2DLKA

Solution structure of the first and the second zf-c2h2 domains of zinc finger protein 692
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
GSSGSSGMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords novel protein
publication title Solution structure of the first and the second zf-C2H2 domains of zinc finger protein 692
rcsb
source organism Homo sapiens
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA01
2YTEA 1RMDA 2EQ0A 2PRTA 5KL2A 2BB8A 1P47A 2J7JA 5KL5A 2ELYA 1KJKA 2EOEA 2EOQA 2MKDA 2YTIA 1ZAAC 2EMFA 2EL6A 2EMLA 2EOMA 2EN6A 2EMGA 2JP9A 2EMHA 2EM8A 3EPKA 2EN7A 2A25A 2DRPA 1BBOA 2EMCA 2VRDA 2I13A 2YTNA 2WBTA 1B69A 2YTPA 2ENCA 2EOIA 3UK3C 1UN6B 2ADRA 3EPLA 3EPHA 3VHTB 2EPPA 4X9JA 1A1GA 1A1HA 2EQ3A 1MEYC 2D9HA 1YUIA 2MDGA 4R2SA 2DLKA 2LV2A 2YRKA 4FK5C 2ELZA 2EOYA 2ENHA 4GZNC 2GLIA 2EPRA 2YTQA 3EPJA 2EM2A 4R2EA 1TF3A 2HGHA 4WSGA 2EN4A 2EOOA 2MKNA 2WBUA 2CSHA 2EM3A 2EMWA 1BB8A 5KL4A 2YTDA 1A1IA 4IS1C 2EMYA 2EPZA 1JK1A 2EPUA 4R2CA 2YU5A 4R2DA 2EMKA 1A1FA 4F6NA 1NCSA 2EM6A 1JK2A 2JPAA 2EPCA 4R2RA 2DMIA 1YUJA 2CTDA 4F2JC 5KL7A 1X6HA 4R2AA 1AAYA 2EM0A 4M9VC 2DGCA 2YTJA 2EMAA 1X6FA 4IJDA 2LVHA 2EN8A 2YRMA 2EN1A 3M99B 2M9AA 1A1JA 2ENAA 3MHSC 2YU8A 2EJ4A 2NABA 2RPCA 4R2PA 1X3CA 1ZR9A 2EMXA 2EQ1A 2EOZA 1X5WA 1ZU1A 2EM5A 4R2QA 1G2FC 2EP3A 1WJPA 2EORA 1A1LA 2DLQA 2EOJA 2EM9A 2EPAA 2EMBA 1F2IG 2EL4A 2YTGA 2WCC3 4F6MA 1TN9A 2EOXA 2E72A 2R1FA 2WBSA 2EM4A 2LCEA 2YRHA 3MHHC 2YSOA 1YSAC 2GHFA 2YSPA 2CT1A 5KL3A 2EOSA 2EN2A 1Z1BA 2EM7A 2LT7A 1G2DC 1TF6A 2EL5A 2EOFA 2EMZA 2RSIA 2YTFA 1UBDC 2YTOA 5KL6A 1A1KA 2LO3A 2EOHA 1X6EA 1DGCA 2EE8A 2EPXA 2EMIA 2EN3A 1LLMC
chains in the Genus database with same CATH superfamily
5AC5A 2PRTA 2LJHA 2V88A 2NUFA 2KONA 2EPMX 3IWDA 2MKDA 2EPOA 1BBGA 2YTIA 5A2QC 2FTXB 2JWOA 4NXME 2EL6A 2JVAA 2EN6A 3C4BA 2EMGA 2DB2A 2JP9A 1HNZE 4ZYGA 2EM8A 2LTRA 4GKJE 2L2NA 3EPKA 1PJQA 2A25A 2EMCA 2VRDA 2WBTA 1B69A 2MC5A 2ENCA 4DUYE 1A1GA 3JAMC 4ZYDA 1J5EE 4LF4E 4RH8A 4DUZE 2MDGA 2RS6A 4LFBE 5F3WA 4M0VA 4R2SA 4MLVA 1T4LB 2LV2A 2K4VA 1EH8A 3EPJA 2EM2A 4WXCA 2MKNA 3KZZA 3BIDA 2EM3A 1A1IA 4IS1C 2EPZA 2EPUA 4R2CA 2YU5A 3HPSA 2LTSA 2EMKA 4WYQB 4LU9A 1NCSA 2EPKX 2LE2A 1PKPA 3VYXA 1JK2A 2I9IA 1IQSA 4DV3E 1X6HA 4BHBA 4R2AA 4DR3E 3RMPA 2G7HA 4DV6E 2LUPB 1X6FA 1T39A 1T38A 4O4KA 2EN1A 4DR1E 1A1JA 2ENAA 3HPZA 5AE3A 2EJ4A 1I94E 2BBGA 3THNA 3AUZA 1ZU1A 2EP3A 3DF6A 1F2IG 2N8XA 2EL4A 5A6KA 2WCC3 4F6MA 1TN9A 2UU9E 4BCAA 2EM4A 4P78A 2IHR1 2YZTA 3MHHC 2YSOA 2UXDE 1Z1BA 2CT1A 5KL3A 2EOSA 2EN2A 2V86A 2EM7A 1X47A 2YWQA 1G2DC 2RSIA 2R76A 4F9AB 4NZVA 1UBDC 2YTOA 2ODRD 1IQOA 4DKKA 1O0WA 2N3HA 2JOBA 4O24A 2EOHA 4DR7E 2M4IA 1DGCA 4R03A 4Q35B 2L2MA 2EPXA 2EMIA 1LLMC 2YTEA 2EQ0A 4F54A 2J7JA 4L5NC 2EOQA 2KOUA 1ZAAC 1T4OA 4M30A 2L3JA 3C6MA 5A6BA 3ADLA 1PJTA 2JXPA 2DRPA 4B3SE 2B7TA 3QG5C 2YTNA 2CPNA 2YTPA 3JU0A 3UK3C 1UN6B 4X9JA 1SR9A 3J7AG 1L4SA 4R8OA 2D9HA 4DR2E 1YUIA 1DI2A 3IWCA 1HNWE 4JI8E 4B3TE 4M2ZA 2YRKA 3ADJA 4JI2E 1N34E 4F9BB 2GLIA 4JV5E 4LF6E 2HGHA 1XNQE 2WBUA 2L92A 1N32E 3KWRA 2JR1A 2V8QB 4JI5E 5TSEA 2EM6A 4R2RA 2DMIA 1YYWA 4GKKE 5IXMB 4DMIA 4F2JC 1YYKA 2NUGA 5LMNE 2EM0A 2EPLX 4JI6E 1N36E 4M9VC 4LF5E 4LF7E 4HEIA 2DGCA 2L8TA 4O5GA 1SFEA 1FKAE 2LVHA 2EN8A 5A6AA 2M9AA 3MSWA 2YU8A 3OMLA 2VQEE 2RPCA 2EOZA 3L00A 2EMXA 2EQ1A 4DR6E 3BBGA 1G2FC 1ZBQA 2EORA 2EOJA 2EPAA 4WX9A 3EQ1A 2UUBE 1WHQA 2F8BA 3THOB 5A6BD 1HNXE 2E72A 4N4RB 1MGTA 5IV8B 2HJJA 2LCEA 2LJUA 2B3TB 1YSAC 2EZ6A 2GHFA 3ZOQB 2EL5A 2EOFA 2YTFA 1N33E 4YHHE 2B7VA 4DV0E 1WHNA 2LO3A 4LF9E 2VQFE 1X6EA 4ZYHA 4LFAE 1UHZA 2EN3A 1YPNA 1RMDA 2ELYA 4LFCE 2LUQA 2FV4B 2JY9A 2EMFA 3HXLA 4NHRA 1NEIA 2EOMA 3J81C 4X8WA 3C4TA 2EN7A 1YYOA 1XMQE 3EPLA 3VHTB 2EPPA 4DR5E 1A1HA 1MEYC 2NUEA 2FGGA 4KWYA 4NXNE 4O43A 4GEQB 4J8ZA 4BBYA 1WXRA 2E1MA 1IBKE 1EKZA 3TQMA 2LRSA 2LBSB 2EOYA 2ENHA 2V85A 4GZNC 2EPRA 2YTQA 4Q28A 5BR8E 3H09A 4WSGA 2EOOA 4DV7E 4I8OA 2CSHA 1BB8A 2YTDA 4TUIA 2EMYA 2RQLA 2F4VE 1N3GA 2MDRA 1A1FA 4F6NA 3ADIA 2UXCE 2EPNA 1WRJA 2EPCA 1YUJA 2VF1A 3VYYA 1GQEA 5KL7A 3AV0A 2YTJA 5T6JA 5AC4A 2EMAA 3M99B 4WPYA 4YY3E 1FJGE 4WFTA 4P7DA 3T1YE 4JI4E 3OTOE 1STUA 2L6MA 2L2KB 2DLQA 2EM9A 2EMBA 1ZBTA 2M7QA 1XNRE 2JOXA 2RSMA 1EH7A 1YZ9A 3P1XA 2EOXA 1QNTA 2K7IA 2WBSA 1AH5A 3F6HA 4L8NA 1X49A 2LT7A 3JTZA 4LF8E 1IBLE 1XMOE 2HC5A 3J7Yp 1A1KA 5AE2A 2GPIA 2V87A 2DIXA 2VE7C 4ZYEA 2EE8A 5FLXC 5LL6R 2MC6A 3J80C 4OOGC 4BHCA 4OX9E 1DQ3A 2LMZA 5AE1A 3ADGA 2BB8A 4BMJA 4F9CB 2H36X 4KZSA 5KL2A 4X64E 5KL5A 1P47A 1KJKA 2EOEA 3C6KA 4RHBB 1YFHA 4WSPA 2EMLA 5IWAE 5DNYA 3K6QA 1RC7A 5AASA 2EMHA 1IMUA 2DMYA 2RS7A 1BBOA 2I13A 4DV4E 3EPHA 2EOIA 2ADRA 3T1HE 2WZOA 4KHPE 2EQ3A 2E5LE 4DV1E 4JI7E 1HR0E 4BC7A 1X48A 2NA2A 2DLKA 4X65E 4FK5C 2ELZA 2N3GA 1QU6A 5ADZA 1PJSA 1TF3A 4MLQA 4R2EA 2ODRC 2EN4A 2EWLA 1J26A 1EH6A 2EMWA 5KL4A 1UILA 1PDAA 3HTXA 5IT9C 4DV5E 2M1SA 2RTXA 1JK1A 2L3CA 4JI3E 3KZYA 4R2DA 5A69A 2JYAA 4X62E 2YPNA 3BGHA 2JPAA 3LMLA 2CTDA 3BF2A 3VK6A 4JI0E 1AAYA 2UUCE 1T4NA 4IJDA 4BC9A 2YRMA 5LMUE 3MHSC 4LTYA 2NABA 2DSYA 2UUAE 4R2PA 1X3CA 1ZR9A 1X5WA 4TUGA 2EM5A 2V89A 4R2QA 2KHXA 4B3ME 1WJPA 1A1LA 1GTKA 2V83A 4JYAE 3IWBA 2YTGA 3HQ1A 4BS9A 4K0KE 2L33A 4DR4E 1RQ0A 2ZM6E 2R1FA 3DJWA 3LLHA 4WXDA 2Q8UA 2YRHA 4JI1E 1GZ6A 3F6GA 2YSPA 1TF6A 3FIGA 4DV2E 2EMZA 4HTGA 4AQYE 2UXBE 4X66E 5KL6A 5A6JA 1IBME 2HHHE 2B9DA 4B3RE 3ECRA 5LLQA 2YT4A 5CFFE 1KYQA
chains in the Genus database with same CATH topology
2YTEA 1RMDA 2EQ0A 2PRTA 5KL2A 2BB8A 1P47A 2J7JA 5KL5A 2ELYA 1KJKA 2EOEA 2EOQA 2MKDA 2YTIA 1ZAAC 2EMFA 2EL6A 2EMLA 2EOMA 2EN6A 2EMGA 2JP9A 2EMHA 2EM8A 3EPKA 2EN7A 2A25A 2DRPA 1BBOA 2EMCA 2VRDA 2I13A 2YTNA 2WBTA 1B69A 2YTPA 2ENCA 2EOIA 3UK3C 1UN6B 2ADRA 3EPLA 3EPHA 3VHTB 2EPPA 4X9JA 1A1GA 1A1HA 2EQ3A 1MEYC 2D9HA 1YUIA 2MDGA 4R2SA 2DLKA 2LV2A 2YRKA 4FK5C 2ELZA 2EOYA 2ENHA 4GZNC 2GLIA 2EPRA 2YTQA 3EPJA 2EM2A 4R2EA 1TF3A 2HGHA 4WSGA 2EN4A 2EOOA 2MKNA 2WBUA 2CSHA 2EM3A 2EMWA 1BB8A 5KL4A 2YTDA 1A1IA 4IS1C 2EMYA 2EPZA 1JK1A 2EPUA 4R2CA 2YU5A 4R2DA 2EMKA 1A1FA 4F6NA 1NCSA 2EM6A 1JK2A 2JPAA 2EPCA 4R2RA 2DMIA 1YUJA 2CTDA 4F2JC 5KL7A 1X6HA 4R2AA 1AAYA 2EM0A 4M9VC 2DGCA 2YTJA 2EMAA 1X6FA 4IJDA 2LVHA 2EN8A 2YRMA 2EN1A 3M99B 2M9AA 1A1JA 2ENAA 3MHSC 2YU8A 2EJ4A 2NABA 2RPCA 4R2PA 1X3CA 1ZR9A 2EMXA 2EQ1A 2EOZA 1X5WA 1ZU1A 2EM5A 4R2QA 1G2FC 2EP3A 1WJPA 2EORA 1A1LA 2DLQA 2EOJA 2EM9A 2EPAA 2EMBA 1F2IG 2EL4A 2YTGA 2WCC3 4F6MA 1TN9A 2EOXA 2E72A 2R1FA 2WBSA 2EM4A 2LCEA 2YRHA 3MHHC 2YSOA 1YSAC 2GHFA 2YSPA 2CT1A 5KL3A 2EOSA 2EN2A 1Z1BA 2EM7A 2LT7A 1G2DC 1TF6A 2EL5A 2EOFA 2EMZA 2RSIA 2YTFA 1UBDC 2YTOA 5KL6A 1A1KA 2LO3A 2EOHA 1X6EA 1DGCA 2EE8A 2EPXA 2EMIA 2EN3A 1LLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTE A;  1RMD A;  2EQ0 A;  2PRT A;  5KL2 A;  2BB8 A;  1P47 A;  2J7J A;  5KL5 A;  2ELY A;  1KJK A;  2EOE A;  2EOQ A;  2MKD A;  2YTI A;  1ZAA C;  2EMF A;  2EL6 A;  2EML A;  2EOM A;  2EN6 A;  2EMG A;  2JP9 A;  2EMH A;  2EM8 A;  3EPK A;  2EN7 A;  2A25 A;  2DRP A;  1BBO A;  2EMC A;  2VRD A;  2I13 A;  2YTN A;  2WBT A;  1B69 A;  2YTP A;  2ENC A;  2EOI A;  3UK3 C;  1UN6 B;  2ADR A;  3EPL A;  3EPH A;  3VHT B;  2EPP A;  4X9J A;  1A1G A;  1A1H A;  2EQ3 A;  1MEY C;  2D9H A;  1YUI A;  2MDG A;  4R2S A;  2DLK A;  2LV2 A;  2YRK A;  4FK5 C;  2ELZ A;  2EOY A;  2ENH A;  4GZN C;  2GLI A;  2EPR A;  2YTQ A;  3EPJ A;  2EM2 A;  4R2E A;  1TF3 A;  2HGH A;  4WSG A;  2EN4 A;  2EOO A;  2MKN A;  2WBU A;  2CSH A;  2EM3 A;  2EMW A;  1BB8 A;  5KL4 A;  2YTD A;  1A1I A;  4IS1 C;  2EMY A;  2EPZ A;  1JK1 A;  2EPU A;  4R2C A;  2YU5 A;  4R2D A;  2EMK A;  1A1F A;  4F6N A;  1NCS A;  2EM6 A;  1JK2 A;  2JPA A;  2EPC A;  4R2R A;  2DMI A;  1YUJ A;  2CTD A;  4F2J C;  5KL7 A;  1X6H A;  4R2A A;  1AAY A;  2EM0 A;  4M9V C;  2DGC A;  2YTJ A;  2EMA A;  1X6F A;  4IJD A;  2LVH A;  2EN8 A;  2YRM A;  2EN1 A;  3M99 B;  2M9A A;  1A1J A;  2ENA A;  3MHS C;  2YU8 A;  2EJ4 A;  2NAB A;  2RPC A;  4R2P A;  1X3C A;  1ZR9 A;  2EMX A;  2EQ1 A;  2EOZ A;  1X5W A;  1ZU1 A;  2EM5 A;  4R2Q A;  1G2F C;  2EP3 A;  1WJP A;  2EOR A;  1A1L A;  2DLQ A;  2EOJ A;  2EM9 A;  2EPA A;  2EMB A;  1F2I G;  2EL4 A;  2YTG A;  2WCC 3;  4F6M A;  1TN9 A;  2EOX A;  2E72 A;  2R1F A;  2WBS A;  2EM4 A;  2LCE A;  2YRH A;  3MHH C;  2YSO A;  1YSA C;  2GHF A;  2YSP A;  2CT1 A;  5KL3 A;  2EOS A;  2EN2 A;  1Z1B A;  2EM7 A;  2LT7 A;  1G2D C;  1TF6 A;  2EL5 A;  2EOF A;  2EMZ A;  2RSI A;  2YTF A;  1UBD C;  2YTO A;  5KL6 A;  1A1K A;  2LO3 A;  2EOH A;  1X6E A;  1DGC A;  2EE8 A;  2EPX A;  2EMI A;  2EN3 A;  1LLM C; 
#chains in the Genus database with same CATH topology
 5AC5 A;  2PRT A;  2LJH A;  2V88 A;  2NUF A;  2KON A;  2EPM X;  3IWD A;  2MKD A;  2EPO A;  1BBG A;  2YTI A;  5A2Q C;  2FTX B;  2JWO A;  4NXM E;  2EL6 A;  2JVA A;  2EN6 A;  3C4B A;  2EMG A;  2DB2 A;  2JP9 A;  1HNZ E;  4ZYG A;  2EM8 A;  2LTR A;  4GKJ E;  2L2N A;  3EPK A;  1PJQ A;  2A25 A;  2EMC A;  2VRD A;  2WBT A;  1B69 A;  2MC5 A;  2ENC A;  4DUY E;  1A1G A;  3JAM C;  4ZYD A;  1J5E E;  4LF4 E;  4RH8 A;  4DUZ E;  2MDG A;  2RS6 A;  4LFB E;  5F3W A;  4M0V A;  4R2S A;  4MLV A;  1T4L B;  2LV2 A;  2K4V A;  1EH8 A;  3EPJ A;  2EM2 A;  4WXC A;  2MKN A;  3KZZ A;  3BID A;  2EM3 A;  1A1I A;  4IS1 C;  2EPZ A;  2EPU A;  4R2C A;  2YU5 A;  3HPS A;  2LTS A;  2EMK A;  4WYQ B;  4LU9 A;  1NCS A;  2EPK X;  2LE2 A;  1PKP A;  3VYX A;  1JK2 A;  2I9I A;  1IQS A;  4DV3 E;  1X6H A;  4BHB A;  4R2A A;  4DR3 E;  3RMP A;  2G7H A;  4DV6 E;  2LUP B;  1X6F A;  1T39 A;  1T38 A;  4O4K A;  2EN1 A;  4DR1 E;  1A1J A;  2ENA A;  3HPZ A;  5AE3 A;  2EJ4 A;  1I94 E;  2BBG A;  3THN A;  3AUZ A;  1ZU1 A;  2EP3 A;  3DF6 A;  1F2I G;  2N8X A;  2EL4 A;  5A6K A;  2WCC 3;  4F6M A;  1TN9 A;  2UU9 E;  4BCA A;  2EM4 A;  4P78 A;  2IHR 1;  2YZT A;  3MHH C;  2YSO A;  2UXD E;  1Z1B A;  2CT1 A;  5KL3 A;  2EOS A;  2EN2 A;  2V86 A;  2EM7 A;  1X47 A;  2YWQ A;  1G2D C;  2RSI A;  2R76 A;  4F9A B;  4NZV A;  1UBD C;  2YTO A;  2ODR D;  1IQO A;  4DKK A;  1O0W A;  2N3H A;  2JOB A;  4O24 A;  2EOH A;  4DR7 E;  2M4I A;  1DGC A;  4R03 A;  4Q35 B;  2L2M A;  2EPX A;  2EMI A;  1LLM C;  2YTE A;  2EQ0 A;  4F54 A;  2J7J A;  4L5N C;  2EOQ A;  2KOU A;  1ZAA C;  1T4O A;  4M30 A;  2L3J A;  3C6M A;  5A6B A;  3ADL A;  1PJT A;  2JXP A;  2DRP A;  4B3S E;  2B7T A;  3QG5 C;  2YTN A;  2CPN A;  2YTP A;  3JU0 A;  3UK3 C;  1UN6 B;  4X9J A;  1SR9 A;  3J7A G;  1L4S A;  4R8O A;  2D9H A;  4DR2 E;  1YUI A;  1DI2 A;  3IWC A;  1HNW E;  4JI8 E;  4B3T E;  4M2Z A;  2YRK A;  3ADJ A;  4JI2 E;  1N34 E;  4F9B B;  2GLI A;  4JV5 E;  4LF6 E;  2HGH A;  1XNQ E;  2WBU A;  2L92 A;  1N32 E;  3KWR A;  2JR1 A;  2V8Q B;  4JI5 E;  5TSE A;  2EM6 A;  4R2R A;  2DMI A;  1YYW A;  4GKK E;  5IXM B;  4DMI A;  4F2J C;  1YYK A;  2NUG A;  5LMN E;  2EM0 A;  2EPL X;  4JI6 E;  1N36 E;  4M9V C;  4LF5 E;  4LF7 E;  4HEI A;  2DGC A;  2L8T A;  4O5G A;  1SFE A;  1FKA E;  2LVH A;  2EN8 A;  5A6A A;  2M9A A;  3MSW A;  2YU8 A;  3OML A;  2VQE E;  2RPC A;  2EOZ A;  3L00 A;  2EMX A;  2EQ1 A;  4DR6 E;  3BBG A;  1G2F C;  1ZBQ A;  2EOR A;  2EOJ A;  2EPA A;  4WX9 A;  3EQ1 A;  2UUB E;  1WHQ A;  2F8B A;  3THO B;  5A6B D;  1HNX E;  2E72 A;  4N4R B;  1MGT A;  5IV8 B;  2HJJ A;  2LCE A;  2LJU A;  2B3T B;  1YSA C;  2EZ6 A;  2GHF A;  3ZOQ B;  2EL5 A;  2EOF A;  2YTF A;  1N33 E;  4YHH E;  2B7V A;  4DV0 E;  1WHN A;  2LO3 A;  4LF9 E;  2VQF E;  1X6E A;  4ZYH A;  4LFA E;  1UHZ A;  2EN3 A;  1YPN A;  1RMD A;  2ELY A;  4LFC E;  2LUQ A;  2FV4 B;  2JY9 A;  2EMF A;  3HXL A;  4NHR A;  1NEI A;  2EOM A;  3J81 C;  4X8W A;  3C4T A;  2EN7 A;  1YYO A;  1XMQ E;  3EPL A;  3VHT B;  2EPP A;  4DR5 E;  1A1H A;  1MEY C;  2NUE A;  2FGG A;  4KWY A;  4NXN E;  4O43 A;  4GEQ B;  4J8Z A;  4BBY A;  1WXR A;  2E1M A;  1IBK E;  1EKZ A;  3TQM A;  2LRS A;  2LBS B;  2EOY A;  2ENH A;  2V85 A;  4GZN C;  2EPR A;  2YTQ A;  4Q28 A;  5BR8 E;  3H09 A;  4WSG A;  2EOO A;  4DV7 E;  4I8O A;  2CSH A;  1BB8 A;  2YTD A;  4TUI A;  2EMY A;  2RQL A;  2F4V E;  1N3G A;  2MDR A;  1A1F A;  4F6N A;  3ADI A;  2UXC E;  2EPN A;  1WRJ A;  2EPC A;  1YUJ A;  2VF1 A;  3VYY A;  1GQE A;  5KL7 A;  3AV0 A;  2YTJ A;  5T6J A;  5AC4 A;  2EMA A;  3M99 B;  4WPY A;  4YY3 E;  1FJG E;  4WFT A;  4P7D A;  3T1Y E;  4JI4 E;  3OTO E;  1STU A;  2L6M A;  2L2K B;  2DLQ A;  2EM9 A;  2EMB A;  1ZBT A;  2M7Q A;  1XNR E;  2JOX A;  2RSM A;  1EH7 A;  1YZ9 A;  3P1X A;  2EOX A;  1QNT A;  2K7I A;  2WBS A;  1AH5 A;  3F6H A;  4L8N A;  1X49 A;  2LT7 A;  3JTZ A;  4LF8 E;  1IBL E;  1XMO E;  2HC5 A;  3J7Y p;  1A1K A;  5AE2 A;  2GPI A;  2V87 A;  2DIX A;  2VE7 C;  4ZYE A;  2EE8 A;  5FLX C;  5LL6 R;  2MC6 A;  3J80 C;  4OOG C;  4BHC A;  4OX9 E;  1DQ3 A;  2LMZ A;  5AE1 A;  3ADG A;  2BB8 A;  4BMJ A;  4F9C B;  2H36 X;  4KZS A;  5KL2 A;  4X64 E;  5KL5 A;  1P47 A;  1KJK A;  2EOE A;  3C6K A;  4RHB B;  1YFH A;  4WSP A;  2EML A;  5IWA E;  5DNY A;  3K6Q A;  1RC7 A;  5AAS A;  2EMH A;  1IMU A;  2DMY A;  2RS7 A;  1BBO A;  2I13 A;  4DV4 E;  3EPH A;  2EOI A;  2ADR A;  3T1H E;  2WZO A;  4KHP E;  2EQ3 A;  2E5L E;  4DV1 E;  4JI7 E;  1HR0 E;  4BC7 A;  1X48 A;  2NA2 A;  2DLK A;  4X65 E;  4FK5 C;  2ELZ A;  2N3G A;  1QU6 A;  5ADZ A;  1PJS A;  1TF3 A;  4MLQ A;  4R2E A;  2ODR C;  2EN4 A;  2EWL A;  1J26 A;  1EH6 A;  2EMW A;  5KL4 A;  1UIL A;  1PDA A;  3HTX A;  5IT9 C;  4DV5 E;  2M1S A;  2RTX A;  1JK1 A;  2L3C A;  4JI3 E;  3KZY A;  4R2D A;  5A69 A;  2JYA A;  4X62 E;  2YPN A;  3BGH A;  2JPA A;  3LML A;  2CTD A;  3BF2 A;  3VK6 A;  4JI0 E;  1AAY A;  2UUC E;  1T4N A;  4IJD A;  4BC9 A;  2YRM A;  5LMU E;  3MHS C;  4LTY A;  2NAB A;  2DSY A;  2UUA E;  4R2P A;  1X3C A;  1ZR9 A;  1X5W A;  4TUG A;  2EM5 A;  2V89 A;  4R2Q A;  2KHX A;  4B3M E;  1WJP A;  1A1L A;  1GTK A;  2V83 A;  4JYA E;  3IWB A;  2YTG A;  3HQ1 A;  4BS9 A;  4K0K E;  2L33 A;  4DR4 E;  1RQ0 A;  2ZM6 E;  2R1F A;  3DJW A;  3LLH A;  4WXD A;  2Q8U A;  2YRH A;  4JI1 E;  1GZ6 A;  3F6G A;  2YSP A;  1TF6 A;  3FIG A;  4DV2 E;  2EMZ A;  4HTG A;  4AQY E;  2UXB E;  4X66 E;  5KL6 A;  5A6J A;  1IBM E;  2HHH E;  2B9D A;  4B3R E;  3ECR A;  5LLQ A;  2YT4 A;  5CFF E;  1KYQ A; 
#chains in the Genus database with same CATH homology
 2YTE A;  1RMD A;  2EQ0 A;  2PRT A;  5KL2 A;  2BB8 A;  1P47 A;  2J7J A;  5KL5 A;  2ELY A;  1KJK A;  2EOE A;  2EOQ A;  2MKD A;  2YTI A;  1ZAA C;  2EMF A;  2EL6 A;  2EML A;  2EOM A;  2EN6 A;  2EMG A;  2JP9 A;  2EMH A;  2EM8 A;  3EPK A;  2EN7 A;  2A25 A;  2DRP A;  1BBO A;  2EMC A;  2VRD A;  2I13 A;  2YTN A;  2WBT A;  1B69 A;  2YTP A;  2ENC A;  2EOI A;  3UK3 C;  1UN6 B;  2ADR A;  3EPL A;  3EPH A;  3VHT B;  2EPP A;  4X9J A;  1A1G A;  1A1H A;  2EQ3 A;  1MEY C;  2D9H A;  1YUI A;  2MDG A;  4R2S A;  2DLK A;  2LV2 A;  2YRK A;  4FK5 C;  2ELZ A;  2EOY A;  2ENH A;  4GZN C;  2GLI A;  2EPR A;  2YTQ A;  3EPJ A;  2EM2 A;  4R2E A;  1TF3 A;  2HGH A;  4WSG A;  2EN4 A;  2EOO A;  2MKN A;  2WBU A;  2CSH A;  2EM3 A;  2EMW A;  1BB8 A;  5KL4 A;  2YTD A;  1A1I A;  4IS1 C;  2EMY A;  2EPZ A;  1JK1 A;  2EPU A;  4R2C A;  2YU5 A;  4R2D A;  2EMK A;  1A1F A;  4F6N A;  1NCS A;  2EM6 A;  1JK2 A;  2JPA A;  2EPC A;  4R2R A;  2DMI A;  1YUJ A;  2CTD A;  4F2J C;  5KL7 A;  1X6H A;  4R2A A;  1AAY A;  2EM0 A;  4M9V C;  2DGC A;  2YTJ A;  2EMA A;  1X6F A;  4IJD A;  2LVH A;  2EN8 A;  2YRM A;  2EN1 A;  3M99 B;  2M9A A;  1A1J A;  2ENA A;  3MHS C;  2YU8 A;  2EJ4 A;  2NAB A;  2RPC A;  4R2P A;  1X3C A;  1ZR9 A;  2EMX A;  2EQ1 A;  2EOZ A;  1X5W A;  1ZU1 A;  2EM5 A;  4R2Q A;  1G2F C;  2EP3 A;  1WJP A;  2EOR A;  1A1L A;  2DLQ A;  2EOJ A;  2EM9 A;  2EPA A;  2EMB A;  1F2I G;  2EL4 A;  2YTG A;  2WCC 3;  4F6M A;  1TN9 A;  2EOX A;  2E72 A;  2R1F A;  2WBS A;  2EM4 A;  2LCE A;  2YRH A;  3MHH C;  2YSO A;  1YSA C;  2GHF A;  2YSP A;  2CT1 A;  5KL3 A;  2EOS A;  2EN2 A;  1Z1B A;  2EM7 A;  2LT7 A;  1G2D C;  1TF6 A;  2EL5 A;  2EOF A;  2EMZ A;  2RSI A;  2YTF A;  1UBD C;  2YTO A;  5KL6 A;  1A1K A;  2LO3 A;  2EOH A;  1X6E A;  1DGC A;  2EE8 A;  2EPX A;  2EMI A;  2EN3 A;  1LLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...