1X6EA

Solution structures of the c2h2 type zinc finger domain of human zinc finger protein 24
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
b'GSSGSSGIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 24
publication title Solution structures of the C2H2 type zinc finger domain of human Zinc finger protein 24
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6eA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6eA02
1DGCA 2D9HA 3EPHA 2J7JA 1AAYA 2EM8A 4WSGA 4R2DA 1A1IA 2YRKA 2ELYA 2M9AA 5KL4A 1B69A 2DRPA 2JP9A 1X6EA 2YSPA 2EQ1A 2EM7A 5KL7A 2YTIA 2LV2A 2EOEA 2EMXA 2EOQA 4IS1C 2EM2A 2LCEA 2WBUA 2WBTA 2EMIA 2EOHA 2RSIA 2EM9A 2LVHA 3EPJA 2PRTA 4GZNC 2YTQA 1P47A 2GLIA 2YTEA 2YTGA 3VHTB 2EMAA 2MKDA 4F2JC 4F6MA 1Z1BA 1X6HA 1A1JA 2EN7A 1WJPA 2EPRA 4R2QA 2EN3A 2EPZA 1A1HA 3MHSC 5KL3A 2EORA 1A1GA 2NABA 1YSAC 2EMHA 3UK3C 2EM3A 2DLKA 4FK5C 2MKNA 2HGHA 4R2SA 2EN4A 3MHHC 2EL5A 2YSOA 2I13A 1ZAAC 2ENHA 2EOIA 2EL6A 4X9JA 1UBDC 1YUIA 2EN6A 2WCC3 2EMBA 2YTFA 2EOZA 2ADRA 1UN6B 1X3CA 2DMIA 2EN1A 1JK1A 2R1FA 5KL6A 2EJ4A 1X5WA 2ENAA 2EQ0A 4R2AA 2EMYA 2ENCA 1ZR9A 2EM5A 2EM4A 2EOXA 1TN9A 1BB8A 2EM6A 2EMWA 2YTOA 2LO3A 2YRHA 2EPXA 4F6NA 1A1KA 2EMLA 2EQ3A 2EMCA 1RMDA 2EOFA 2YTPA 2EM0A 1A1FA 2YU5A 2WBSA 2EPCA 1MEYC 2EMZA 2CSHA 2DLQA 2YTDA 1KJKA 2E72A 4R2RA 3EPKA 2MDGA 2YTNA 5KL5A 2EMFA 1G2FC 2CT1A 4R2EA 3M99B 2EOSA 2EL4A 2EE8A 4R2PA 2LT7A 1LLMC 2CTDA 2JPAA 2GHFA 2EN2A 2EOYA 2VRDA 2A25A 2EPAA 4IJDA 2EOMA 1NCSA 2EPUA 2YRMA 2EOOA 2EP3A 1JK2A 1X6FA 2YU8A 4M9VC 2EMKA 2BB8A 2EMGA 1G2DC 2EN8A 2ELZA 2RPCA 1ZU1A 2YTJA 5KL2A 1BBOA 1TF3A 4R2CA 2DGCA 3EPLA 1A1LA 1TF6A 1F2IG 2EPPA 1YUJA 2EOJA
chains in the Genus database with same CATH superfamily
4DMIA 1DGCA 4DR1E 2J7JA 3TQMA 4R2DA 4JI3E 2ELYA 2M9AA 2JP9A 4LF8E 5KL7A 2EM7A 4DV3E 2YTIA 5IXMB 3J81C 1PDAA 1FJGE 1X47A 2RS7A 2WBTA 3HXLA 4LFAE 3T1HE 3EPJA 2B3TB 3J80C 4GZNC 1UILA 5IV8B 2K4VA 5CFFE 4LF5E 1DQ3A 2MKDA 5A6BD 4GEQB 4DR7E 4L5NC 1N3GA 2M7QA 1A1GA 3VK6A 3UK3C 3JAMC 1PJTA 2NUGA 4FK5C 2V86A 3IWBA 3L00A 2EPNA 2HC5A 2EOIA 4L8NA 4BCAA 2WCC3 2ADRA 1X3CA 2DMIA 4BMJA 4LU9A 4B3SE 2EJ4A 2ENAA 1WHNA 4R2AA 2EMYA 1ZR9A 2EOXA 2MC5A 2ZM6E 3HPZA 2HJJA 1O0WA 2RTXA 3HPSA 4LF4E 2EQ3A 2EMCA 2EM0A 4F9BB 4AQYE 3C6KA 3QG5C 2UUCE 3EPKA 1YFHA 5KL5A 5F3WA 1PJQA 1WHQA 4MLQA 2EOSA 2EL4A 4R2PA 4DV1E 2LT7A 1LLMC 4LF9E 3BBGA 4BHCA 3ECRA 2GHFA 2LJHA 2VRDA 1IQOA 4O4KA 3KWRA 1X6FA 2YU8A 4M9VC 2EMKA 3DF6A 4JV5E 2YZTA 2ELZA 2RPCA 2YTJA 1HR0E 4JI0E 5A6AA 1EH8A 3EPLA 1TF6A 2L2NA 3C4TA 1YUJA 1G2DC 3EPHA 1AAYA 1PJSA 1A1IA 5T6JA 2B7TA 1XMQE 2DRPA 1X6EA 2YSPA 2JOXA 3HQ1A 2DB2A 3J7AG 2EMXA 2EOQA 2JYAA 2EM2A 2LCEA 2WBUA 1EH7A 2RSIA 2EM9A 2F4VE 2GLIA 5FLXC 3ADJA 2YT4A 1GQEA 2IHR1 4F6MA 1Z1BA 1X6HA 5ADZA 4O43A 2L3JA 2CPNA 2LMZA 3P1XA 2MDRA 5KL3A 4DR4E 2EMHA 2EM3A 4X66E 5LLQA 2MKNA 2V89A 2VQFE 4KHPE 4KWYA 2EL5A 1YPNA 4X9JA 4DR3E 2N3HA 2GPIA 4K0KE 2YTFA 3MSWA 1WXRA 2EN1A 5A69A 2EQ0A 5IWAE 2ENCA 1YYOA 2EM5A 1TN9A 2R76A 4DV5E 2EMWA 4X62E 2F8BA 5LMNE 1A1KA 4WXCA 2EMLA 4RH8A 3VYXA 4LTYA 2LBSB 2EPCA 1MEYC 4WXDA 2DLQA 3F6HA 1GTKA 1X48A 1BBGA 1KJKA 3HTXA 1N32E 2LUPB 1YYWA 1HNZE 1G2FC 2FTXB 1QNTA 4Q28A 3ADLA 4R03A 1N33E 2I9IA 5BR8E 4WFTA 1ZBTA 4ZYGA 4HTGA 2EPAA 2LTRA 2EOMA 2YPNA 4IJDA 4JI2E 4NXNE 2EPUA 2E1MA 2YRMA 1EH6A 2EOOA 2L92A 3IWDA 1UHZA 2LUQA 4JYAE 1T4NA 3K6QA 1L4SA 3LMLA 2LRSA 4X64E 2VF1A 2ODRD 2UXBE 5AC4A 1BBOA 4BC7A 4R2CA 2V88A 4F9CB 5A2QC 2DGCA 1T4OA 1F2IG 4X8WA 1MGTA 2D9HA 2V83A 3ADIA 4WSGA 2YRKA 1B69A 5KL4A 5A6KA 2EQ1A 3OMLA 4WPYA 2LV2A 2FV4B 1N36E 1X49A 2EOEA 2EZ6A 3AV0A 4LF7E 2VQEE 1RQ0A 2LVHA 1HNXE 2YTQA 3F6GA 4BHBA 2YTGA 3OTOE 3VHTB 1ZBQA 1WJPA 3DJWA 2EPRA 4WYQB 4R2QA 2YWQA 2EN3A 3THOB 2EPZA 1A1HA 2RSMA 3MHSC 1IMUA 2MC6A 1GZ6A 1QU6A 4BS9A 4R8OA 1J5EE 2EORA 2L2KB 4JI1E 2NABA 4I8OA 1YSAC 1IBME 1HNWE 2HGHA 3FIGA 4GKKE 4HEIA 4B3ME 1ZAAC 2K7IA 2RQLA 4Q35B 4DV7E 2EN6A 2Q8UA 2EMBA 1AH5A 2B9DA 4DUZE 1X5WA 4DKKA 1IBLE 4NXME 3C6MA 1N34E 3LLHA 3ZOQB 1BB8A 4J8ZA 4DV0E 1SR9A 2YTOA 2YRHA 4X65E 1SFEA 3AUZA 4JI6E 4BBYA 5IT9C 2YTPA 3IWCA 2JVAA 4JI5E 1A1FA 2YU5A 5AASA 2EMZA 2CSHA 2YTDA 1YZ9A 2JXPA 1EKZA 2E72A 4DV4E 3RMPA 2H36X 2YTNA 4R2EA 2WZOA 1XNRE 3M99B 1XMOE 1STUA 4DR6E 2JY9A 2DIXA 4YY3E 2NUEA 2KOUA 3ADGA 4DV2E 1T38A 2JR1A 4O24A 2EN2A 2EOYA 2UUAE 4WX9A 1NCSA 5AE1A 3BGHA 3EQ1A 1FKAE 5AE2A 2EMGA 2V8QB 2EN8A 2L2MA 5LMUE 5KL2A 2LTSA 2EPLX 3JU0A 5TSEA 1A1LA 5A6JA 2EPPA 2LE2A 4YHHE 2EM8A 4JI4E 2EWLA 1I94E 5A6BA 2ODRC 2L6MA 4IS1C 3C4BA 4O5GA 5DNYA 2EMIA 2EOHA 3KZZA 1P47A 2PRTA 5AC5A 4M0VA 2YTEA 2L3CA 4BC9A 4ZYHA 2EMAA 4F2JC 4JI7E 4RHBB 1A1JA 2KHXA 2M4IA 3T1YE 1RC7A 2EN7A 5LL6R 4ZYEA 3J7Yp 2V85A 2N3GA 2DMYA 3KZYA 4M2ZA 4P7DA 4ZYDA 3THNA 2L8TA 4JI8E 1PKPA 3VYYA 2M1SA 2DLKA 4R2SA 2DSYA 2EN4A 3MHHC 2YSOA 2I13A 4DUYE 2ENHA 2EL6A 2LJUA 2G7HA 1UBDC 1YUIA 4WSPA 2UXDE 2NA2A 2EOZA 4TUGA 1UN6B 1J26A 2JOBA 3JTZA 2NUFA 4B3TE 1JK1A 2R1FA 4MLVA 4LF6E 2EPOA 5KL6A 2EM4A 2EPKX 1IBKE 4OX9E 2EM6A 2LO3A 2EPXA 4F6NA 1DI2A 2N8XA 3BIDA 2UXCE 1IQSA 1RMDA 2EOFA 4B3RE 2L33A 2VE7C 1KYQA 2WBSA 4KZSA 2E5LE 5AE3A 4R2RA 2FGGA 4TUIA 2MDGA 2EMFA 2CT1A 1YYKA 4GKJE 4OOGC 4F54A 2EE8A 4DV6E 4NZVA 2CTDA 2JPAA 4N4RB 2V87A 2KONA 2B7VA 2HHHE 2A25A 2JWOA 4NHRA 1NEIA 1T4LB 2EP3A 4F9AB 3BF2A 4LFCE 4LFBE 1JK2A 2RS6A 2BBGA 2UUBE 1XNQE 2BB8A 4M30A 4DR2E 1WRJA 3H09A 1ZU1A 2UU9E 4P78A 1T39A 2EPMX 1TF3A 4DR5E 2EOJA
chains in the Genus database with same CATH topology
1DGCA 2D9HA 3EPHA 2J7JA 1AAYA 2EM8A 4WSGA 4R2DA 1A1IA 2YRKA 2ELYA 2M9AA 5KL4A 1B69A 2DRPA 2JP9A 1X6EA 2YSPA 2EQ1A 2EM7A 5KL7A 2YTIA 2LV2A 2EOEA 2EMXA 2EOQA 4IS1C 2EM2A 2LCEA 2WBUA 2WBTA 2EMIA 2EOHA 2RSIA 2EM9A 2LVHA 3EPJA 2PRTA 4GZNC 2YTQA 1P47A 2GLIA 2YTEA 2YTGA 3VHTB 2EMAA 2MKDA 4F2JC 4F6MA 1Z1BA 1X6HA 1A1JA 2EN7A 1WJPA 2EPRA 4R2QA 2EN3A 2EPZA 1A1HA 3MHSC 5KL3A 2EORA 1A1GA 2NABA 1YSAC 2EMHA 3UK3C 2EM3A 2DLKA 4FK5C 2MKNA 2HGHA 4R2SA 2EN4A 3MHHC 2EL5A 2YSOA 2I13A 1ZAAC 2ENHA 2EOIA 2EL6A 4X9JA 1UBDC 1YUIA 2EN6A 2WCC3 2EMBA 2YTFA 2EOZA 2ADRA 1UN6B 1X3CA 2DMIA 2EN1A 1JK1A 2R1FA 5KL6A 2EJ4A 1X5WA 2ENAA 2EQ0A 4R2AA 2EMYA 2ENCA 1ZR9A 2EM5A 2EM4A 2EOXA 1TN9A 1BB8A 2EM6A 2EMWA 2YTOA 2LO3A 2YRHA 2EPXA 4F6NA 1A1KA 2EMLA 2EQ3A 2EMCA 1RMDA 2EOFA 2YTPA 2EM0A 1A1FA 2YU5A 2WBSA 2EPCA 1MEYC 2EMZA 2CSHA 2DLQA 2YTDA 1KJKA 2E72A 4R2RA 3EPKA 2MDGA 2YTNA 5KL5A 2EMFA 1G2FC 2CT1A 4R2EA 3M99B 2EOSA 2EL4A 2EE8A 4R2PA 2LT7A 1LLMC 2CTDA 2JPAA 2GHFA 2EN2A 2EOYA 2VRDA 2A25A 2EPAA 4IJDA 2EOMA 1NCSA 2EPUA 2YRMA 2EOOA 2EP3A 1JK2A 1X6FA 2YU8A 4M9VC 2EMKA 2BB8A 2EMGA 1G2DC 2EN8A 2ELZA 2RPCA 1ZU1A 2YTJA 5KL2A 1BBOA 1TF3A 4R2CA 2DGCA 3EPLA 1A1LA 1TF6A 1F2IG 2EPPA 1YUJA 2EOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGC A;  2D9H A;  3EPH A;  2J7J A;  1AAY A;  2EM8 A;  4WSG A;  4R2D A;  1A1I A;  2YRK A;  2ELY A;  2M9A A;  5KL4 A;  1B69 A;  2DRP A;  2JP9 A;  1X6E A;  2YSP A;  2EQ1 A;  2EM7 A;  5KL7 A;  2YTI A;  2LV2 A;  2EOE A;  2EMX A;  2EOQ A;  4IS1 C;  2EM2 A;  2LCE A;  2WBU A;  2WBT A;  2EMI A;  2EOH A;  2RSI A;  2EM9 A;  2LVH A;  3EPJ A;  2PRT A;  4GZN C;  2YTQ A;  1P47 A;  2GLI A;  2YTE A;  2YTG A;  3VHT B;  2EMA A;  2MKD A;  4F2J C;  4F6M A;  1Z1B A;  1X6H A;  1A1J A;  2EN7 A;  1WJP A;  2EPR A;  4R2Q A;  2EN3 A;  2EPZ A;  1A1H A;  3MHS C;  5KL3 A;  2EOR A;  1A1G A;  2NAB A;  1YSA C;  2EMH A;  3UK3 C;  2EM3 A;  2DLK A;  4FK5 C;  2MKN A;  2HGH A;  4R2S A;  2EN4 A;  3MHH C;  2EL5 A;  2YSO A;  2I13 A;  1ZAA C;  2ENH A;  2EOI A;  2EL6 A;  4X9J A;  1UBD C;  1YUI A;  2EN6 A;  2WCC 3;  2EMB A;  2YTF A;  2EOZ A;  2ADR A;  1UN6 B;  1X3C A;  2DMI A;  2EN1 A;  1JK1 A;  2R1F A;  5KL6 A;  2EJ4 A;  1X5W A;  2ENA A;  2EQ0 A;  4R2A A;  2EMY A;  2ENC A;  1ZR9 A;  2EM5 A;  2EM4 A;  2EOX A;  1TN9 A;  1BB8 A;  2EM6 A;  2EMW A;  2YTO A;  2LO3 A;  2YRH A;  2EPX A;  4F6N A;  1A1K A;  2EML A;  2EQ3 A;  2EMC A;  1RMD A;  2EOF A;  2YTP A;  2EM0 A;  1A1F A;  2YU5 A;  2WBS A;  2EPC A;  1MEY C;  2EMZ A;  2CSH A;  2DLQ A;  2YTD A;  1KJK A;  2E72 A;  4R2R A;  3EPK A;  2MDG A;  2YTN A;  5KL5 A;  2EMF A;  1G2F C;  2CT1 A;  4R2E A;  3M99 B;  2EOS A;  2EL4 A;  2EE8 A;  4R2P A;  2LT7 A;  1LLM C;  2CTD A;  2JPA A;  2GHF A;  2EN2 A;  2EOY A;  2VRD A;  2A25 A;  2EPA A;  4IJD A;  2EOM A;  1NCS A;  2EPU A;  2YRM A;  2EOO A;  2EP3 A;  1JK2 A;  1X6F A;  2YU8 A;  4M9V C;  2EMK A;  2BB8 A;  2EMG A;  1G2D C;  2EN8 A;  2ELZ A;  2RPC A;  1ZU1 A;  2YTJ A;  5KL2 A;  1BBO A;  1TF3 A;  4R2C A;  2DGC A;  3EPL A;  1A1L A;  1TF6 A;  1F2I G;  2EPP A;  1YUJ A;  2EOJ A; 
#chains in the Genus database with same CATH topology
 4DMI A;  1DGC A;  4DR1 E;  2J7J A;  3TQM A;  4R2D A;  4JI3 E;  2ELY A;  2M9A A;  2JP9 A;  4LF8 E;  5KL7 A;  2EM7 A;  4DV3 E;  2YTI A;  5IXM B;  3J81 C;  1PDA A;  1FJG E;  1X47 A;  2RS7 A;  2WBT A;  3HXL A;  4LFA E;  3T1H E;  3EPJ A;  2B3T B;  3J80 C;  4GZN C;  1UIL A;  5IV8 B;  2K4V A;  5CFF E;  4LF5 E;  1DQ3 A;  2MKD A;  5A6B D;  4GEQ B;  4DR7 E;  4L5N C;  1N3G A;  2M7Q A;  1A1G A;  3VK6 A;  3UK3 C;  3JAM C;  1PJT A;  2NUG A;  4FK5 C;  2V86 A;  3IWB A;  3L00 A;  2EPN A;  2HC5 A;  2EOI A;  4L8N A;  4BCA A;  2WCC 3;  2ADR A;  1X3C A;  2DMI A;  4BMJ A;  4LU9 A;  4B3S E;  2EJ4 A;  2ENA A;  1WHN A;  4R2A A;  2EMY A;  1ZR9 A;  2EOX A;  2MC5 A;  2ZM6 E;  3HPZ A;  2HJJ A;  1O0W A;  2RTX A;  3HPS A;  4LF4 E;  2EQ3 A;  2EMC A;  2EM0 A;  4F9B B;  4AQY E;  3C6K A;  3QG5 C;  2UUC E;  3EPK A;  1YFH A;  5KL5 A;  5F3W A;  1PJQ A;  1WHQ A;  4MLQ A;  2EOS A;  2EL4 A;  4R2P A;  4DV1 E;  2LT7 A;  1LLM C;  4LF9 E;  3BBG A;  4BHC A;  3ECR A;  2GHF A;  2LJH A;  2VRD A;  1IQO A;  4O4K A;  3KWR A;  1X6F A;  2YU8 A;  4M9V C;  2EMK A;  3DF6 A;  4JV5 E;  2YZT A;  2ELZ A;  2RPC A;  2YTJ A;  1HR0 E;  4JI0 E;  5A6A A;  1EH8 A;  3EPL A;  1TF6 A;  2L2N A;  3C4T A;  1YUJ A;  1G2D C;  3EPH A;  1AAY A;  1PJS A;  1A1I A;  5T6J A;  2B7T A;  1XMQ E;  2DRP A;  1X6E A;  2YSP A;  2JOX A;  3HQ1 A;  2DB2 A;  3J7A G;  2EMX A;  2EOQ A;  2JYA A;  2EM2 A;  2LCE A;  2WBU A;  1EH7 A;  2RSI A;  2EM9 A;  2F4V E;  2GLI A;  5FLX C;  3ADJ A;  2YT4 A;  1GQE A;  2IHR 1;  4F6M A;  1Z1B A;  1X6H A;  5ADZ A;  4O43 A;  2L3J A;  2CPN A;  2LMZ A;  3P1X A;  2MDR A;  5KL3 A;  4DR4 E;  2EMH A;  2EM3 A;  4X66 E;  5LLQ A;  2MKN A;  2V89 A;  2VQF E;  4KHP E;  4KWY A;  2EL5 A;  1YPN A;  4X9J A;  4DR3 E;  2N3H A;  2GPI A;  4K0K E;  2YTF A;  3MSW A;  1WXR A;  2EN1 A;  5A69 A;  2EQ0 A;  5IWA E;  2ENC A;  1YYO A;  2EM5 A;  1TN9 A;  2R76 A;  4DV5 E;  2EMW A;  4X62 E;  2F8B A;  5LMN E;  1A1K A;  4WXC A;  2EML A;  4RH8 A;  3VYX A;  4LTY A;  2LBS B;  2EPC A;  1MEY C;  4WXD A;  2DLQ A;  3F6H A;  1GTK A;  1X48 A;  1BBG A;  1KJK A;  3HTX A;  1N32 E;  2LUP B;  1YYW A;  1HNZ E;  1G2F C;  2FTX B;  1QNT A;  4Q28 A;  3ADL A;  4R03 A;  1N33 E;  2I9I A;  5BR8 E;  4WFT A;  1ZBT A;  4ZYG A;  4HTG A;  2EPA A;  2LTR A;  2EOM A;  2YPN A;  4IJD A;  4JI2 E;  4NXN E;  2EPU A;  2E1M A;  2YRM A;  1EH6 A;  2EOO A;  2L92 A;  3IWD A;  1UHZ A;  2LUQ A;  4JYA E;  1T4N A;  3K6Q A;  1L4S A;  3LML A;  2LRS A;  4X64 E;  2VF1 A;  2ODR D;  2UXB E;  5AC4 A;  1BBO A;  4BC7 A;  4R2C A;  2V88 A;  4F9C B;  5A2Q C;  2DGC A;  1T4O A;  1F2I G;  4X8W A;  1MGT A;  2D9H A;  2V83 A;  3ADI A;  4WSG A;  2YRK A;  1B69 A;  5KL4 A;  5A6K A;  2EQ1 A;  3OML A;  4WPY A;  2LV2 A;  2FV4 B;  1N36 E;  1X49 A;  2EOE A;  2EZ6 A;  3AV0 A;  4LF7 E;  2VQE E;  1RQ0 A;  2LVH A;  1HNX E;  2YTQ A;  3F6G A;  4BHB A;  2YTG A;  3OTO E;  3VHT B;  1ZBQ A;  1WJP A;  3DJW A;  2EPR A;  4WYQ B;  4R2Q A;  2YWQ A;  2EN3 A;  3THO B;  2EPZ A;  1A1H A;  2RSM A;  3MHS C;  1IMU A;  2MC6 A;  1GZ6 A;  1QU6 A;  4BS9 A;  4R8O A;  1J5E E;  2EOR A;  2L2K B;  4JI1 E;  2NAB A;  4I8O A;  1YSA C;  1IBM E;  1HNW E;  2HGH A;  3FIG A;  4GKK E;  4HEI A;  4B3M E;  1ZAA C;  2K7I A;  2RQL A;  4Q35 B;  4DV7 E;  2EN6 A;  2Q8U A;  2EMB A;  1AH5 A;  2B9D A;  4DUZ E;  1X5W A;  4DKK A;  1IBL E;  4NXM E;  3C6M A;  1N34 E;  3LLH A;  3ZOQ B;  1BB8 A;  4J8Z A;  4DV0 E;  1SR9 A;  2YTO A;  2YRH A;  4X65 E;  1SFE A;  3AUZ A;  4JI6 E;  4BBY A;  5IT9 C;  2YTP A;  3IWC A;  2JVA A;  4JI5 E;  1A1F A;  2YU5 A;  5AAS A;  2EMZ A;  2CSH A;  2YTD A;  1YZ9 A;  2JXP A;  1EKZ A;  2E72 A;  4DV4 E;  3RMP A;  2H36 X;  2YTN A;  4R2E A;  2WZO A;  1XNR E;  3M99 B;  1XMO E;  1STU A;  4DR6 E;  2JY9 A;  2DIX A;  4YY3 E;  2NUE A;  2KOU A;  3ADG A;  4DV2 E;  1T38 A;  2JR1 A;  4O24 A;  2EN2 A;  2EOY A;  2UUA E;  4WX9 A;  1NCS A;  5AE1 A;  3BGH A;  3EQ1 A;  1FKA E;  5AE2 A;  2EMG A;  2V8Q B;  2EN8 A;  2L2M A;  5LMU E;  5KL2 A;  2LTS A;  2EPL X;  3JU0 A;  5TSE A;  1A1L A;  5A6J A;  2EPP A;  2LE2 A;  4YHH E;  2EM8 A;  4JI4 E;  2EWL A;  1I94 E;  5A6B A;  2ODR C;  2L6M A;  4IS1 C;  3C4B A;  4O5G A;  5DNY A;  2EMI A;  2EOH A;  3KZZ A;  1P47 A;  2PRT A;  5AC5 A;  4M0V A;  2YTE A;  2L3C A;  4BC9 A;  4ZYH A;  2EMA A;  4F2J C;  4JI7 E;  4RHB B;  1A1J A;  2KHX A;  2M4I A;  3T1Y E;  1RC7 A;  2EN7 A;  5LL6 R;  4ZYE A;  3J7Y p;  2V85 A;  2N3G A;  2DMY A;  3KZY A;  4M2Z A;  4P7D A;  4ZYD A;  3THN A;  2L8T A;  4JI8 E;  1PKP A;  3VYY A;  2M1S A;  2DLK A;  4R2S A;  2DSY A;  2EN4 A;  3MHH C;  2YSO A;  2I13 A;  4DUY E;  2ENH A;  2EL6 A;  2LJU A;  2G7H A;  1UBD C;  1YUI A;  4WSP A;  2UXD E;  2NA2 A;  2EOZ A;  4TUG A;  1UN6 B;  1J26 A;  2JOB A;  3JTZ A;  2NUF A;  4B3T E;  1JK1 A;  2R1F A;  4MLV A;  4LF6 E;  2EPO A;  5KL6 A;  2EM4 A;  2EPK X;  1IBK E;  4OX9 E;  2EM6 A;  2LO3 A;  2EPX A;  4F6N A;  1DI2 A;  2N8X A;  3BID A;  2UXC E;  1IQS A;  1RMD A;  2EOF A;  4B3R E;  2L33 A;  2VE7 C;  1KYQ A;  2WBS A;  4KZS A;  2E5L E;  5AE3 A;  4R2R A;  2FGG A;  4TUI A;  2MDG A;  2EMF A;  2CT1 A;  1YYK A;  4GKJ E;  4OOG C;  4F54 A;  2EE8 A;  4DV6 E;  4NZV A;  2CTD A;  2JPA A;  4N4R B;  2V87 A;  2KON A;  2B7V A;  2HHH E;  2A25 A;  2JWO A;  4NHR A;  1NEI A;  1T4L B;  2EP3 A;  4F9A B;  3BF2 A;  4LFC E;  4LFB E;  1JK2 A;  2RS6 A;  2BBG A;  2UUB E;  1XNQ E;  2BB8 A;  4M30 A;  4DR2 E;  1WRJ A;  3H09 A;  1ZU1 A;  2UU9 E;  4P78 A;  1T39 A;  2EPM X;  1TF3 A;  4DR5 E;  2EOJ A; 
#chains in the Genus database with same CATH homology
 1DGC A;  2D9H A;  3EPH A;  2J7J A;  1AAY A;  2EM8 A;  4WSG A;  4R2D A;  1A1I A;  2YRK A;  2ELY A;  2M9A A;  5KL4 A;  1B69 A;  2DRP A;  2JP9 A;  1X6E A;  2YSP A;  2EQ1 A;  2EM7 A;  5KL7 A;  2YTI A;  2LV2 A;  2EOE A;  2EMX A;  2EOQ A;  4IS1 C;  2EM2 A;  2LCE A;  2WBU A;  2WBT A;  2EMI A;  2EOH A;  2RSI A;  2EM9 A;  2LVH A;  3EPJ A;  2PRT A;  4GZN C;  2YTQ A;  1P47 A;  2GLI A;  2YTE A;  2YTG A;  3VHT B;  2EMA A;  2MKD A;  4F2J C;  4F6M A;  1Z1B A;  1X6H A;  1A1J A;  2EN7 A;  1WJP A;  2EPR A;  4R2Q A;  2EN3 A;  2EPZ A;  1A1H A;  3MHS C;  5KL3 A;  2EOR A;  1A1G A;  2NAB A;  1YSA C;  2EMH A;  3UK3 C;  2EM3 A;  2DLK A;  4FK5 C;  2MKN A;  2HGH A;  4R2S A;  2EN4 A;  3MHH C;  2EL5 A;  2YSO A;  2I13 A;  1ZAA C;  2ENH A;  2EOI A;  2EL6 A;  4X9J A;  1UBD C;  1YUI A;  2EN6 A;  2WCC 3;  2EMB A;  2YTF A;  2EOZ A;  2ADR A;  1UN6 B;  1X3C A;  2DMI A;  2EN1 A;  1JK1 A;  2R1F A;  5KL6 A;  2EJ4 A;  1X5W A;  2ENA A;  2EQ0 A;  4R2A A;  2EMY A;  2ENC A;  1ZR9 A;  2EM5 A;  2EM4 A;  2EOX A;  1TN9 A;  1BB8 A;  2EM6 A;  2EMW A;  2YTO A;  2LO3 A;  2YRH A;  2EPX A;  4F6N A;  1A1K A;  2EML A;  2EQ3 A;  2EMC A;  1RMD A;  2EOF A;  2YTP A;  2EM0 A;  1A1F A;  2YU5 A;  2WBS A;  2EPC A;  1MEY C;  2EMZ A;  2CSH A;  2DLQ A;  2YTD A;  1KJK A;  2E72 A;  4R2R A;  3EPK A;  2MDG A;  2YTN A;  5KL5 A;  2EMF A;  1G2F C;  2CT1 A;  4R2E A;  3M99 B;  2EOS A;  2EL4 A;  2EE8 A;  4R2P A;  2LT7 A;  1LLM C;  2CTD A;  2JPA A;  2GHF A;  2EN2 A;  2EOY A;  2VRD A;  2A25 A;  2EPA A;  4IJD A;  2EOM A;  1NCS A;  2EPU A;  2YRM A;  2EOO A;  2EP3 A;  1JK2 A;  1X6F A;  2YU8 A;  4M9V C;  2EMK A;  2BB8 A;  2EMG A;  1G2D C;  2EN8 A;  2ELZ A;  2RPC A;  1ZU1 A;  2YTJ A;  5KL2 A;  1BBO A;  1TF3 A;  4R2C A;  2DGC A;  3EPL A;  1A1L A;  1TF6 A;  1F2I G;  2EPP A;  1YUJ A;  2EOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...