2D9HA

Solution structure of the forth and fifth zf-c2h2 domains of zinc finger protein 692
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the forth and fifth zf-C2H2 domains of zinc finger protein 692
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Zinc finger protein 692
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2d9hA00
2VRDA 1A1JA 2I13A 2RSIA 3MHHC 2EM6A 1JK2A 4R2EA 4R2SA 2EMWA 2A25A 2EMLA 2WBSA 1YUIA 3EPLA 2EL4A 1ZU1A 2R1FA 2DLQA 2CSHA 2YTNA 2YSPA 1X6FA 1B69A 2NABA 2EPZA 4IJDA 2YTEA 2EMCA 1X5WA 4FK5C 2DLKA 2HGHA 2EL5A 1TN9A 4R2AA 2LVHA 5KL6A 2JP9A 1A1FA 2CTDA 5KL5A 2DRPA 2LT7A 1WJPA 2EORA 1UBDC 2EM8A 5KL2A 2YTJA 1X6HA 2EMZA 2EMGA 1F2IG 1A1IA 1KJKA 2EOMA 2EPAA 1A1HA 2J7JA 1ZR9A 4R2CA 2EOJA 2YTQA 2MKDA 4F2JC 5KL4A 4F6MA 2EM7A 2EOYA 1NCSA 2ADRA 1UN6B 2EOHA 2LO3A 4R2QA 2EM9A 1TF6A 1A1LA 2JPAA 1BBOA 3VHTB 2EM2A 4R2RA 2WBUA 2EPCA 2LV2A 2PRTA 1P47A 4F6NA 2EN1A 1MEYC 2EQ1A 1G2FC 2EM0A 2EQ0A 2YU5A 4IS1C 2EOSA 2YTIA 2EN7A 1YUJA 2EOOA 2EPUA 3UK3C 2YRKA 4M9VC 2EL6A 1DGCA 1TF3A 4R2DA 1A1GA 2ENHA 2EPPA 2EN3A 2E72A 2RPCA 2EMKA 1AAYA 2YSOA 2YRMA 3EPJA 2EMXA 2YTGA 2EOXA 4WSGA 2EPRA 2BB8A 2GHFA 2EN6A 2EOEA 5KL7A 2WBTA 1G2DC 1X6EA 2MDGA 2YRHA 1JK1A 4GZNC 1ZAAC 2EMHA 4R2PA 2ENAA 2GLIA 2DGCA 2EMFA 2YTFA 3EPKA 2YTPA 2EJ4A 1RMDA 2WCC3 2EN2A 2EOZA 2YU8A 3EPHA 2EM5A 2EE8A 2EMYA 2M9AA 2ELZA 4X9JA 2EMAA 2EPXA 1BB8A 2EMBA 2DMIA 2EP3A 1YSAC 2EOFA 3MHSC 2ENCA 3M99B 5KL3A 1LLMC 2EM4A 2EOQA 2ELYA 1A1KA 2EMIA 2YTDA 2EN8A 2D9HA 2LCEA 2EN4A 2YTOA 1Z1BA 2CT1A 2EM3A 2EQ3A 1X3CA 2EOIA 2MKNA
chains in the Genus database with same CATH superfamily
2VRDA 1T4OA 3ADJA 4DV5E 1QU6A 4X8WA 2NUGA 4JI0E 3MHHC 1GZ6A 4JI4E 3AV0A 1IMUA 1JK2A 2EPMX 4TUGA 3ZOQB 2EMWA 4JI8E 1IBME 1YUIA 4RH8A 1B69A 1GQEA 2JYAA 2YTEA 2YT4A 2LJUA 2EL5A 1TN9A 3T1HE 5KL6A 2JP9A 1WRJA 4LF5E 2LBSB 3F6HA 2LJHA 4KWYA 1A1HA 2J7JA 1ZR9A 4R03A 2F8BA 2MKDA 2RS6A 1YZ9A 1T39A 5KL4A 3HXLA 4DR6E 2EOHA 2DSYA 4R2QA 2EM9A 3IWCA 1HNWE 2B7TA 2EN1A 1PDAA 2V89A 2UUAE 2EOSA 2YTIA 4M9VC 3ADGA 4LFAE 1XNQE 1X49A 1HNXE 4AQYE 4JYAE 2ZM6E 5IWAE 2EMKA 5A6BD 3HPZA 2YTGA 2EOXA 3F6GA 2BB8A 2DIXA 4BS9A 1PJQA 2EN6A 2WBTA 2YRHA 2GPIA 4KHPE 1GTKA 2Q8UA 4MLVA 2EMFA 2EJ4A 4NXNE 1IBLE 4F54A 5AE3A 1WXRA 4F9AB 2LUPB 3EPHA 4BCAA 2EM5A 1FJGE 5T6JA 2EMYA 1PJTA 1IQOA 5F3WA 2V85A 2MDRA 3C4BA 3C4TA 4YY3E 5LMNE 2ELZA 2L2KB 4DV3E 2EOFA 1DQ3A 1LLMC 4LFCE 3HTXA 5IXMB 2V8QB 1SFEA 4RHBB 4NZVA 3RMPA 4DMIA 4B3RE 2L33A 1O0WA 2NUEA 1A1JA 4K0KE 4WXCA 2I13A 2HC5A 1PKPA 2M7QA 2RSIA 3LLHA 4R2EA 2RS7A 4OX9E 2EL4A 2R1FA 4B3SE 1ZBTA 4IJDA 1X5WA 2HGHA 2VQEE 2M4IA 3OMLA 2DRPA 1WJPA 4Q28A 3BBGA 2EM8A 5KL2A 2EMGA 1F2IG 4ZYGA 5AE1A 3AUZA 4Q35B 3K6QA 4R2CA 4WSPA 2N3GA 3JTZA 1IQSA 1UN6B 1TF6A 1A1LA 2JPAA 1RC7A 4NHRA 2UUBE 1P47A 4WYQB 4LF8E 2YU5A 1YUJA 3J80C 2YRKA 4X62E 3TQMA 2JR1A 1XMOE 2E5LE 2JWOA 2EPNA 2ENHA 2EPPA 2EN3A 2E72A 5DNYA 4DR7E 3ECRA 4JI5E 2M1SA 2YRMA 4LFBE 2EMXA 1WHNA 2FV4B 2K7IA 2L8TA 4X64E 4ZYDA 2EOEA 2N3HA 1N36E 4LU9A 4DR2E 1G2DC 1X6EA 2MDGA 3L00A 4M2ZA 1ZAAC 2DGCA 2V86A 2FTXB 2B3TB 3DJWA 1QNTA 3ADIA 1ZBQA 4BHCA 2M9AA 5IT9C 4LF6E 1UILA 4ZYHA 4GKJE 5A69A 2EMAA 2V88A 2DMYA 2JXPA 2L2NA 4M30A 1BB8A 5AC5A 3MHSC 2L92A 2ENCA 3M99B 4BBYA 4LF4E 3ADLA 4P78A 2EM4A 1EH7A 2ELYA 3EQ1A 2ODRC 4DV2E 4JI3E 2D9HA 2ODRD 3VK6A 1DI2A 1Z1BA 4B3ME 2EM3A 3THNA 2BBGA 1YFHA 1EH8A 1X3CA 2RTXA 2YWQA 2L2MA 2EWLA 2CPNA 4TUIA 2A25A 3EPLA 1X47A 1N34E 2DLQA 2CSHA 4M0VA 1X6FA 5ADZA 2NABA 4OOGC 2EPZA 3KZYA 4O5GA 2UUCE 5FLXC 4FK5C 4HTGA 5CFFE 4R2AA 2LVHA 2F4VE 1XNRE 5A6KA 2LT7A 2JVAA 1UBDC 2UXDE 2VQFE 4DR1E 3KWRA 1A1IA 1KJKA 2EOMA 2VE7C 2EOJA 2YTQA 4DV4E 5A6AA 4F2JC 1NEIA 5IV8B 2EM7A 3IWDA 2UXCE 1RQ0A 2EPOA 5LLQA 3VHTB 2EM2A 4R2RA 2PRTA 4F6NA 1MEYC 4JI2E 4HEIA 1J5EE 2UXBE 2G7HA 3UK3C 3QG5C 4KZSA 1T4LB 2EL6A 2FGGA 1DGCA 1TF3A 4R2DA 1A1GA 1HR0E 2EZ6A 4J8ZA 1EH6A 4JV5E 2RPCA 3BF2A 2IHR1 2E1MA 4JI1E 4X65E 2JOXA 2RSMA 2JY9A 1I94E 3DF6A 5A2QC 4WX9A 4DR4E 5KL7A 4WXDA 4GZNC 2ENAA 4BC7A 2GLIA 3J81C 2YTFA 2EPLX 3J7Yp 5A6BA 1RMDA 2WCC3 2EOZA 2YU8A 2LMZA 1EKZA 3VYXA 4L5NC 1XMQE 2EE8A 5AE2A 2YZTA 1KYQA 4LTYA 2EPXA 2EMBA 2DMIA 2DB2A 4WFTA 1YSAC 5KL3A 3P1XA 2WZOA 4O43A 1HNZE 4DUZE 2YTDA 4DR5E 4I8OA 5LL6R 2EN4A 3C6KA 3HQ1A 1N32E 2CT1A 4R8OA 2B7VA 2EOIA 4JI6E 4DKKA 2R76A 2VF1A 2LRSA 1PJSA 1T38A 4YHHE 3HPSA 4NXME 2EM6A 5BR8E 4R2SA 4WPYA 4O4KA 2EMLA 2WBSA 4DUYE 4B3TE 1ZU1A 2MC5A 3H09A 2YTNA 2YSPA 2YPNA 2EMCA 2DLKA 4L8NA 2LTSA 2HHHE 1A1FA 2CTDA 5KL5A 4DR3E 4ZYEA 1STUA 3MSWA 2EORA 4JI7E 2YTJA 3JU0A 1X6HA 2EMZA 2L6MA 3IWBA 2EPAA 1N3GA 1FKAE 1MGTA 4X66E 3J7AG 4BC9A 4GEQB 2HJJA 4F6MA 2EOYA 1YYOA 1NCSA 2ADRA 2MC6A 1YYWA 2LO3A 2LE2A 1BBOA 2WBUA 3C6MA 2EPCA 2LV2A 2EQ1A 4MLQA 1G2FC 2EM0A 2EQ0A 4IS1C 2KONA 1YYKA 3KZZA 2EN7A 2EOOA 2EPUA 2H36X 3LMLA 3T1YE 5TSEA 2NUFA 4LF9E 2K4VA 3VYYA 5AC4A 5A6JA 2N8XA 1X48A 2NA2A 1L4SA 1AAYA 2YSOA 3OTOE 3EPJA 5AASA 5LMUE 1IBKE 4WSGA 2EPRA 4BMJA 3BIDA 2RQLA 3FIGA 2GHFA 4F9BB 2V87A 1AH5A 4P7DA 4DV0E 1JK1A 2LUQA 1WHQA 2EMHA 4R2PA 1SR9A 4N4RB 3EPKA 2YTPA 4DV6E 2EN2A 2L3JA 4LF7E 4X9JA 2EPKX 1YPNA 4DV1E 2I9IA 2KHXA 3BGHA 4BHBA 2EP3A 4F9CB 1UHZA 4DV7E 2EOQA 1A1KA 2EMIA 3THOB 2EN8A 2LCEA 1T4NA 2YTOA 2L3CA 2V83A 2B9DA 4O24A 2JOBA 1BBGA 1N33E 2EQ3A 1J26A 4GKKE 2KOUA 2LTRA 3JAMC 2UU9E 2MKNA
chains in the Genus database with same CATH topology
2VRDA 1A1JA 2I13A 2RSIA 3MHHC 2EM6A 1JK2A 4R2EA 4R2SA 2EMWA 2A25A 2EMLA 2WBSA 1YUIA 3EPLA 2EL4A 1ZU1A 2R1FA 2DLQA 2CSHA 2YTNA 2YSPA 1X6FA 1B69A 2NABA 2EPZA 4IJDA 2YTEA 2EMCA 1X5WA 4FK5C 2DLKA 2HGHA 2EL5A 1TN9A 4R2AA 2LVHA 5KL6A 2JP9A 1A1FA 2CTDA 5KL5A 2DRPA 2LT7A 1WJPA 2EORA 1UBDC 2EM8A 5KL2A 2YTJA 1X6HA 2EMZA 2EMGA 1F2IG 1A1IA 1KJKA 2EOMA 2EPAA 1A1HA 2J7JA 1ZR9A 4R2CA 2EOJA 2YTQA 2MKDA 4F2JC 5KL4A 4F6MA 2EM7A 2EOYA 1NCSA 2ADRA 1UN6B 2EOHA 2LO3A 4R2QA 2EM9A 1TF6A 1A1LA 2JPAA 1BBOA 3VHTB 2EM2A 4R2RA 2WBUA 2EPCA 2LV2A 2PRTA 1P47A 4F6NA 2EN1A 1MEYC 2EQ1A 1G2FC 2EM0A 2EQ0A 2YU5A 4IS1C 2EOSA 2YTIA 2EN7A 1YUJA 2EOOA 2EPUA 3UK3C 2YRKA 4M9VC 2EL6A 1DGCA 1TF3A 4R2DA 1A1GA 2ENHA 2EPPA 2EN3A 2E72A 2RPCA 2EMKA 1AAYA 2YSOA 2YRMA 3EPJA 2EMXA 2YTGA 2EOXA 4WSGA 2EPRA 2BB8A 2GHFA 2EN6A 2EOEA 5KL7A 2WBTA 1G2DC 1X6EA 2MDGA 2YRHA 1JK1A 4GZNC 1ZAAC 2EMHA 4R2PA 2ENAA 2GLIA 2DGCA 2EMFA 2YTFA 3EPKA 2YTPA 2EJ4A 1RMDA 2WCC3 2EN2A 2EOZA 2YU8A 3EPHA 2EM5A 2EE8A 2EMYA 2M9AA 2ELZA 4X9JA 2EMAA 2EPXA 1BB8A 2EMBA 2DMIA 2EP3A 1YSAC 2EOFA 3MHSC 2ENCA 3M99B 5KL3A 1LLMC 2EM4A 2EOQA 2ELYA 1A1KA 2EMIA 2YTDA 2EN8A 2D9HA 2LCEA 2EN4A 2YTOA 1Z1BA 2CT1A 2EM3A 2EQ3A 1X3CA 2EOIA 2MKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRD A;  1A1J A;  2I13 A;  2RSI A;  3MHH C;  2EM6 A;  1JK2 A;  4R2E A;  4R2S A;  2EMW A;  2A25 A;  2EML A;  2WBS A;  1YUI A;  3EPL A;  2EL4 A;  1ZU1 A;  2R1F A;  2DLQ A;  2CSH A;  2YTN A;  2YSP A;  1X6F A;  1B69 A;  2NAB A;  2EPZ A;  4IJD A;  2YTE A;  2EMC A;  1X5W A;  4FK5 C;  2DLK A;  2HGH A;  2EL5 A;  1TN9 A;  4R2A A;  2LVH A;  5KL6 A;  2JP9 A;  1A1F A;  2CTD A;  5KL5 A;  2DRP A;  2LT7 A;  1WJP A;  2EOR A;  1UBD C;  2EM8 A;  5KL2 A;  2YTJ A;  1X6H A;  2EMZ A;  2EMG A;  1F2I G;  1A1I A;  1KJK A;  2EOM A;  2EPA A;  1A1H A;  2J7J A;  1ZR9 A;  4R2C A;  2EOJ A;  2YTQ A;  2MKD A;  4F2J C;  5KL4 A;  4F6M A;  2EM7 A;  2EOY A;  1NCS A;  2ADR A;  1UN6 B;  2EOH A;  2LO3 A;  4R2Q A;  2EM9 A;  1TF6 A;  1A1L A;  2JPA A;  1BBO A;  3VHT B;  2EM2 A;  4R2R A;  2WBU A;  2EPC A;  2LV2 A;  2PRT A;  1P47 A;  4F6N A;  2EN1 A;  1MEY C;  2EQ1 A;  1G2F C;  2EM0 A;  2EQ0 A;  2YU5 A;  4IS1 C;  2EOS A;  2YTI A;  2EN7 A;  1YUJ A;  2EOO A;  2EPU A;  3UK3 C;  2YRK A;  4M9V C;  2EL6 A;  1DGC A;  1TF3 A;  4R2D A;  1A1G A;  2ENH A;  2EPP A;  2EN3 A;  2E72 A;  2RPC A;  2EMK A;  1AAY A;  2YSO A;  2YRM A;  3EPJ A;  2EMX A;  2YTG A;  2EOX A;  4WSG A;  2EPR A;  2BB8 A;  2GHF A;  2EN6 A;  2EOE A;  5KL7 A;  2WBT A;  1G2D C;  1X6E A;  2MDG A;  2YRH A;  1JK1 A;  4GZN C;  1ZAA C;  2EMH A;  4R2P A;  2ENA A;  2GLI A;  2DGC A;  2EMF A;  2YTF A;  3EPK A;  2YTP A;  2EJ4 A;  1RMD A;  2WCC 3;  2EN2 A;  2EOZ A;  2YU8 A;  3EPH A;  2EM5 A;  2EE8 A;  2EMY A;  2M9A A;  2ELZ A;  4X9J A;  2EMA A;  2EPX A;  1BB8 A;  2EMB A;  2DMI A;  2EP3 A;  1YSA C;  2EOF A;  3MHS C;  2ENC A;  3M99 B;  5KL3 A;  1LLM C;  2EM4 A;  2EOQ A;  2ELY A;  1A1K A;  2EMI A;  2YTD A;  2EN8 A;  2D9H A;  2LCE A;  2EN4 A;  2YTO A;  1Z1B A;  2CT1 A;  2EM3 A;  2EQ3 A;  1X3C A;  2EOI A;  2MKN A; 
#chains in the Genus database with same CATH topology
 2VRD A;  1T4O A;  3ADJ A;  4DV5 E;  1QU6 A;  4X8W A;  2NUG A;  4JI0 E;  3MHH C;  1GZ6 A;  4JI4 E;  3AV0 A;  1IMU A;  1JK2 A;  2EPM X;  4TUG A;  3ZOQ B;  2EMW A;  4JI8 E;  1IBM E;  1YUI A;  4RH8 A;  1B69 A;  1GQE A;  2JYA A;  2YTE A;  2YT4 A;  2LJU A;  2EL5 A;  1TN9 A;  3T1H E;  5KL6 A;  2JP9 A;  1WRJ A;  4LF5 E;  2LBS B;  3F6H A;  2LJH A;  4KWY A;  1A1H A;  2J7J A;  1ZR9 A;  4R03 A;  2F8B A;  2MKD A;  2RS6 A;  1YZ9 A;  1T39 A;  5KL4 A;  3HXL A;  4DR6 E;  2EOH A;  2DSY A;  4R2Q A;  2EM9 A;  3IWC A;  1HNW E;  2B7T A;  2EN1 A;  1PDA A;  2V89 A;  2UUA E;  2EOS A;  2YTI A;  4M9V C;  3ADG A;  4LFA E;  1XNQ E;  1X49 A;  1HNX E;  4AQY E;  4JYA E;  2ZM6 E;  5IWA E;  2EMK A;  5A6B D;  3HPZ A;  2YTG A;  2EOX A;  3F6G A;  2BB8 A;  2DIX A;  4BS9 A;  1PJQ A;  2EN6 A;  2WBT A;  2YRH A;  2GPI A;  4KHP E;  1GTK A;  2Q8U A;  4MLV A;  2EMF A;  2EJ4 A;  4NXN E;  1IBL E;  4F54 A;  5AE3 A;  1WXR A;  4F9A B;  2LUP B;  3EPH A;  4BCA A;  2EM5 A;  1FJG E;  5T6J A;  2EMY A;  1PJT A;  1IQO A;  5F3W A;  2V85 A;  2MDR A;  3C4B A;  3C4T A;  4YY3 E;  5LMN E;  2ELZ A;  2L2K B;  4DV3 E;  2EOF A;  1DQ3 A;  1LLM C;  4LFC E;  3HTX A;  5IXM B;  2V8Q B;  1SFE A;  4RHB B;  4NZV A;  3RMP A;  4DMI A;  4B3R E;  2L33 A;  1O0W A;  2NUE A;  1A1J A;  4K0K E;  4WXC A;  2I13 A;  2HC5 A;  1PKP A;  2M7Q A;  2RSI A;  3LLH A;  4R2E A;  2RS7 A;  4OX9 E;  2EL4 A;  2R1F A;  4B3S E;  1ZBT A;  4IJD A;  1X5W A;  2HGH A;  2VQE E;  2M4I A;  3OML A;  2DRP A;  1WJP A;  4Q28 A;  3BBG A;  2EM8 A;  5KL2 A;  2EMG A;  1F2I G;  4ZYG A;  5AE1 A;  3AUZ A;  4Q35 B;  3K6Q A;  4R2C A;  4WSP A;  2N3G A;  3JTZ A;  1IQS A;  1UN6 B;  1TF6 A;  1A1L A;  2JPA A;  1RC7 A;  4NHR A;  2UUB E;  1P47 A;  4WYQ B;  4LF8 E;  2YU5 A;  1YUJ A;  3J80 C;  2YRK A;  4X62 E;  3TQM A;  2JR1 A;  1XMO E;  2E5L E;  2JWO A;  2EPN A;  2ENH A;  2EPP A;  2EN3 A;  2E72 A;  5DNY A;  4DR7 E;  3ECR A;  4JI5 E;  2M1S A;  2YRM A;  4LFB E;  2EMX A;  1WHN A;  2FV4 B;  2K7I A;  2L8T A;  4X64 E;  4ZYD A;  2EOE A;  2N3H A;  1N36 E;  4LU9 A;  4DR2 E;  1G2D C;  1X6E A;  2MDG A;  3L00 A;  4M2Z A;  1ZAA C;  2DGC A;  2V86 A;  2FTX B;  2B3T B;  3DJW A;  1QNT A;  3ADI A;  1ZBQ A;  4BHC A;  2M9A A;  5IT9 C;  4LF6 E;  1UIL A;  4ZYH A;  4GKJ E;  5A69 A;  2EMA A;  2V88 A;  2DMY A;  2JXP A;  2L2N A;  4M30 A;  1BB8 A;  5AC5 A;  3MHS C;  2L92 A;  2ENC A;  3M99 B;  4BBY A;  4LF4 E;  3ADL A;  4P78 A;  2EM4 A;  1EH7 A;  2ELY A;  3EQ1 A;  2ODR C;  4DV2 E;  4JI3 E;  2D9H A;  2ODR D;  3VK6 A;  1DI2 A;  1Z1B A;  4B3M E;  2EM3 A;  3THN A;  2BBG A;  1YFH A;  1EH8 A;  1X3C A;  2RTX A;  2YWQ A;  2L2M A;  2EWL A;  2CPN A;  4TUI A;  2A25 A;  3EPL A;  1X47 A;  1N34 E;  2DLQ A;  2CSH A;  4M0V A;  1X6F A;  5ADZ A;  2NAB A;  4OOG C;  2EPZ A;  3KZY A;  4O5G A;  2UUC E;  5FLX C;  4FK5 C;  4HTG A;  5CFF E;  4R2A A;  2LVH A;  2F4V E;  1XNR E;  5A6K A;  2LT7 A;  2JVA A;  1UBD C;  2UXD E;  2VQF E;  4DR1 E;  3KWR A;  1A1I A;  1KJK A;  2EOM A;  2VE7 C;  2EOJ A;  2YTQ A;  4DV4 E;  5A6A A;  4F2J C;  1NEI A;  5IV8 B;  2EM7 A;  3IWD A;  2UXC E;  1RQ0 A;  2EPO A;  5LLQ A;  3VHT B;  2EM2 A;  4R2R A;  2PRT A;  4F6N A;  1MEY C;  4JI2 E;  4HEI A;  1J5E E;  2UXB E;  2G7H A;  3UK3 C;  3QG5 C;  4KZS A;  1T4L B;  2EL6 A;  2FGG A;  1DGC A;  1TF3 A;  4R2D A;  1A1G A;  1HR0 E;  2EZ6 A;  4J8Z A;  1EH6 A;  4JV5 E;  2RPC A;  3BF2 A;  2IHR 1;  2E1M A;  4JI1 E;  4X65 E;  2JOX A;  2RSM A;  2JY9 A;  1I94 E;  3DF6 A;  5A2Q C;  4WX9 A;  4DR4 E;  5KL7 A;  4WXD A;  4GZN C;  2ENA A;  4BC7 A;  2GLI A;  3J81 C;  2YTF A;  2EPL X;  3J7Y p;  5A6B A;  1RMD A;  2WCC 3;  2EOZ A;  2YU8 A;  2LMZ A;  1EKZ A;  3VYX A;  4L5N C;  1XMQ E;  2EE8 A;  5AE2 A;  2YZT A;  1KYQ A;  4LTY A;  2EPX A;  2EMB A;  2DMI A;  2DB2 A;  4WFT A;  1YSA C;  5KL3 A;  3P1X A;  2WZO A;  4O43 A;  1HNZ E;  4DUZ E;  2YTD A;  4DR5 E;  4I8O A;  5LL6 R;  2EN4 A;  3C6K A;  3HQ1 A;  1N32 E;  2CT1 A;  4R8O A;  2B7V A;  2EOI A;  4JI6 E;  4DKK A;  2R76 A;  2VF1 A;  2LRS A;  1PJS A;  1T38 A;  4YHH E;  3HPS A;  4NXM E;  2EM6 A;  5BR8 E;  4R2S A;  4WPY A;  4O4K A;  2EML A;  2WBS A;  4DUY E;  4B3T E;  1ZU1 A;  2MC5 A;  3H09 A;  2YTN A;  2YSP A;  2YPN A;  2EMC A;  2DLK A;  4L8N A;  2LTS A;  2HHH E;  1A1F A;  2CTD A;  5KL5 A;  4DR3 E;  4ZYE A;  1STU A;  3MSW A;  2EOR A;  4JI7 E;  2YTJ A;  3JU0 A;  1X6H A;  2EMZ A;  2L6M A;  3IWB A;  2EPA A;  1N3G A;  1FKA E;  1MGT A;  4X66 E;  3J7A G;  4BC9 A;  4GEQ B;  2HJJ A;  4F6M A;  2EOY A;  1YYO A;  1NCS A;  2ADR A;  2MC6 A;  1YYW A;  2LO3 A;  2LE2 A;  1BBO A;  2WBU A;  3C6M A;  2EPC A;  2LV2 A;  2EQ1 A;  4MLQ A;  1G2F C;  2EM0 A;  2EQ0 A;  4IS1 C;  2KON A;  1YYK A;  3KZZ A;  2EN7 A;  2EOO A;  2EPU A;  2H36 X;  3LML A;  3T1Y E;  5TSE A;  2NUF A;  4LF9 E;  2K4V A;  3VYY A;  5AC4 A;  5A6J A;  2N8X A;  1X48 A;  2NA2 A;  1L4S A;  1AAY A;  2YSO A;  3OTO E;  3EPJ A;  5AAS A;  5LMU E;  1IBK E;  4WSG A;  2EPR A;  4BMJ A;  3BID A;  2RQL A;  3FIG A;  2GHF A;  4F9B B;  2V87 A;  1AH5 A;  4P7D A;  4DV0 E;  1JK1 A;  2LUQ A;  1WHQ A;  2EMH A;  4R2P A;  1SR9 A;  4N4R B;  3EPK A;  2YTP A;  4DV6 E;  2EN2 A;  2L3J A;  4LF7 E;  4X9J A;  2EPK X;  1YPN A;  4DV1 E;  2I9I A;  2KHX A;  3BGH A;  4BHB A;  2EP3 A;  4F9C B;  1UHZ A;  4DV7 E;  2EOQ A;  1A1K A;  2EMI A;  3THO B;  2EN8 A;  2LCE A;  1T4N A;  2YTO A;  2L3C A;  2V83 A;  2B9D A;  4O24 A;  2JOB A;  1BBG A;  1N33 E;  2EQ3 A;  1J26 A;  4GKK E;  2KOU A;  2LTR A;  3JAM C;  2UU9 E;  2MKN A; 
#chains in the Genus database with same CATH homology
 2VRD A;  1A1J A;  2I13 A;  2RSI A;  3MHH C;  2EM6 A;  1JK2 A;  4R2E A;  4R2S A;  2EMW A;  2A25 A;  2EML A;  2WBS A;  1YUI A;  3EPL A;  2EL4 A;  1ZU1 A;  2R1F A;  2DLQ A;  2CSH A;  2YTN A;  2YSP A;  1X6F A;  1B69 A;  2NAB A;  2EPZ A;  4IJD A;  2YTE A;  2EMC A;  1X5W A;  4FK5 C;  2DLK A;  2HGH A;  2EL5 A;  1TN9 A;  4R2A A;  2LVH A;  5KL6 A;  2JP9 A;  1A1F A;  2CTD A;  5KL5 A;  2DRP A;  2LT7 A;  1WJP A;  2EOR A;  1UBD C;  2EM8 A;  5KL2 A;  2YTJ A;  1X6H A;  2EMZ A;  2EMG A;  1F2I G;  1A1I A;  1KJK A;  2EOM A;  2EPA A;  1A1H A;  2J7J A;  1ZR9 A;  4R2C A;  2EOJ A;  2YTQ A;  2MKD A;  4F2J C;  5KL4 A;  4F6M A;  2EM7 A;  2EOY A;  1NCS A;  2ADR A;  1UN6 B;  2EOH A;  2LO3 A;  4R2Q A;  2EM9 A;  1TF6 A;  1A1L A;  2JPA A;  1BBO A;  3VHT B;  2EM2 A;  4R2R A;  2WBU A;  2EPC A;  2LV2 A;  2PRT A;  1P47 A;  4F6N A;  2EN1 A;  1MEY C;  2EQ1 A;  1G2F C;  2EM0 A;  2EQ0 A;  2YU5 A;  4IS1 C;  2EOS A;  2YTI A;  2EN7 A;  1YUJ A;  2EOO A;  2EPU A;  3UK3 C;  2YRK A;  4M9V C;  2EL6 A;  1DGC A;  1TF3 A;  4R2D A;  1A1G A;  2ENH A;  2EPP A;  2EN3 A;  2E72 A;  2RPC A;  2EMK A;  1AAY A;  2YSO A;  2YRM A;  3EPJ A;  2EMX A;  2YTG A;  2EOX A;  4WSG A;  2EPR A;  2BB8 A;  2GHF A;  2EN6 A;  2EOE A;  5KL7 A;  2WBT A;  1G2D C;  1X6E A;  2MDG A;  2YRH A;  1JK1 A;  4GZN C;  1ZAA C;  2EMH A;  4R2P A;  2ENA A;  2GLI A;  2DGC A;  2EMF A;  2YTF A;  3EPK A;  2YTP A;  2EJ4 A;  1RMD A;  2WCC 3;  2EN2 A;  2EOZ A;  2YU8 A;  3EPH A;  2EM5 A;  2EE8 A;  2EMY A;  2M9A A;  2ELZ A;  4X9J A;  2EMA A;  2EPX A;  1BB8 A;  2EMB A;  2DMI A;  2EP3 A;  1YSA C;  2EOF A;  3MHS C;  2ENC A;  3M99 B;  5KL3 A;  1LLM C;  2EM4 A;  2EOQ A;  2ELY A;  1A1K A;  2EMI A;  2YTD A;  2EN8 A;  2D9H A;  2LCE A;  2EN4 A;  2YTO A;  1Z1B A;  2CT1 A;  2EM3 A;  2EQ3 A;  1X3C A;  2EOI A;  2MKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...