1X6EA

Solution structures of the c2h2 type zinc finger domain of human zinc finger protein 24
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
GSSGSSGIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 24
publication title Solution structures of the C2H2 type zinc finger domain of human Zinc finger protein 24
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6eA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6eA02
2YRHA 2EM0A 1DGCA 2EP3A 3UK3C 1ZR9A 2EPPA 2E72A 2YTEA 2EOHA 2YTFA 2GLIA 5KL7A 2YU5A 4X9JA 3EPJA 1A1LA 2EOMA 1YUIA 1NCSA 1X5WA 2RSIA 1F2IG 2DMIA 4GZNC 2MDGA 4R2AA 2EN7A 1TF6A 2EOSA 4F6NA 2BB8A 2EMYA 2R1FA 1ZAAC 2LO3A 2EOOA 2RPCA 2WBSA 1P47A 2ENCA 1A1HA 4FK5C 1UN6B 1JK1A 2EE8A 1Z1BA 2EN3A 1YUJA 1AAYA 2ELYA 2EMXA 2EM8A 2ELZA 2EOIA 2YSOA 2WCC3 2WBTA 2EQ0A 2EMGA 2EOYA 2EPZA 2ENHA 2YTGA 2VRDA 3VHTB 2GHFA 1BBOA 2HGHA 2YTNA 2ADRA 1G2FC 2EM2A 2EM7A 2EPAA 2EMWA 3MHSC 2EJ4A 1X6HA 4F2JC 2DRPA 4R2QA 1UBDC 2EQ3A 4R2EA 2EM6A 2YRMA 3MHHC 2EORA 1ZU1A 1TN9A 2EL6A 2EOJA 1WJPA 2YTPA 4R2PA 2A25A 2CT1A 2YTJA 2MKNA 2YRKA 4R2RA 2DGCA 5KL3A 3EPLA 1A1FA 2EOQA 2EMCA 3EPHA 2MKDA 2YSPA 2YTIA 2EMZA 2DLQA 5KL2A 2EOFA 3M99B 2I13A 1RMDA 1MEYC 2EL4A 2D9HA 1TF3A 2J7JA 2YTDA 1G2DC 2EN2A 4R2CA 4R2SA 2LVHA 1X6EA 2YTOA 2EMLA 2EOXA 2EPRA 1X6FA 2LT7A 2CTDA 2EN4A 2EOEA 1JK2A 5KL5A 2EMBA 2DLKA 4WSGA 2EN1A 2EMIA 4IJDA 1X3CA 2JP9A 1BB8A 5KL4A 2EM3A 2ENAA 1B69A 2EN6A 1A1JA 2EMFA 1LLMC 2EPUA 2EM5A 2EMHA 4IS1C 2CSHA 2EQ1A 3EPKA 1KJKA 2EL5A 2EN8A 1YSAC 2LCEA 2PRTA 2EMAA 2NABA 4M9VC 2EPXA 2LV2A 2YTQA 4R2DA 2JPAA 2EPCA 2EOZA 1A1IA 2YU8A 2M9AA 1A1KA 2EM4A 1A1GA 2EMKA 5KL6A 2WBUA 4F6MA 2EM9A
chains in the Genus database with same CATH superfamily
2YZTA 2YRHA 3VK6A 1DGCA 2DMYA 3DF6A 3UK3C 4DV3E 4DV6E 1DI2A 2YTFA 2UUCE 1X49A 1A1LA 4GEQB 2EOMA 1NCSA 2L6MA 2RSIA 1F2IG 4ZYHA 2FV4B 5IWAE 2BBGA 1GTKA 1IBKE 2LO3A 2EOOA 3AV0A 3F6GA 5AC5A 1P47A 4R8OA 4LFCE 4TUGA 4B3TE 3ZOQB 3K6QA 3BF2A 2EE8A 1WHQA 2L2NA 2EN3A 4X8WA 2L3JA 3J7AG 2RQLA 3MSWA 2RS6A 4BC7A 2EOYA 2YTGA 1J5EE 2HGHA 4L5NC 3ADLA 2V88A 1YFHA 1G2FC 2EM7A 1X48A 2N3HA 2EPAA 4DR4E 1YZ9A 4F2JC 4M2ZA 2GPIA 1UBDC 3L00A 2EM6A 2RTXA 4LF5E 1TN9A 2EL6A 1WJPA 4R2PA 4DR1E 1BBGA 2CT1A 2LTSA 1T38A 3EPLA 4BMJA 1XMQE 3EPHA 2RS7A 2V85A 2YSPA 2YTIA 4F9AB 3C4BA 3M99B 3BBGA 3JTZA 4X64E 2HC5A 2R76A 4LTYA 1XMOE 5F3WA 4JI3E 4JI7E 2LVHA 2LE2A 1X6EA 2VQFE 2EPRA 2NUEA 2K4VA 2EN4A 3BGHA 4WSGA 2DLKA 2EMIA 4NXNE 1X3CA 5A6BA 2N8XA 4GKKE 3LMLA 1PKPA 3VYXA 4DR6E 1IQOA 2EN6A 2EMFA 3HQ1A 2B9DA 4AQYE 3IWBA 4DR3E 1HR0E 2H36X 1KJKA 1YSAC 3HTXA 2HHHE 2PRTA 4M9VC 1UHZA 4MLQA 3THNA 1WHNA 4DR5E 4LF4E 2L33A 1XNQE 1A1IA 2MC5A 5IT9C 4DR2E 4WXDA 2EM4A 2EMKA 3C4TA 3RMPA 2EM0A 1PJTA 2JY9A 2UXCE 2EP3A 4O5GA 2L2MA 2MDRA 1YPNA 1PJQA 3C6MA 4Q28A 5KL7A 4X9JA 4JI5E 1EH8A 4WSPA 2YWQA 5AE3A 4N4RB 1T4NA 1TF6A 2BB8A 2R1FA 3DJWA 1PJSA 1I94E 2V83A 1JK1A 1YUJA 1RQ0A 2VE7C 1IBME 2B7TA 2EM8A 2WCC3 5A6KA 2L3CA 2EMGA 2NUGA 2ENHA 2VRDA 2GHFA 2YTNA 3BIDA 1L4SA 4ZYDA 4I8OA 3ADGA 2JXPA 2FTXB 4OOGC 5A69A 2EMWA 4YY3E 2DRPA 4R2QA 1PDAA 3AUZA 4JI0E 2LTRA 4DV7E 3OTOE 1ZU1A 2A25A 2MKNA 2YRKA 4LFAE 2UXBE 4L8NA 2LJUA 3KZYA 4F9CB 1A1FA 2EOQA 4O4KA 3T1HE 3TQMA 2DLQA 4F9BB 4B3RE 5KL2A 2EOFA 1MEYC 2D9HA 1TF3A 4R2SA 3F6HA 4M30A 2CTDA 2EOEA 4NZVA 4WXCA 5KL5A 4JYAE 2EN1A 5A6JA 4IJDA 4BHBA 1N34E 2UU9E 1N33E 5KL4A 4DR7E 1B69A 4LF6E 3ADJA 1LLMC 2EPUA 2UXDE 2EMHA 4IS1C 2CSHA 2EL5A 2L8TA 2E1MA 2LCEA 4X66E 5AC4A 2NABA 5AE2A 4J8ZA 3HPSA 2JPAA 3IWDA 1T4OA 2EZ6A 2VQEE 2M1SA 2EOZA 2YU8A 4DV0E 2LBSB 1HNXE 5A2QC 4WPYA 3JU0A 4DUYE 4K0KE 1ZR9A 2DB2A 2EOHA 2GLIA 3H09A 3KWRA 1IBLE 2YU5A 1YUIA 3EPJA 2G7HA 1GQEA 1O0WA 2EN7A 4F6NA 2EMYA 2B7VA 2EPLX 2RPCA 2WBSA 4LU9A 1A1HA 4FK5C 4DKKA 1UN6B 1Z1BA 4DV1E 4DV4E 4JI6E 2ELYA 4RH8A 1YYKA 2EMXA 5TSEA 2ELZA 2M4IA 2YSOA 4B3SE 4JV5E 2WZOA 3T1YE 4LFBE 3VHTB 1BBOA 5IXMB 4BHCA 2JOBA 2ADRA 2UUAE 4BS9A 2EM2A 2ODRD 5AE1A 3EQ1A 5LMUE 1N3GA 3VYYA 1X47A 4ZYEA 3HXLA 2EJ4A 1X6HA 2DSYA 5LL6R 1STUA 2V8QB 2EQ3A 4R2EA 1YYWA 2Q8UA 1NEIA 2EORA 2LJHA 3HPZA 4GKJE 4HTGA 2YTJA 4X65E 4O43A 5AASA 2EWLA 4R2RA 5LMNE 1N36E 2EPKX 4R03A 5KL3A 2DGCA 4KWYA 4NHRA 2EMCA 4JI1E 4Q35B 3ADIA 2LMZA 5A6AA 4LF7E 1G2DC 3IWCA 4R2CA 1WXRA 5BR8E 1FKAE 2JWOA 4M0VA 1X6FA 4BBYA 1JK2A 2EMBA 1EH6A 1QU6A 4O24A 2EPOA 2JP9A 5IV8B 2ENAA 2L92A 3LLHA 1A1JA 2V86A 4HEIA 1FJGE 1AH5A 4WYQB 4KZSA 5T6JA 2EN8A 1XNRE 4JI2E 4KHPE 3ECRA 4RHBB 3JAMC 4YHHE 3J81C 2MC6A 2IHR1 2L2KB 1A1KA 1DQ3A 1A1GA 1ZBQA 2KOUA 2EM9A 4X62E 2F4VE 4F54A 2JR1A 2EPPA 4TUIA 1MGTA 1SR9A 1T39A 2E72A 2YTEA 2DIXA 5DNYA 2V87A 1X5WA 2CPNA 1J26A 4NXME 2DMIA 1IQSA 4LF8E 4GZNC 2MDGA 4MLVA 4R2AA 2F8BA 2EOSA 2HJJA 1ZAAC 3J80C 2EPMX 3C6KA 1YYOA 2ODRC 4LF9E 2ENCA 4BC9A 4JI8E 2V89A 2VF1A 1N32E 1AAYA 2EOIA 1RC7A 2K7IA 2NUFA 2WBTA 2EQ0A 1HNWE 2EPNA 2EPZA 5CFFE 2JYAA 2YPNA 1EH7A 5LLQA 3MHSC 4JI4E 2YT4A 2YRMA 3MHHC 1WRJA 4P78A 2EOJA 2YTPA 1GZ6A 4BCAA 2B3TB 2JOXA 5FLXC 3THOB 5A6BD 1IMUA 3FIGA 1EKZA 1SFEA 4OX9E 2MKDA 2EMZA 3OMLA 4WFTA 2I13A 2ZM6E 1RMDA 2EL4A 2J7JA 2YTDA 4P7DA 2EN2A 4B3ME 1KYQA 4DMIA 2LUPB 2YTOA 2EMLA 2EOXA 1HNZE 2KONA 2LT7A 3J7Yp 3KZZA 4DUZE 2E5LE 2RSMA 2FGGA 3QG5C 2UUBE 3P1XA 2N3GA 1BB8A 2M7QA 2EM3A 2NA2A 2EM5A 4WX9A 4ZYGA 2EQ1A 3EPKA 2KHXA 2LUQA 1QNTA 2EMAA 1UILA 2LRSA 2JVAA 5ADZA 2EPXA 4DV5E 2LV2A 2YTQA 4R2DA 1ZBTA 1T4LB 2EPCA 4DV2E 2M9AA 5KL6A 2WBUA 4F6MA 2I9IA
chains in the Genus database with same CATH topology
2YRHA 2EM0A 1DGCA 2EP3A 3UK3C 1ZR9A 2EPPA 2E72A 2YTEA 2EOHA 2YTFA 2GLIA 5KL7A 2YU5A 4X9JA 3EPJA 1A1LA 2EOMA 1YUIA 1NCSA 1X5WA 2RSIA 1F2IG 2DMIA 4GZNC 2MDGA 4R2AA 2EN7A 1TF6A 2EOSA 4F6NA 2BB8A 2EMYA 2R1FA 1ZAAC 2LO3A 2EOOA 2RPCA 2WBSA 1P47A 2ENCA 1A1HA 4FK5C 1UN6B 1JK1A 2EE8A 1Z1BA 2EN3A 1YUJA 1AAYA 2ELYA 2EMXA 2EM8A 2ELZA 2EOIA 2YSOA 2WCC3 2WBTA 2EQ0A 2EMGA 2EOYA 2EPZA 2ENHA 2YTGA 2VRDA 3VHTB 2GHFA 1BBOA 2HGHA 2YTNA 2ADRA 1G2FC 2EM2A 2EM7A 2EPAA 2EMWA 3MHSC 2EJ4A 1X6HA 4F2JC 2DRPA 4R2QA 1UBDC 2EQ3A 4R2EA 2EM6A 2YRMA 3MHHC 2EORA 1ZU1A 1TN9A 2EL6A 2EOJA 1WJPA 2YTPA 4R2PA 2A25A 2CT1A 2YTJA 2MKNA 2YRKA 4R2RA 2DGCA 5KL3A 3EPLA 1A1FA 2EOQA 2EMCA 3EPHA 2MKDA 2YSPA 2YTIA 2EMZA 2DLQA 5KL2A 2EOFA 3M99B 2I13A 1RMDA 1MEYC 2EL4A 2D9HA 1TF3A 2J7JA 2YTDA 1G2DC 2EN2A 4R2CA 4R2SA 2LVHA 1X6EA 2YTOA 2EMLA 2EOXA 2EPRA 1X6FA 2LT7A 2CTDA 2EN4A 2EOEA 1JK2A 5KL5A 2EMBA 2DLKA 4WSGA 2EN1A 2EMIA 4IJDA 1X3CA 2JP9A 1BB8A 5KL4A 2EM3A 2ENAA 1B69A 2EN6A 1A1JA 2EMFA 1LLMC 2EPUA 2EM5A 2EMHA 4IS1C 2CSHA 2EQ1A 3EPKA 1KJKA 2EL5A 2EN8A 1YSAC 2LCEA 2PRTA 2EMAA 2NABA 4M9VC 2EPXA 2LV2A 2YTQA 4R2DA 2JPAA 2EPCA 2EOZA 1A1IA 2YU8A 2M9AA 1A1KA 2EM4A 1A1GA 2EMKA 5KL6A 2WBUA 4F6MA 2EM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRH A;  2EM0 A;  1DGC A;  2EP3 A;  3UK3 C;  1ZR9 A;  2EPP A;  2E72 A;  2YTE A;  2EOH A;  2YTF A;  2GLI A;  5KL7 A;  2YU5 A;  4X9J A;  3EPJ A;  1A1L A;  2EOM A;  1YUI A;  1NCS A;  1X5W A;  2RSI A;  1F2I G;  2DMI A;  4GZN C;  2MDG A;  4R2A A;  2EN7 A;  1TF6 A;  2EOS A;  4F6N A;  2BB8 A;  2EMY A;  2R1F A;  1ZAA C;  2LO3 A;  2EOO A;  2RPC A;  2WBS A;  1P47 A;  2ENC A;  1A1H A;  4FK5 C;  1UN6 B;  1JK1 A;  2EE8 A;  1Z1B A;  2EN3 A;  1YUJ A;  1AAY A;  2ELY A;  2EMX A;  2EM8 A;  2ELZ A;  2EOI A;  2YSO A;  2WCC 3;  2WBT A;  2EQ0 A;  2EMG A;  2EOY A;  2EPZ A;  2ENH A;  2YTG A;  2VRD A;  3VHT B;  2GHF A;  1BBO A;  2HGH A;  2YTN A;  2ADR A;  1G2F C;  2EM2 A;  2EM7 A;  2EPA A;  2EMW A;  3MHS C;  2EJ4 A;  1X6H A;  4F2J C;  2DRP A;  4R2Q A;  1UBD C;  2EQ3 A;  4R2E A;  2EM6 A;  2YRM A;  3MHH C;  2EOR A;  1ZU1 A;  1TN9 A;  2EL6 A;  2EOJ A;  1WJP A;  2YTP A;  4R2P A;  2A25 A;  2CT1 A;  2YTJ A;  2MKN A;  2YRK A;  4R2R A;  2DGC A;  5KL3 A;  3EPL A;  1A1F A;  2EOQ A;  2EMC A;  3EPH A;  2MKD A;  2YSP A;  2YTI A;  2EMZ A;  2DLQ A;  5KL2 A;  2EOF A;  3M99 B;  2I13 A;  1RMD A;  1MEY C;  2EL4 A;  2D9H A;  1TF3 A;  2J7J A;  2YTD A;  1G2D C;  2EN2 A;  4R2C A;  4R2S A;  2LVH A;  1X6E A;  2YTO A;  2EML A;  2EOX A;  2EPR A;  1X6F A;  2LT7 A;  2CTD A;  2EN4 A;  2EOE A;  1JK2 A;  5KL5 A;  2EMB A;  2DLK A;  4WSG A;  2EN1 A;  2EMI A;  4IJD A;  1X3C A;  2JP9 A;  1BB8 A;  5KL4 A;  2EM3 A;  2ENA A;  1B69 A;  2EN6 A;  1A1J A;  2EMF A;  1LLM C;  2EPU A;  2EM5 A;  2EMH A;  4IS1 C;  2CSH A;  2EQ1 A;  3EPK A;  1KJK A;  2EL5 A;  2EN8 A;  1YSA C;  2LCE A;  2PRT A;  2EMA A;  2NAB A;  4M9V C;  2EPX A;  2LV2 A;  2YTQ A;  4R2D A;  2JPA A;  2EPC A;  2EOZ A;  1A1I A;  2YU8 A;  2M9A A;  1A1K A;  2EM4 A;  1A1G A;  2EMK A;  5KL6 A;  2WBU A;  4F6M A;  2EM9 A; 
#chains in the Genus database with same CATH topology
 2YZT A;  2YRH A;  3VK6 A;  1DGC A;  2DMY A;  3DF6 A;  3UK3 C;  4DV3 E;  4DV6 E;  1DI2 A;  2YTF A;  2UUC E;  1X49 A;  1A1L A;  4GEQ B;  2EOM A;  1NCS A;  2L6M A;  2RSI A;  1F2I G;  4ZYH A;  2FV4 B;  5IWA E;  2BBG A;  1GTK A;  1IBK E;  2LO3 A;  2EOO A;  3AV0 A;  3F6G A;  5AC5 A;  1P47 A;  4R8O A;  4LFC E;  4TUG A;  4B3T E;  3ZOQ B;  3K6Q A;  3BF2 A;  2EE8 A;  1WHQ A;  2L2N A;  2EN3 A;  4X8W A;  2L3J A;  3J7A G;  2RQL A;  3MSW A;  2RS6 A;  4BC7 A;  2EOY A;  2YTG A;  1J5E E;  2HGH A;  4L5N C;  3ADL A;  2V88 A;  1YFH A;  1G2F C;  2EM7 A;  1X48 A;  2N3H A;  2EPA A;  4DR4 E;  1YZ9 A;  4F2J C;  4M2Z A;  2GPI A;  1UBD C;  3L00 A;  2EM6 A;  2RTX A;  4LF5 E;  1TN9 A;  2EL6 A;  1WJP A;  4R2P A;  4DR1 E;  1BBG A;  2CT1 A;  2LTS A;  1T38 A;  3EPL A;  4BMJ A;  1XMQ E;  3EPH A;  2RS7 A;  2V85 A;  2YSP A;  2YTI A;  4F9A B;  3C4B A;  3M99 B;  3BBG A;  3JTZ A;  4X64 E;  2HC5 A;  2R76 A;  4LTY A;  1XMO E;  5F3W A;  4JI3 E;  4JI7 E;  2LVH A;  2LE2 A;  1X6E A;  2VQF E;  2EPR A;  2NUE A;  2K4V A;  2EN4 A;  3BGH A;  4WSG A;  2DLK A;  2EMI A;  4NXN E;  1X3C A;  5A6B A;  2N8X A;  4GKK E;  3LML A;  1PKP A;  3VYX A;  4DR6 E;  1IQO A;  2EN6 A;  2EMF A;  3HQ1 A;  2B9D A;  4AQY E;  3IWB A;  4DR3 E;  1HR0 E;  2H36 X;  1KJK A;  1YSA C;  3HTX A;  2HHH E;  2PRT A;  4M9V C;  1UHZ A;  4MLQ A;  3THN A;  1WHN A;  4DR5 E;  4LF4 E;  2L33 A;  1XNQ E;  1A1I A;  2MC5 A;  5IT9 C;  4DR2 E;  4WXD A;  2EM4 A;  2EMK A;  3C4T A;  3RMP A;  2EM0 A;  1PJT A;  2JY9 A;  2UXC E;  2EP3 A;  4O5G A;  2L2M A;  2MDR A;  1YPN A;  1PJQ A;  3C6M A;  4Q28 A;  5KL7 A;  4X9J A;  4JI5 E;  1EH8 A;  4WSP A;  2YWQ A;  5AE3 A;  4N4R B;  1T4N A;  1TF6 A;  2BB8 A;  2R1F A;  3DJW A;  1PJS A;  1I94 E;  2V83 A;  1JK1 A;  1YUJ A;  1RQ0 A;  2VE7 C;  1IBM E;  2B7T A;  2EM8 A;  2WCC 3;  5A6K A;  2L3C A;  2EMG A;  2NUG A;  2ENH A;  2VRD A;  2GHF A;  2YTN A;  3BID A;  1L4S A;  4ZYD A;  4I8O A;  3ADG A;  2JXP A;  2FTX B;  4OOG C;  5A69 A;  2EMW A;  4YY3 E;  2DRP A;  4R2Q A;  1PDA A;  3AUZ A;  4JI0 E;  2LTR A;  4DV7 E;  3OTO E;  1ZU1 A;  2A25 A;  2MKN A;  2YRK A;  4LFA E;  2UXB E;  4L8N A;  2LJU A;  3KZY A;  4F9C B;  1A1F A;  2EOQ A;  4O4K A;  3T1H E;  3TQM A;  2DLQ A;  4F9B B;  4B3R E;  5KL2 A;  2EOF A;  1MEY C;  2D9H A;  1TF3 A;  4R2S A;  3F6H A;  4M30 A;  2CTD A;  2EOE A;  4NZV A;  4WXC A;  5KL5 A;  4JYA E;  2EN1 A;  5A6J A;  4IJD A;  4BHB A;  1N34 E;  2UU9 E;  1N33 E;  5KL4 A;  4DR7 E;  1B69 A;  4LF6 E;  3ADJ A;  1LLM C;  2EPU A;  2UXD E;  2EMH A;  4IS1 C;  2CSH A;  2EL5 A;  2L8T A;  2E1M A;  2LCE A;  4X66 E;  5AC4 A;  2NAB A;  5AE2 A;  4J8Z A;  3HPS A;  2JPA A;  3IWD A;  1T4O A;  2EZ6 A;  2VQE E;  2M1S A;  2EOZ A;  2YU8 A;  4DV0 E;  2LBS B;  1HNX E;  5A2Q C;  4WPY A;  3JU0 A;  4DUY E;  4K0K E;  1ZR9 A;  2DB2 A;  2EOH A;  2GLI A;  3H09 A;  3KWR A;  1IBL E;  2YU5 A;  1YUI A;  3EPJ A;  2G7H A;  1GQE A;  1O0W A;  2EN7 A;  4F6N A;  2EMY A;  2B7V A;  2EPL X;  2RPC A;  2WBS A;  4LU9 A;  1A1H A;  4FK5 C;  4DKK A;  1UN6 B;  1Z1B A;  4DV1 E;  4DV4 E;  4JI6 E;  2ELY A;  4RH8 A;  1YYK A;  2EMX A;  5TSE A;  2ELZ A;  2M4I A;  2YSO A;  4B3S E;  4JV5 E;  2WZO A;  3T1Y E;  4LFB E;  3VHT B;  1BBO A;  5IXM B;  4BHC A;  2JOB A;  2ADR A;  2UUA E;  4BS9 A;  2EM2 A;  2ODR D;  5AE1 A;  3EQ1 A;  5LMU E;  1N3G A;  3VYY A;  1X47 A;  4ZYE A;  3HXL A;  2EJ4 A;  1X6H A;  2DSY A;  5LL6 R;  1STU A;  2V8Q B;  2EQ3 A;  4R2E A;  1YYW A;  2Q8U A;  1NEI A;  2EOR A;  2LJH A;  3HPZ A;  4GKJ E;  4HTG A;  2YTJ A;  4X65 E;  4O43 A;  5AAS A;  2EWL A;  4R2R A;  5LMN E;  1N36 E;  2EPK X;  4R03 A;  5KL3 A;  2DGC A;  4KWY A;  4NHR A;  2EMC A;  4JI1 E;  4Q35 B;  3ADI A;  2LMZ A;  5A6A A;  4LF7 E;  1G2D C;  3IWC A;  4R2C A;  1WXR A;  5BR8 E;  1FKA E;  2JWO A;  4M0V A;  1X6F A;  4BBY A;  1JK2 A;  2EMB A;  1EH6 A;  1QU6 A;  4O24 A;  2EPO A;  2JP9 A;  5IV8 B;  2ENA A;  2L92 A;  3LLH A;  1A1J A;  2V86 A;  4HEI A;  1FJG E;  1AH5 A;  4WYQ B;  4KZS A;  5T6J A;  2EN8 A;  1XNR E;  4JI2 E;  4KHP E;  3ECR A;  4RHB B;  3JAM C;  4YHH E;  3J81 C;  2MC6 A;  2IHR 1;  2L2K B;  1A1K A;  1DQ3 A;  1A1G A;  1ZBQ A;  2KOU A;  2EM9 A;  4X62 E;  2F4V E;  4F54 A;  2JR1 A;  2EPP A;  4TUI A;  1MGT A;  1SR9 A;  1T39 A;  2E72 A;  2YTE A;  2DIX A;  5DNY A;  2V87 A;  1X5W A;  2CPN A;  1J26 A;  4NXM E;  2DMI A;  1IQS A;  4LF8 E;  4GZN C;  2MDG A;  4MLV A;  4R2A A;  2F8B A;  2EOS A;  2HJJ A;  1ZAA C;  3J80 C;  2EPM X;  3C6K A;  1YYO A;  2ODR C;  4LF9 E;  2ENC A;  4BC9 A;  4JI8 E;  2V89 A;  2VF1 A;  1N32 E;  1AAY A;  2EOI A;  1RC7 A;  2K7I A;  2NUF A;  2WBT A;  2EQ0 A;  1HNW E;  2EPN A;  2EPZ A;  5CFF E;  2JYA A;  2YPN A;  1EH7 A;  5LLQ A;  3MHS C;  4JI4 E;  2YT4 A;  2YRM A;  3MHH C;  1WRJ A;  4P78 A;  2EOJ A;  2YTP A;  1GZ6 A;  4BCA A;  2B3T B;  2JOX A;  5FLX C;  3THO B;  5A6B D;  1IMU A;  3FIG A;  1EKZ A;  1SFE A;  4OX9 E;  2MKD A;  2EMZ A;  3OML A;  4WFT A;  2I13 A;  2ZM6 E;  1RMD A;  2EL4 A;  2J7J A;  2YTD A;  4P7D A;  2EN2 A;  4B3M E;  1KYQ A;  4DMI A;  2LUP B;  2YTO A;  2EML A;  2EOX A;  1HNZ E;  2KON A;  2LT7 A;  3J7Y p;  3KZZ A;  4DUZ E;  2E5L E;  2RSM A;  2FGG A;  3QG5 C;  2UUB E;  3P1X A;  2N3G A;  1BB8 A;  2M7Q A;  2EM3 A;  2NA2 A;  2EM5 A;  4WX9 A;  4ZYG A;  2EQ1 A;  3EPK A;  2KHX A;  2LUQ A;  1QNT A;  2EMA A;  1UIL A;  2LRS A;  2JVA A;  5ADZ A;  2EPX A;  4DV5 E;  2LV2 A;  2YTQ A;  4R2D A;  1ZBT A;  1T4L B;  2EPC A;  4DV2 E;  2M9A A;  5KL6 A;  2WBU A;  4F6M A;  2I9I A; 
#chains in the Genus database with same CATH homology
 2YRH A;  2EM0 A;  1DGC A;  2EP3 A;  3UK3 C;  1ZR9 A;  2EPP A;  2E72 A;  2YTE A;  2EOH A;  2YTF A;  2GLI A;  5KL7 A;  2YU5 A;  4X9J A;  3EPJ A;  1A1L A;  2EOM A;  1YUI A;  1NCS A;  1X5W A;  2RSI A;  1F2I G;  2DMI A;  4GZN C;  2MDG A;  4R2A A;  2EN7 A;  1TF6 A;  2EOS A;  4F6N A;  2BB8 A;  2EMY A;  2R1F A;  1ZAA C;  2LO3 A;  2EOO A;  2RPC A;  2WBS A;  1P47 A;  2ENC A;  1A1H A;  4FK5 C;  1UN6 B;  1JK1 A;  2EE8 A;  1Z1B A;  2EN3 A;  1YUJ A;  1AAY A;  2ELY A;  2EMX A;  2EM8 A;  2ELZ A;  2EOI A;  2YSO A;  2WCC 3;  2WBT A;  2EQ0 A;  2EMG A;  2EOY A;  2EPZ A;  2ENH A;  2YTG A;  2VRD A;  3VHT B;  2GHF A;  1BBO A;  2HGH A;  2YTN A;  2ADR A;  1G2F C;  2EM2 A;  2EM7 A;  2EPA A;  2EMW A;  3MHS C;  2EJ4 A;  1X6H A;  4F2J C;  2DRP A;  4R2Q A;  1UBD C;  2EQ3 A;  4R2E A;  2EM6 A;  2YRM A;  3MHH C;  2EOR A;  1ZU1 A;  1TN9 A;  2EL6 A;  2EOJ A;  1WJP A;  2YTP A;  4R2P A;  2A25 A;  2CT1 A;  2YTJ A;  2MKN A;  2YRK A;  4R2R A;  2DGC A;  5KL3 A;  3EPL A;  1A1F A;  2EOQ A;  2EMC A;  3EPH A;  2MKD A;  2YSP A;  2YTI A;  2EMZ A;  2DLQ A;  5KL2 A;  2EOF A;  3M99 B;  2I13 A;  1RMD A;  1MEY C;  2EL4 A;  2D9H A;  1TF3 A;  2J7J A;  2YTD A;  1G2D C;  2EN2 A;  4R2C A;  4R2S A;  2LVH A;  1X6E A;  2YTO A;  2EML A;  2EOX A;  2EPR A;  1X6F A;  2LT7 A;  2CTD A;  2EN4 A;  2EOE A;  1JK2 A;  5KL5 A;  2EMB A;  2DLK A;  4WSG A;  2EN1 A;  2EMI A;  4IJD A;  1X3C A;  2JP9 A;  1BB8 A;  5KL4 A;  2EM3 A;  2ENA A;  1B69 A;  2EN6 A;  1A1J A;  2EMF A;  1LLM C;  2EPU A;  2EM5 A;  2EMH A;  4IS1 C;  2CSH A;  2EQ1 A;  3EPK A;  1KJK A;  2EL5 A;  2EN8 A;  1YSA C;  2LCE A;  2PRT A;  2EMA A;  2NAB A;  4M9V C;  2EPX A;  2LV2 A;  2YTQ A;  4R2D A;  2JPA A;  2EPC A;  2EOZ A;  1A1I A;  2YU8 A;  2M9A A;  1A1K A;  2EM4 A;  1A1G A;  2EMK A;  5KL6 A;  2WBU A;  4F6M A;  2EM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...