;  2EM4 A;  2EPM X;  2LE2 A;  2B7T A;  3KZY A;  4M2Z A;  2YTE A;  3ZOQ B;  2RQL A;  4GZN C;  1YFH A;  1YUI A;  1A1F A;  2YSP A;  4MLV A;  2EN7 A;  3VHT B;  1I94 E;  4BC7 A;  2KOU A;  1F2I G;  2NUG A;  1EH7 A;  1ZR9 A;  2EOZ A;  2F8B A;  4R03 A;  2VRD A;  3C6K A;  2K4V A;  3C6M A;  4O5G A;  2EL5 A;  4JI3 E;  3EQ1 A;  2EL6 A;  2V83 A;  1AH5 A;  2EL4 A;  2B7V A;  4DKK A;  5A6B D;  3C4T A;  4X66 E;  2LJH A;  4HEI A;  1RC7 A;  2EPL X;  4FK5 C;  2E1M A;  3HPZ A;  5AC4 A;  2EWL A;  5F3W A;  4DV2 E;  2EMI A;  4DV7 E;  2EML A;  2EPC A;  2JYA A;  3J81 C;  2HJJ A;  1XMQ E;  3HQ1 A;  3K6Q A;  3IWC A;  2HGH A;  4DV5 E;  2LUP B;  5CFF E;  2MC6 A;  2NA2 A;  4LF5 E;  2MDR A;  1EH8 A;  4LFC E;  2L2K B;  4DMI A;  2DB2 A;  4R2Q A;  2EMH A;  3JTZ A;  4WPY A;  4BHC A;  1X49 A;  5KL4 A;  2UXC E;  4B3S E;  3HXL A;  4JI7 E;  2JXP A;  4R8O A;  2YTG A;  1IBK E;  1ZBQ A;  4DR2 E;  1XMO E;  1YYO A;  2DMI A;  2M4I A;  5KL7 A;  2HHH E;  2CT1 A;  2M1S A;  1HR0 E;  2L33 A;  1WXR A;  4WX9 A;  3BF2 A;  5AE1 A;  4WFT A;  3VK6 A;  5AE2 A;  4WSP A;  4BC9 A;  1HNW E;  2YT4 A;  2ZM6 E;  2ENC A;  3TQM A;  2EPR A;  1N33 E;  3RMP A;  2YTP A;  4N4R B;  2DRP A;  2ELY A;  2MC5 A;  2EM6 A;  3FIG A;  2EM3 A;  2I9I A;  1WHQ A;  5LLQ A;  2EQ1 A;  2EOQ A;  2RS6 A;  1G2F C;  5BR8 E;  4I8O A;  2VF1 A;  1T4N A;  4YHH E;  4AQY E;  2WCC 3;  5T6J A;  2LUQ A;  2EMZ A;  1A1H A;  1N3G A;  1BBG A;  3MHH C;  2YZT A;  4X62 E;  3C4B A;  3EPJ A;  1N32 E;  2YTI A;  2N3G A;  2EPN A;  2M7Q A;  1IQS A;  5DNY A;  4JI2 E;  1JK1 A;  1A1J A;  3AUZ A;  2EPK X;  3LLH A;  2L6M A;  2LCE A;  1ZAA C;  3MSW A;  5LL6 R;  2MKN A;  2EN8 A;  1ZU1 A;  2EM5 A;  3DJW A;  1PDA A;  1STU A;  5KL6 A;  2N8X A;  3LML A;  4GEQ B;  2YTF A;  2EM7 A;  3F6G A;  4B3M E;  1X6F A;  3H09 A;  2MKD A;  4LFB E;  2EOH A;  2N3H A;  1A1L A;  4GKJ E;  2DMY A;  4DUZ E;  4JI6 E;  1P47 A;  2LMZ A;  4LF8 E;  2V89 A;  1MEY C;  2WZO A;  4WXC A;  4ZYH A;  2VQE E;  4R2A A;  4DV1 E;  2KHX A;  2RTX A;  4R2R A;  1SR9 A;  5A6J A;  2EOX A;  4HTG A;  3DF6 A;  2EMB A;  4DR4 E;  2YTD A;  2ODR C;  4BCA A;  1WJP A;  2I13 A;  2A25 A;  2EPP A;  2IHR 1;  4DV4 E;  2V85 A;  5KL3 A;  2VE7 C;  4R2S A;  1X5W A;  5KL2 A;  4R2E A;  2LO3 A;  4X65 E;  2ODR D;  1YYW A;  2V86 A;  1YPN A;  2YRM A;  4LTY A;  2WBU A;  2H36 X;  2EQ0 A;  4R2P A;  3KWR A;  2ENH A;  2YU8 A;  2DGC A;  1NCS A;  2EN2 A;  2L2M A;  3MHS C;  2YTN A;  2GHF A;  4ZYE A;  2D9H A;  4KZS A;  2EP3 A;  4RHB B;  4NXM E;  3J80 C;  2JY9 A;  4P78 A;  2EMF A;  1GTK A;  2KON A;  2EPA A;  1T4L B;  1WHN A;  2LJU A;  3F6H A;  2L3C A;  1A1G A;  1UIL A;  4L8N A;  4M0V A;  3T1H E;  3M99 B;  3THO B;  2LTS A;  2LVH A;  1SFE A;  4DV0 E;  4F9A B;  3AV0 A;  2EOS A;  4Q28 A;  4M30 A;  1YZ9 A;  2EMW A;  1IBL E;  2EOI A;  4M9V C;  4O43 A;  1NEI A;  2EQ3 A;  2DLQ A;  4P7D A;  4K0K E;  2EMA A;  1GQE A;  5IV8 B;  2JOX A;  2EMX A;  2EOE A;  1UN6 B;  4DV6 E;  3EPK A;  2NAB A;  2EN1 A;  3OTO E;  2UUC E;  2CTD A;  2EM8 A;  3EPH A;  4B3R E;  1T4O A;  2EOO A;  1TF3 A;  4LF7 E;  3L00 A;  5A69 A;  4KHP E;  3ECR A;  2NUE A;  3JU0 A;  2LBS B;  2M9A A;  4F2J C;  2PRT A;  2LV2 A;  2EM2 A;  3BGH A;  1ZBT A;  1A1I A;  2EN4 A;  2YU5 A;  4DR3 E;  2EPX A;  2DLK A;  1WRJ A;  2EOF A;  4DUY E;  2EOY A;  1DI2 A;  1KJK A;  1XNR E;  2JOB A;  2YTJ A;  2EOJ A;  1YYK A;  2BB8 A;  2JWO A;  5A2Q C;  2FTX B;  2JR1 A;  2JP9 A;  2YRH A;  4TUI A;  4JV5 E;  4JI5 E;  5TSE A;  1RQ0 A;  2UUB E;  4DR7 E;  1IBM E;  2YWQ A;  2YTQ A;  1O0W A;  1IQO A;  2JVA A;  4WYQ B;  1G2D C;  5A6A A;  1X6H A;  2UXD E;  3ADI A;  1KYQ A;  4TUG A;  4LF6 E;  2L92 A;  1GZ6 A;  3BBG A;  2EMC A;  1PKP A;  2V88 A;  2G7H A;  3QG5 C;  3KZZ A;  3HTX A;  4YY3 E;  2R1F A;  2FV4 B;  4DV3 E;  1FJG E;  4WXD A;  4JI0 E;  4JI4 E;  2YRK A;  4F54 A;  2RPC A;  2LRS A;  1J5E E;  5KL5 A;  1LLM C;  1BB8 A;  3JAM C;  4J8Z A;  2Q8U A;  5AE3 A;  4ZYD A;  3HPS A;  1YUJ A;  2UUA E;  2WBT A;  2GLI A;  3P1X A;  1T38 A;  1JK2 A;  1X47 A;  2L2N A;  4X9J A;  3THN A;  4JYA E;  4NZV A;  2EZ6 A;  3VYY A;  5FLX C;  3ADJ A;  1TF6 A;  1IMU A;  1T39 A;  2EMY A;  2LT7 A;  2EPU A;  2E72 A;  2EM9 A;  1A1K A;  4O4K A;  2V8Q B;  3J7A G;  4X64 E;  4L5N C;  2YTO A;  3T1Y E;  1N34 E;  2CPN A;  4LF4 E;  3ADL A;  2EN3 A;  4NXN E;  4BBY A;  2B9D A;  4DR5 E;  1B69 A;  3OML A;  1FKA E;  2L3J A;  1X6E A;  4DR1 E;  2NUF A;  1X3C A;  1PJT A;  5IT9 C;  4IS1 C;  2F4V E;  1EH6 A;  1DQ3 A;  5IXM B;  4R2D A;  4LF9 E;  2DSY A;  2K7I A;  1DGC A;  2DIX A;  1PJS A;  4ZYG A;  1RMD A;  2EJ4 A;  3IWD A;  1BBO A;  4RH8 A;  1HNZ E;  2ELZ A;  2FGG A;  1X48 A;  5LMU E;  2R76 A;  4JI8 E;  2HC5 A;  3IWB A;  1MGT A;  4B3T E;  2EOR A;  2UXB E;  4BHB A;  5IWA E;  4GKK E;  1L4S A;  2YSO A;  2YPN A;  4IJD A;  4NHR A;  4OOG C;  1UHZ A;  4LFA E;  3EPL A;  4X8W A;  5A6K A;  2RS7 A;  2GPI A;  3BID A;  1YSA C;  2E5L E;  2ENA A;  2B3T B;  4JI1 E;  3VYX A;  4KWY A;  1J26 A;  2EPO A;  2RSI A;  2V87 A;  1QU6 A;  1TN9 A;  2JPA A;  3J7Y p;  2UU9 E;  2EOM A;  2RSM A;  5AC5 A;  4R2C A;  2EN6 A;  2EPZ A;  5AAS A;  1Z1B A;  5LMN E;  4F9C B;  2J7J A;  1N36 E;  1UBD C;  1PJQ A;  4OX9 E;  2EMG A;  4F6N A;  2CSH A;  2WBS A;  2VQF E;  2LTR A;  1AAY A;  1HNX E;  2ADR A;  3ADG A;  5ADZ A;  2EMK A;  2MDG A;  4WSG A;  4F9B B;  3UK3 C;  4BMJ A;  4BS9 A;  4O24 A;  4Q35 B;  2BBG A;  2EE8 A;  4DR6 E;  5A6B A;  2EM0 A;  1QNT A;  4MLQ A;  4F6M A;  1XNQ E;  2L8T A;  1EKZ A; 
#chains in the Genus database with same CATH homology
 4M9V C;  2EM4 A;  1TF6 A;  2WCC 3;  2EMY A;  2EQ3 A;  2DLQ A;  2YTE A;  2LT7 A;  2EMZ A;  2EPU A;  2E72 A;  1A1H A;  2EMA A;  4GZN C;  2EM9 A;  1A1K A;  1YUI A;  2YTO A;  1A1F A;  2EMX A;  2YSP A;  3MHH C;  2EN3 A;  2EOE A;  2EN7 A;  3VHT B;  3EPK A;  1UN6 B;  1B69 A;  2NAB A;  3EPJ A;  1F2I G;  2YTI A;  1X6E A;  1ZR9 A;  2EOZ A;  2EN1 A;  2CTD A;  2VRD A;  2EM8 A;  1X3C A;  1JK1 A;  1A1J A;  3EPH A;  2EL5 A;  4IS1 C;  2EL6 A;  2EOO A;  2LCE A;  1TF3 A;  1ZAA C;  2EL4 A;  4R2D A;  2MKN A;  2EN8 A;  1ZU1 A;  2EM5 A;  4FK5 C;  1DGC A;  2M9A A;  5KL6 A;  4F2J C;  2PRT A;  1RMD A;  2LV2 A;  2EM2 A;  2EJ4 A;  1BBO A;  2EMI A;  2YTF A;  2EM7 A;  2EML A;  2EPC A;  1A1I A;  2ELZ A;  2EN4 A;  2YU5 A;  2EPX A;  2DLK A;  1X6F A;  2EOF A;  2EOY A;  2MKD A;  2EOH A;  2EOR A;  1A1L A;  2HGH A;  1KJK A;  2YSO A;  2YTJ A;  2EOJ A;  4IJD A;  1P47 A;  3EPL A;  2BB8 A;  1MEY C;  4R2Q A;  4R2A A;  2JP9 A;  2YRH A;  2EMH A;  4R2R A;  2EOX A;  1YSA C;  2YTQ A;  5KL4 A;  2EMB A;  1G2D C;  2ENA A;  1X6H A;  2YTD A;  1WJP A;  2I13 A;  2RSI A;  2A25 A;  2EPP A;  2YTG A;  2EMC A;  1TN9 A;  5KL3 A;  2JPA A;  2EOM A;  4R2S A;  2DMI A;  5KL7 A;  1X5W A;  4R2C A;  5KL2 A;  4R2E A;  2LO3 A;  2EN6 A;  2CT1 A;  2EPZ A;  2YRM A;  1Z1B A;  2J7J A;  2R1F A;  1UBD C;  2WBU A;  4R2P A;  2EQ0 A;  2ENH A;  2YU8 A;  2DGC A;  1NCS A;  2EMG A;  2YRK A;  2RPC A;  2EN2 A;  4F6N A;  3MHS C;  2CSH A;  2YTN A;  2GHF A;  2WBS A;  2D9H A;  5KL5 A;  2ENC A;  2EP3 A;  1AAY A;  1LLM C;  2ADR A;  2EPR A;  1BB8 A;  2EMF A;  2EPA A;  2YTP A;  2EMK A;  2MDG A;  2DRP A;  4WSG A;  2ELY A;  1YUJ A;  1A1G A;  2WBT A;  3UK3 C;  2GLI A;  2EM6 A;  2EM3 A;  3M99 B;  2LVH A;  2EQ1 A;  2EOQ A;  2EOS A;  1JK2 A;  1G2F C;  2EE8 A;  4X9J A;  2EM0 A;  2EMW A;  4F6M A;  2EOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...