2D9HA

Solution structure of the forth and fifth zf-c2h2 domains of zinc finger protein 692
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 692
publication title Solution structure of the forth and fifth zf-C2H2 domains of zinc finger protein 692
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2d9hA00
2EQ3A 2YU5A 4F6MA 2EM5A 2EMHA 2EN4A 2JPAA 2YSPA 4R2CA 1KJKA 2EPZA 2EM9A 2YTJA 1B69A 1BBOA 5KL4A 2LO3A 2EN2A 4R2EA 2EM0A 2LV2A 1A1LA 2D9HA 2EM7A 2YTFA 2DGCA 4M9VC 2EM2A 2EL5A 2EN1A 1A1JA 2DRPA 1TF3A 1NCSA 2WBUA 2EP3A 2EOYA 1G2FC 4WSGA 2RSIA 2EN6A 1TN9A 4X9JA 1X3CA 2RPCA 2EOXA 1X6FA 2E72A 2YTIA 2EPXA 1A1IA 2EOQA 4F6NA 2EOJA 2DLQA 2YTNA 2EMIA 2EMWA 2EOHA 2YTQA 2EQ0A 2GHFA 4R2PA 3EPHA 2EOSA 1ZU1A 1X5WA 5KL6A 2EOEA 2EPPA 2YU8A 1ZR9A 1A1GA 2J7JA 2EQ1A 2EL4A 1RMDA 2DMIA 2ENAA 4R2SA 2CT1A 1AAYA 1YUIA 2BB8A 1A1KA 2EMLA 2M9AA 1JK2A 2YTPA 2EL6A 1UBDC 4IJDA 3EPJA 2EM8A 1BB8A 2EMYA 2EMXA 1JK1A 2ELZA 2MKNA 2LCEA 2ENCA 1X6HA 2WBSA 2ENHA 2EOIA 5KL3A 4FK5C 4R2AA 2EN7A 2YSOA 5KL5A 2EMZA 2NABA 2EOZA 2EM6A 2EPRA 3UK3C 5KL2A 1Z1BA 1MEYC 4R2QA 2EOFA 2EOOA 1F2IG 3EPLA 2EMFA 3MHHC 2EM3A 2YTGA 2R1FA 2YRHA 2EORA 1YUJA 2LT7A 2DLKA 2EMGA 3M99B 4R2RA 1TF6A 1YSAC 3MHSC 2EPUA 2EN3A 2YRKA 4IS1C 2EMBA 2EOMA 1WJPA 2EE8A 2EPAA 2CTDA 4F2JC 1A1HA 5KL7A 2ELYA 2PRTA 1X6EA 2EMAA 1LLMC 1P47A 1UN6B 2EN8A 2WBTA 1G2DC 2YRMA 3EPKA 1DGCA 1ZAAC 2MKDA 2YTDA 3VHTB 4R2DA 2HGHA 2CSHA 2EMCA 2WCC3 2EMKA 2I13A 2VRDA 2A25A 2YTEA 2EJ4A 2MDGA 2JP9A 2YTOA 1A1FA 2EPCA 4GZNC 2ADRA 2EM4A 2LVHA 2GLIA
chains in the Genus database with same CATH superfamily
3JAMC 1GQEA 2EPZA 2UUCE 5LMUE 2EM0A 3J7AG 4X64E 2YTFA 4B3ME 4DR4E 4DR5E 4WPYA 5T6JA 4M30A 2EM2A 2UXDE 3HPZA 2DRPA 3DJWA 1TF3A 2WBUA 2EP3A 2LUPB 1G2FC 4WSGA 1FKAE 2EN6A 4GKJE 4R8OA 2L33A 4LF8E 2EOJA 2R76A 4F9CB 2I9IA 2YTQA 1MGTA 4JI3E 5LL6R 4R2PA 3EPHA 2FGGA 2Q8UA 4DR6E 4BHBA 3ADIA 2UXCE 2LJHA 1T4LB 5AE2A 1JK2A 2YTPA 3C4TA 1UBDC 5TSEA 1ZBTA 2LMZA 2EZ6A 1JK1A 5A2QC 3THOB 4F54A 2LJUA 4JI2E 1X6HA 2MDRA 2HHHE 1N3GA 2ENHA 3EQ1A 4NXNE 5AE3A 2HC5A 4FK5C 3ECRA 2JYAA 2YSOA 2NABA 4LF4E 4KZSA 5IXMB 5A6BA 1HR0E 4B3TE 1IMUA 1Z1BA 2EOOA 1F2IG 3MHHC 2YTGA 2BBGA 2EORA 1YYOA 2LT7A 2DLKA 2EMGA 2FTXB 4Q35B 1TF6A 2NUFA 3MHSC 2EPUA 2EN3A 2YRKA 4M2ZA 2EOMA 1XNQE 1WJPA 2RTXA 2EE8A 2HJJA 2EPOA 1RQ0A 1N36E 1IBLE 3HPSA 2KONA 2ELYA 3KZZA 1X6EA 1LLMC 2K4VA 2EN8A 4HEIA 2M1SA 2ZM6E 1ZBQA 4MLVA 4DV2E 3OTOE 1ZAAC 4TUIA 2L3JA 3C4BA 2MC5A 1IBKE 4R2DA 2HGHA 2CSHA 4TUGA 2WCC3 2YPNA 3VYYA 3RMPA 1T38A 2K7IA 4WXCA 2MDGA 2VF1A 1J5EE 2B3TB 2EQ3A 2YU5A 4DV0E 1YYKA 4WXDA 3KZYA 1KJKA 1B69A 2YT4A 5KL4A 5A6JA 2LO3A 2EN2A 5A6BD 4NZVA 2JXPA 4LF5E 1YZ9A 2EN1A 3QG5C 5IT9C 3F6GA 4JI8E 3J7Yp 2CPNA 1TN9A 4DV3E 4O43A 2RPCA 1X6FA 2B9DA 2JVAA 1A1IA 4JI1E 2E5LE 2EPKX 2YTNA 3KWRA 2EOHA 4ZYEA 2V85A 4AQYE 2GHFA 3LMLA 4LFBE 5KL6A 2UU9E 2LE2A 2YU8A 4GEQB 4DR1E 1ZR9A 4JI4E 4JI7E 4RH8A 2MC6A 1N32E 1EH6A 1RMDA 2L2MA 2ENAA 2CT1A 4B3SE 2BB8A 2EL6A 5A69A 1T39A 4IJDA 2LTSA 4P78A 2YWQA 2G7HA 2ELZA 2JWOA 2MKNA 2N8XA 4N4RB 2DMYA 5DNYA 1EH8A 1HNZE 2WBSA 2EOIA 2L2NA 4WX9A 2LTRA 5KL5A 2EMZA 4JYAE 2EM6A 2EPRA 2ODRD 2LUQA 3JTZA 1IBME 4BCAA 3ZOQB 5FLXC 2KHXA 1DQ3A 2NUEA 2EM3A 5LMNE 2UXBE 3ADGA 2DIXA 3BF2A 2KOUA 3BIDA 3M99B 1YSAC 4DV7E 1HNXE 2JOBA 4LFAE 4LTYA 4F2JC 1GTKA 2B7TA 2PRTA 1EKZA 2EMAA 3VK6A 2ODRC 1UN6B 1STUA 2YRMA 3EPKA 5ADZA 3FIGA 1QU6A 4YHHE 2EMCA 2I13A 4DV6E 4GKKE 2VRDA 2A25A 1X48A 2JP9A 1HNWE 2YTOA 1A1FA 2EPCA 1PJQA 2RS7A 4DR7E 4R03A 2IHR1 4F6MA 2EM5A 2EMHA 2EPLX 1QNTA 2EN4A 4JV5E 3VYXA 1I94E 4R2EA 2V88A 2LV2A 4X62E 1X49A 1A1LA 5AASA 4L8NA 3LLHA 3ADLA 2D9HA 1GZ6A 2EM7A 2NA2A 4BBYA 1J26A 3BBGA 2EL5A 2V89A 4B3RE 1L4SA 2L6MA 2EOYA 2N3HA 2RSIA 3P1XA 4NHRA 1RC7A 3J80C 1X3CA 1IQSA 2EOXA 2EPXA 2EOQA 2GPIA 4F6NA 2EWLA 2DLQA 2EMWA 3JU0A 3IWDA 2EQ0A 1DI2A 3J81C 1X5WA 4LF6E 1T4NA 4WSPA 2EQ1A 2DSYA 4DV4E 1T4OA 2DMIA 1AAYA 2EMLA 4DMIA 2EM8A 2LRSA 2EMYA 2M7QA 3EPJA 2LCEA 2ENCA 2B7VA 1N33E 1WRJA 4X8WA 1EH7A 5KL3A 1KYQA 4F9BB 4R2AA 4DKKA 1UHZA 2JR1A 2RSMA 2EOZA 2JY9A 3ADJA 3C6KA 5KL2A 1PJTA 3HQ1A 2EPNA 5IV8B 4R2QA 1WHNA 3OMLA 4BMJA 4DR3E 3EPLA 2EMFA 5BR8E 4OOGC 2R1FA 2YRHA 4M0VA 1FJGE 4ZYHA 1YUJA 3IWCA 4IS1C 3AUZA 2EMBA 1PJSA 4YY3E 2CTDA 1YFHA 2E1MA 3DF6A 2JOXA 3H09A 1P47A 3L00A 2WBTA 1X47A 1G2DC 4LF9E 1DGCA 4F9AB 4J8ZA 4K0KE 5AC4A 2FV4B 2MKDA 5A6AA 1XNRE 2EMKA 4RHBB 2ADRA 2LVHA 2GLIA 2F4VE 1UILA 3BGHA 2JPAA 2YSPA 4R2CA 5LLQA 2V86A 1WHQA 2EM9A 2YTJA 1WXRA 2F8BA 1BBOA 3AV0A 4ZYGA 2RS6A 4LF7E 2DGCA 4M9VC 3T1HE 4WFTA 1A1JA 1NCSA 2V83A 3C6MA 1PDAA 1O0WA 3IWBA 4ZYDA 4X9JA 2VQFE 2E72A 2YTIA 2UUBE 3HXLA 1XMQE 1N34E 4Q28A 2EMIA 2H36X 2VQEE 2VE7C 1YYWA 2EOSA 1ZU1A 2EOEA 2EPPA 4X65E 1A1GA 1IQOA 4O5GA 1BBGA 2J7JA 2EL4A 2L92A 5A6KA 1YUIA 2L8TA 4R2SA 4NXME 1A1KA 2M9AA 2EPMX 2YZTA 3MSWA 1BB8A 2EMXA 2L3CA 1XMOE 4OX9E 1SR9A 4KWYA 4O4KA 4BC7A 4DR2E 3K6QA 3THNA 4X66E 2N3GA 2EN7A 5IWAE 4HTGA 4MLQA 2L2KB 4LFCE 2NUGA 2UUAE 3UK3C 4DUYE 4O24A 4DUZE 1MEYC 4BS9A 1AH5A 2EOFA 4BHCA 4BC9A 1SFEA 5AE1A 1PKPA 4WYQB 4R2RA 2DB2A 4L5NC 4KHPE 2EPAA 3T1YE 1A1HA 1YPNA 4I8OA 5KL7A 4DV1E 4JI5E 3HTXA 4DV5E 2V87A 2V8QB 4LU9A 5F3WA 2RQLA 2YTDA 3TQMA 3VHTB 5AC5A 3F6HA 4JI6E 2YTEA 2EJ4A 1NEIA 2M4IA 4GZNC 4P7DA 2LBSB 4JI0E 2WZOA 2EM4A 5CFFE
chains in the Genus database with same CATH topology
2EQ3A 2YU5A 4F6MA 2EM5A 2EMHA 2EN4A 2JPAA 2YSPA 4R2CA 1KJKA 2EPZA 2EM9A 2YTJA 1B69A 1BBOA 5KL4A 2LO3A 2EN2A 4R2EA 2EM0A 2LV2A 1A1LA 2D9HA 2EM7A 2YTFA 2DGCA 4M9VC 2EM2A 2EL5A 2EN1A 1A1JA 2DRPA 1TF3A 1NCSA 2WBUA 2EP3A 2EOYA 1G2FC 4WSGA 2RSIA 2EN6A 1TN9A 4X9JA 1X3CA 2RPCA 2EOXA 1X6FA 2E72A 2YTIA 2EPXA 1A1IA 2EOQA 4F6NA 2EOJA 2DLQA 2YTNA 2EMIA 2EMWA 2EOHA 2YTQA 2EQ0A 2GHFA 4R2PA 3EPHA 2EOSA 1ZU1A 1X5WA 5KL6A 2EOEA 2EPPA 2YU8A 1ZR9A 1A1GA 2J7JA 2EQ1A 2EL4A 1RMDA 2DMIA 2ENAA 4R2SA 2CT1A 1AAYA 1YUIA 2BB8A 1A1KA 2EMLA 2M9AA 1JK2A 2YTPA 2EL6A 1UBDC 4IJDA 3EPJA 2EM8A 1BB8A 2EMYA 2EMXA 1JK1A 2ELZA 2MKNA 2LCEA 2ENCA 1X6HA 2WBSA 2ENHA 2EOIA 5KL3A 4FK5C 4R2AA 2EN7A 2YSOA 5KL5A 2EMZA 2NABA 2EOZA 2EM6A 2EPRA 3UK3C 5KL2A 1Z1BA 1MEYC 4R2QA 2EOFA 2EOOA 1F2IG 3EPLA 2EMFA 3MHHC 2EM3A 2YTGA 2R1FA 2YRHA 2EORA 1YUJA 2LT7A 2DLKA 2EMGA 3M99B 4R2RA 1TF6A 1YSAC 3MHSC 2EPUA 2EN3A 2YRKA 4IS1C 2EMBA 2EOMA 1WJPA 2EE8A 2EPAA 2CTDA 4F2JC 1A1HA 5KL7A 2ELYA 2PRTA 1X6EA 2EMAA 1LLMC 1P47A 1UN6B 2EN8A 2WBTA 1G2DC 2YRMA 3EPKA 1DGCA 1ZAAC 2MKDA 2YTDA 3VHTB 4R2DA 2HGHA 2CSHA 2EMCA 2WCC3 2EMKA 2I13A 2VRDA 2A25A 2YTEA 2EJ4A 2MDGA 2JP9A 2YTOA 1A1FA 2EPCA 4GZNC 2ADRA 2EM4A 2LVHA 2GLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ3 A;  2YU5 A;  4F6M A;  2EM5 A;  2EMH A;  2EN4 A;  2JPA A;  2YSP A;  4R2C A;  1KJK A;  2EPZ A;  2EM9 A;  2YTJ A;  1B69 A;  1BBO A;  5KL4 A;  2LO3 A;  2EN2 A;  4R2E A;  2EM0 A;  2LV2 A;  1A1L A;  2D9H A;  2EM7 A;  2YTF A;  2DGC A;  4M9V C;  2EM2 A;  2EL5 A;  2EN1 A;  1A1J A;  2DRP A;  1TF3 A;  1NCS A;  2WBU A;  2EP3 A;  2EOY A;  1G2F C;  4WSG A;  2RSI A;  2EN6 A;  1TN9 A;  4X9J A;  1X3C A;  2RPC A;  2EOX A;  1X6F A;  2E72 A;  2YTI A;  2EPX A;  1A1I A;  2EOQ A;  4F6N A;  2EOJ A;  2DLQ A;  2YTN A;  2EMI A;  2EMW A;  2EOH A;  2YTQ A;  2EQ0 A;  2GHF A;  4R2P A;  3EPH A;  2EOS A;  1ZU1 A;  1X5W A;  5KL6 A;  2EOE A;  2EPP A;  2YU8 A;  1ZR9 A;  1A1G A;  2J7J A;  2EQ1 A;  2EL4 A;  1RMD A;  2DMI A;  2ENA A;  4R2S A;  2CT1 A;  1AAY A;  1YUI A;  2BB8 A;  1A1K A;  2EML A;  2M9A A;  1JK2 A;  2YTP A;  2EL6 A;  1UBD C;  4IJD A;  3EPJ A;  2EM8 A;  1BB8 A;  2EMY A;  2EMX A;  1JK1 A;  2ELZ A;  2MKN A;  2LCE A;  2ENC A;  1X6H A;  2WBS A;  2ENH A;  2EOI A;  5KL3 A;  4FK5 C;  4R2A A;  2EN7 A;  2YSO A;  5KL5 A;  2EMZ A;  2NAB A;  2EOZ A;  2EM6 A;  2EPR A;  3UK3 C;  5KL2 A;  1Z1B A;  1MEY C;  4R2Q A;  2EOF A;  2EOO A;  1F2I G;  3EPL A;  2EMF A;  3MHH C;  2EM3 A;  2YTG A;  2R1F A;  2YRH A;  2EOR A;  1YUJ A;  2LT7 A;  2DLK A;  2EMG A;  3M99 B;  4R2R A;  1TF6 A;  1YSA C;  3MHS C;  2EPU A;  2EN3 A;  2YRK A;  4IS1 C;  2EMB A;  2EOM A;  1WJP A;  2EE8 A;  2EPA A;  2CTD A;  4F2J C;  1A1H A;  5KL7 A;  2ELY A;  2PRT A;  1X6E A;  2EMA A;  1LLM C;  1P47 A;  1UN6 B;  2EN8 A;  2WBT A;  1G2D C;  2YRM A;  3EPK A;  1DGC A;  1ZAA C;  2MKD A;  2YTD A;  3VHT B;  4R2D A;  2HGH A;  2CSH A;  2EMC A;  2WCC 3;  2EMK A;  2I13 A;  2VRD A;  2A25 A;  2YTE A;  2EJ4 A;  2MDG A;  2JP9 A;  2YTO A;  1A1F A;  2EPC A;  4GZN C;  2ADR A;  2EM4 A;  2LVH A;  2GLI A; 
#chains in the Genus database with same CATH topology
 3JAM C;  1GQE A;  2EPZ A;  2UUC E;  5LMU E;  2EM0 A;  3J7A G;  4X64 E;  2YTF A;  4B3M E;  4DR4 E;  4DR5 E;  4WPY A;  5T6J A;  4M30 A;  2EM2 A;  2UXD E;  3HPZ A;  2DRP A;  3DJW A;  1TF3 A;  2WBU A;  2EP3 A;  2LUP B;  1G2F C;  4WSG A;  1FKA E;  2EN6 A;  4GKJ E;  4R8O A;  2L33 A;  4LF8 E;  2EOJ A;  2R76 A;  4F9C B;  2I9I A;  2YTQ A;  1MGT A;  4JI3 E;  5LL6 R;  4R2P A;  3EPH A;  2FGG A;  2Q8U A;  4DR6 E;  4BHB A;  3ADI A;  2UXC E;  2LJH A;  1T4L B;  5AE2 A;  1JK2 A;  2YTP A;  3C4T A;  1UBD C;  5TSE A;  1ZBT A;  2LMZ A;  2EZ6 A;  1JK1 A;  5A2Q C;  3THO B;  4F54 A;  2LJU A;  4JI2 E;  1X6H A;  2MDR A;  2HHH E;  1N3G A;  2ENH A;  3EQ1 A;  4NXN E;  5AE3 A;  2HC5 A;  4FK5 C;  3ECR A;  2JYA A;  2YSO A;  2NAB A;  4LF4 E;  4KZS A;  5IXM B;  5A6B A;  1HR0 E;  4B3T E;  1IMU A;  1Z1B A;  2EOO A;  1F2I G;  3MHH C;  2YTG A;  2BBG A;  2EOR A;  1YYO A;  2LT7 A;  2DLK A;  2EMG A;  2FTX B;  4Q35 B;  1TF6 A;  2NUF A;  3MHS C;  2EPU A;  2EN3 A;  2YRK A;  4M2Z A;  2EOM A;  1XNQ E;  1WJP A;  2RTX A;  2EE8 A;  2HJJ A;  2EPO A;  1RQ0 A;  1N36 E;  1IBL E;  3HPS A;  2KON A;  2ELY A;  3KZZ A;  1X6E A;  1LLM C;  2K4V A;  2EN8 A;  4HEI A;  2M1S A;  2ZM6 E;  1ZBQ A;  4MLV A;  4DV2 E;  3OTO E;  1ZAA C;  4TUI A;  2L3J A;  3C4B A;  2MC5 A;  1IBK E;  4R2D A;  2HGH A;  2CSH A;  4TUG A;  2WCC 3;  2YPN A;  3VYY A;  3RMP A;  1T38 A;  2K7I A;  4WXC A;  2MDG A;  2VF1 A;  1J5E E;  2B3T B;  2EQ3 A;  2YU5 A;  4DV0 E;  1YYK A;  4WXD A;  3KZY A;  1KJK A;  1B69 A;  2YT4 A;  5KL4 A;  5A6J A;  2LO3 A;  2EN2 A;  5A6B D;  4NZV A;  2JXP A;  4LF5 E;  1YZ9 A;  2EN1 A;  3QG5 C;  5IT9 C;  3F6G A;  4JI8 E;  3J7Y p;  2CPN A;  1TN9 A;  4DV3 E;  4O43 A;  2RPC A;  1X6F A;  2B9D A;  2JVA A;  1A1I A;  4JI1 E;  2E5L E;  2EPK X;  2YTN A;  3KWR A;  2EOH A;  4ZYE A;  2V85 A;  4AQY E;  2GHF A;  3LML A;  4LFB E;  5KL6 A;  2UU9 E;  2LE2 A;  2YU8 A;  4GEQ B;  4DR1 E;  1ZR9 A;  4JI4 E;  4JI7 E;  4RH8 A;  2MC6 A;  1N32 E;  1EH6 A;  1RMD A;  2L2M A;  2ENA A;  2CT1 A;  4B3S E;  2BB8 A;  2EL6 A;  5A69 A;  1T39 A;  4IJD A;  2LTS A;  4P78 A;  2YWQ A;  2G7H A;  2ELZ A;  2JWO A;  2MKN A;  2N8X A;  4N4R B;  2DMY A;  5DNY A;  1EH8 A;  1HNZ E;  2WBS A;  2EOI A;  2L2N A;  4WX9 A;  2LTR A;  5KL5 A;  2EMZ A;  4JYA E;  2EM6 A;  2EPR A;  2ODR D;  2LUQ A;  3JTZ A;  1IBM E;  4BCA A;  3ZOQ B;  5FLX C;  2KHX A;  1DQ3 A;  2NUE A;  2EM3 A;  5LMN E;  2UXB E;  3ADG A;  2DIX A;  3BF2 A;  2KOU A;  3BID A;  3M99 B;  1YSA C;  4DV7 E;  1HNX E;  2JOB A;  4LFA E;  4LTY A;  4F2J C;  1GTK A;  2B7T A;  2PRT A;  1EKZ A;  2EMA A;  3VK6 A;  2ODR C;  1UN6 B;  1STU A;  2YRM A;  3EPK A;  5ADZ A;  3FIG A;  1QU6 A;  4YHH E;  2EMC A;  2I13 A;  4DV6 E;  4GKK E;  2VRD A;  2A25 A;  1X48 A;  2JP9 A;  1HNW E;  2YTO A;  1A1F A;  2EPC A;  1PJQ A;  2RS7 A;  4DR7 E;  4R03 A;  2IHR 1;  4F6M A;  2EM5 A;  2EMH A;  2EPL X;  1QNT A;  2EN4 A;  4JV5 E;  3VYX A;  1I94 E;  4R2E A;  2V88 A;  2LV2 A;  4X62 E;  1X49 A;  1A1L A;  5AAS A;  4L8N A;  3LLH A;  3ADL A;  2D9H A;  1GZ6 A;  2EM7 A;  2NA2 A;  4BBY A;  1J26 A;  3BBG A;  2EL5 A;  2V89 A;  4B3R E;  1L4S A;  2L6M A;  2EOY A;  2N3H A;  2RSI A;  3P1X A;  4NHR A;  1RC7 A;  3J80 C;  1X3C A;  1IQS A;  2EOX A;  2EPX A;  2EOQ A;  2GPI A;  4F6N A;  2EWL A;  2DLQ A;  2EMW A;  3JU0 A;  3IWD A;  2EQ0 A;  1DI2 A;  3J81 C;  1X5W A;  4LF6 E;  1T4N A;  4WSP A;  2EQ1 A;  2DSY A;  4DV4 E;  1T4O A;  2DMI A;  1AAY A;  2EML A;  4DMI A;  2EM8 A;  2LRS A;  2EMY A;  2M7Q A;  3EPJ A;  2LCE A;  2ENC A;  2B7V A;  1N33 E;  1WRJ A;  4X8W A;  1EH7 A;  5KL3 A;  1KYQ A;  4F9B B;  4R2A A;  4DKK A;  1UHZ A;  2JR1 A;  2RSM A;  2EOZ A;  2JY9 A;  3ADJ A;  3C6K A;  5KL2 A;  1PJT A;  3HQ1 A;  2EPN A;  5IV8 B;  4R2Q A;  1WHN A;  3OML A;  4BMJ A;  4DR3 E;  3EPL A;  2EMF A;  5BR8 E;  4OOG C;  2R1F A;  2YRH A;  4M0V A;  1FJG E;  4ZYH A;  1YUJ A;  3IWC A;  4IS1 C;  3AUZ A;  2EMB A;  1PJS A;  4YY3 E;  2CTD A;  1YFH A;  2E1M A;  3DF6 A;  2JOX A;  3H09 A;  1P47 A;  3L00 A;  2WBT A;  1X47 A;  1G2D C;  4LF9 E;  1DGC A;  4F9A B;  4J8Z A;  4K0K E;  5AC4 A;  2FV4 B;  2MKD A;  5A6A A;  1XNR E;  2EMK A;  4RHB B;  2ADR A;  2LVH A;  2GLI A;  2F4V E;  1UIL A;  3BGH A;  2JPA A;  2YSP A;  4R2C A;  5LLQ A;  2V86 A;  1WHQ A;  2EM9 A;  2YTJ A;  1WXR A;  2F8B A;  1BBO A;  3AV0 A;  4ZYG A;  2RS6 A;  4LF7 E;  2DGC A;  4M9V C;  3T1H E;  4WFT A;  1A1J A;  1NCS A;  2V83 A;  3C6M A;  1PDA A;  1O0W A;  3IWB A;  4ZYD A;  4X9J A;  2VQF E;  2E72 A;  2YTI A;  2UUB E;  3HXL A;  1XMQ E;  1N34 E;  4Q28 A;  2EMI A;  2H36 X;  2VQE E;  2VE7 C;  1YYW A;  2EOS A;  1ZU1 A;  2EOE A;  2EPP A;  4X65 E;  1A1G A;  1IQO A;  4O5G A;  1BBG A;  2J7J A;  2EL4 A;  2L92 A;  5A6K A;  1YUI A;  2L8T A;  4R2S A;  4NXM E;  1A1K A;  2M9A A;  2EPM X;  2YZT A;  3MSW A;  1BB8 A;  2EMX A;  2L3C A;  1XMO E;  4OX9 E;  1SR9 A;  4KWY A;  4O4K A;  4BC7 A;  4DR2 E;  3K6Q A;  3THN A;  4X66 E;  2N3G A;  2EN7 A;  5IWA E;  4HTG A;  4MLQ A;  2L2K B;  4LFC E;  2NUG A;  2UUA E;  3UK3 C;  4DUY E;  4O24 A;  4DUZ E;  1MEY C;  4BS9 A;  1AH5 A;  2EOF A;  4BHC A;  4BC9 A;  1SFE A;  5AE1 A;  1PKP A;  4WYQ B;  4R2R A;  2DB2 A;  4L5N C;  4KHP E;  2EPA A;  3T1Y E;  1A1H A;  1YPN A;  4I8O A;  5KL7 A;  4DV1 E;  4JI5 E;  3HTX A;  4DV5 E;  2V87 A;  2V8Q B;  4LU9 A;  5F3W A;  2RQL A;  2YTD A;  3TQM A;  3VHT B;  5AC5 A;  3F6H A;  4JI6 E;  2YTE A;  2EJ4 A;  1NEI A;  2M4I A;  4GZN C;  4P7D A;  2LBS B;  4JI0 E;  2WZO A;  2EM4 A;  5CFF E; 
#chains in the Genus database with same CATH homology
 2EQ3 A;  2YU5 A;  4F6M A;  2EM5 A;  2EMH A;  2EN4 A;  2JPA A;  2YSP A;  4R2C A;  1KJK A;  2EPZ A;  2EM9 A;  2YTJ A;  1B69 A;  1BBO A;  5KL4 A;  2LO3 A;  2EN2 A;  4R2E A;  2EM0 A;  2LV2 A;  1A1L A;  2D9H A;  2EM7 A;  2YTF A;  2DGC A;  4M9V C;  2EM2 A;  2EL5 A;  2EN1 A;  1A1J A;  2DRP A;  1TF3 A;  1NCS A;  2WBU A;  2EP3 A;  2EOY A;  1G2F C;  4WSG A;  2RSI A;  2EN6 A;  1TN9 A;  4X9J A;  1X3C A;  2RPC A;  2EOX A;  1X6F A;  2E72 A;  2YTI A;  2EPX A;  1A1I A;  2EOQ A;  4F6N A;  2EOJ A;  2DLQ A;  2YTN A;  2EMI A;  2EMW A;  2EOH A;  2YTQ A;  2EQ0 A;  2GHF A;  4R2P A;  3EPH A;  2EOS A;  1ZU1 A;  1X5W A;  5KL6 A;  2EOE A;  2EPP A;  2YU8 A;  1ZR9 A;  1A1G A;  2J7J A;  2EQ1 A;  2EL4 A;  1RMD A;  2DMI A;  2ENA A;  4R2S A;  2CT1 A;  1AAY A;  1YUI A;  2BB8 A;  1A1K A;  2EML A;  2M9A A;  1JK2 A;  2YTP A;  2EL6 A;  1UBD C;  4IJD A;  3EPJ A;  2EM8 A;  1BB8 A;  2EMY A;  2EMX A;  1JK1 A;  2ELZ A;  2MKN A;  2LCE A;  2ENC A;  1X6H A;  2WBS A;  2ENH A;  2EOI A;  5KL3 A;  4FK5 C;  4R2A A;  2EN7 A;  2YSO A;  5KL5 A;  2EMZ A;  2NAB A;  2EOZ A;  2EM6 A;  2EPR A;  3UK3 C;  5KL2 A;  1Z1B A;  1MEY C;  4R2Q A;  2EOF A;  2EOO A;  1F2I G;  3EPL A;  2EMF A;  3MHH C;  2EM3 A;  2YTG A;  2R1F A;  2YRH A;  2EOR A;  1YUJ A;  2LT7 A;  2DLK A;  2EMG A;  3M99 B;  4R2R A;  1TF6 A;  1YSA C;  3MHS C;  2EPU A;  2EN3 A;  2YRK A;  4IS1 C;  2EMB A;  2EOM A;  1WJP A;  2EE8 A;  2EPA A;  2CTD A;  4F2J C;  1A1H A;  5KL7 A;  2ELY A;  2PRT A;  1X6E A;  2EMA A;  1LLM C;  1P47 A;  1UN6 B;  2EN8 A;  2WBT A;  1G2D C;  2YRM A;  3EPK A;  1DGC A;  1ZAA C;  2MKD A;  2YTD A;  3VHT B;  4R2D A;  2HGH A;  2CSH A;  2EMC A;  2WCC 3;  2EMK A;  2I13 A;  2VRD A;  2A25 A;  2YTE A;  2EJ4 A;  2MDG A;  2JP9 A;  2YTO A;  1A1F A;  2EPC A;  4GZN C;  2ADR A;  2EM4 A;  2LVH A;  2GLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...