2DLKA

Solution structure of the first and the second zf-c2h2 domains of zinc finger protein 692
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
GSSGSSGMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords novel protein
publication title Solution structure of the first and the second zf-C2H2 domains of zinc finger protein 692
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA01
2EPPA 1UBDC 2EMCA 2CT1A 2EN7A 2EPUA 2M9AA 2EMBA 1TF6A 1BB8A 2RPCA 2VRDA 4R2SA 5KL2A 5KL6A 2CTDA 3EPLA 1RMDA 2D9HA 2YTGA 2YU8A 1A1FA 2EOQA 2WBTA 1YSAC 1YUJA 1A1LA 4F2JC 2YSOA 2DGCA 2JPAA 1X6HA 3EPKA 1KJKA 2EM7A 2EJ4A 2EMGA 2EQ1A 2YTJA 2LCEA 2ADRA 1AAYA 2DLKA 1DGCA 2PRTA 2YRKA 2YTIA 1A1KA 2EOSA 2EL4A 1B69A 2EQ0A 4R2RA 2A25A 2EE8A 3M99B 1A1HA 2GLIA 2EN4A 1WJPA 2YTNA 2EMAA 3MHHC 2DMIA 2MKDA 2EOZA 2EOIA 1A1IA 1X6EA 5KL3A 1TN9A 2NABA 2EPZA 2DRPA 3EPJA 4X9JA 4IJDA 3UK3C 2LVHA 1X6FA 2YTDA 2WBSA 2YRHA 1TF3A 4F6NA 2EM4A 2R1FA 2EM8A 2EPCA 4FK5C 2EOOA 4WSGA 4R2QA 1Z1BA 1F2IG 4R2PA 2ENCA 2ENAA 2MDGA 2LT7A 2EM0A 4R2DA 2EOFA 2EM9A 3MHSC 2RSIA 5KL4A 2JP9A 2YTOA 2EM3A 2EMFA 2EMXA 2ELZA 2YRMA 1ZR9A 2ELYA 4F6MA 2EL5A 2EN3A 4R2EA 1G2FC 1ZU1A 2EORA 3EPHA 2EN8A 2EMYA 2GHFA 3VHTB 1A1JA 2WCC3 2EMHA 2EL6A 1ZAAC 2EOJA 2ENHA 5KL5A 1P47A 2EMZA 2EN2A 2LO3A 2EQ3A 4R2CA 2WBUA 2EM6A 2EMKA 4IS1C 1JK1A 2EN6A 1NCSA 2EPRA 2EM2A 2EM5A 2EOEA 2EP3A 2I13A 2EPXA 2EMWA 2EOHA 1YUIA 2DLQA 2EMLA 2EOYA 2YU5A 1UN6B 2YTFA 1X3CA 2EN1A 2YTQA 2E72A 4M9VC 2EOXA 1LLMC 1MEYC 2YTPA 2EOMA 2EMIA 1G2DC 2CSHA 1JK2A 2HGHA 2LV2A 4GZNC 1A1GA 2EPAA 2J7JA 4R2AA 2BB8A 2MKNA 2YTEA 2YSPA 1X5WA 5KL7A 1BBOA
chains in the Genus database with same CATH superfamily
2EPPA 3OTOE 1YYWA 4BHCA 1WHQA 4F9AB 4DV3E 2JR1A 5LLQA 3AV0A 1A1FA 1IQOA 4DR6E 2LJHA 2N3GA 1X6HA 3EPKA 1KJKA 2EM7A 2EJ4A 4R8OA 4DR5E 4LF9E 2DLKA 1DGCA 2B3TB 1A1KA 1FJGE 3DJWA 2YWQA 2A25A 4GKKE 3MHHC 2DMIA 1WHNA 5AE2A 1PKPA 2EOZA 4O43A 2FV4B 2UU9E 3C6MA 5KL3A 1GQEA 2EPZA 2DRPA 5AE3A 3EPJA 2F4VE 2LVHA 1X6FA 2YTDA 2WBSA 2YRHA 4B3RE 2EM8A 4WSGA 2ENAA 4DR4E 4BC9A 4JI7E 5A6AA 5F3WA 2EMFA 3BBGA 3K6QA 2H36X 1YYOA 4F6MA 2L2NA 2EL5A 2EN3A 4R2EA 4GKJE 1ZU1A 3KZZA 1T4OA 2GHFA 2JYAA 1N34E 1UHZA 1ZAAC 2EOJA 3HXLA 5KL5A 2LMZA 2BBGA 2EN2A 2EPLX 4R2CA 2EM6A 4M30A 2EN6A 3QG5C 1GTKA 4DUYE 2HHHE 2YU5A 1X3CA 4ZYHA 2LBSB 3DF6A 2LRSA 2GPIA 2YT4A 2EWLA 2YTPA 2EMIA 4NXNE 1IMUA 4F9CB 2EPAA 2JVAA 1I94E 4DV0E 4LF4E 2MKNA 1XNQE 2CPNA 2YTEA 5AC5A 2KOUA 4DR2E 4KZSA 1BBOA 4DV2E 1J26A 2EN7A 2EMBA 1BB8A 2RPCA 2VRDA 4R2SA 5KL2A 2JOXA 4OOGC 2CTDA 3BIDA 2JOBA 1N3GA 1HNXE 3F6GA 4TUIA 4DR1E 4R03A 1YSAC 1YUJA 1A1LA 2HJJA 4Q35B 1IQSA 2L92A 1HNZE 4JI6E 4X62E 1T38A 1XMOE 5ADZA 2YRKA 2YTIA 2V87A 2EQ0A 1EH6A 1X47A 3M99B 2GLIA 2EN4A 4BBYA 4BHBA 2JWOA 1TN9A 2NABA 2M1SA 3THOB 4MLQA 3EQ1A 1IBME 2EPKX 4X9JA 2DMYA 4IJDA 3UK3C 5CFFE 1YFHA 4YY3E 3IWBA 4J8ZA 5IV8B 4N4RB 4WSPA 1T4NA 2LE2A 1TF3A 2M4IA 4R2QA 4F6NA 2EPCA 4FK5C 2EOOA 4NZVA 5A2QC 4R2PA 1IBKE 4B3TE 4KHPE 2MDGA 2VQFE 2UXCE 2EOFA 2YZTA 2EM9A 3MHSC 3C6KA 5KL4A 2Q8UA 2YTOA 4WXDA 3HPZA 1DI2A 4NXME 4LF7E 4DUZE 3ADLA 1ZR9A 2ELYA 2MDRA 5A6KA 4M0VA 3JU0A 2V89A 2NUFA 1QNTA 3IWDA 2JY9A 4JI0E 2B7VA 2M7QA 2EMYA 3HQ1A 1GZ6A 3VHTB 1QU6A 2EMHA 4JI1E 4BS9A 2RS7A 2ENHA 1P47A 2EMZA 3ADIA 3C4BA 2WBUA 1JK1A 2EMKA 4DR7E 2EM5A 2EOEA 2EPMX 4P78A 2DIXA 2EPXA 4JI4E 2EMLA 2EOYA 2V88A 1UN6B 1ZBQA 4WX9A 5LMNE 4DV4E 5AASA 4M9VC 2ODRD 1J5EE 3OMLA 1UILA 4LFCE 3ZOQB 3VK6A 3TQMA 4GZNC 4LU9A 1PDAA 2LTSA 2RSMA 1RQ0A 1XNRE 4LFAE 1ZBTA 3LLHA 3AUZA 3LMLA 3P1XA 4B3ME 4BMJA 1UBDC 2EMCA 2L33A 2CT1A 1FKAE 4X64E 2K4VA 1TF6A 1O0WA 2G7HA 2L2MA 5TSEA 1RMDA 3HTXA 2EOQA 2L6MA 2V86A 2WBTA 2DB2A 2V85A 3RMPA 3T1HE 4B3SE 2KHXA 4F2JC 2ODRC 3MSWA 2DGCA 2JPAA 4JI5E 1BBGA 2L2KB 2EMGA 2EQ1A 1N33E 2KONA 1AAYA 2L3JA 1EH7A 1B69A 1STUA 4R2RA 4DR3E 1A1HA 4LFBE 2YTNA 2DSYA 4M2ZA 2EMAA 3FIGA 2LUPB 2ZM6E 2HC5A 2EOIA 3ADGA 1X6EA 2L8TA 1MGTA 2E1MA 3J81C 5LMUE 2RQLA 5FLXC 2NUEA 3H09A 4DMIA 1XMQE 1PJSA 1YPNA 3ECRA 2EM4A 2R1FA 3F6HA 2UXBE 3JAMC 1HR0E 1PJTA 1YYKA 2ENCA 2I9IA 4JV5E 2JXPA 4R2DA 2VF1A 2B7TA 2RSIA 2N8XA 2EM3A 3VYYA 4L8NA 2R76A 2YRMA 2EORA 5LL6R 3J80C 2EN8A 4DV7E 2EZ6A 1A1JA 2EL6A 4HTGA 5A69A 4F54A 2F8BA 2VE7C 2EQ3A 4O5GA 4HEIA 1WXRA 2EPRA 1NEIA 4BC7A 2EOHA 2EMWA 2LUQA 1YUIA 2DLQA 3L00A 5BR8E 2UUBE 3KWRA 4K0KE 2EN1A 4P7DA 2EOXA 1YZ9A 1MEYC 4YHHE 2CSHA 4MLVA 2V8QB 5AC4A 1JK2A 2HGHA 2LV2A 4DV1E 1EH8A 4KWYA 4WFTA 4JI3E 2BB8A 5IT9C 3IWCA 2UXDE 4DV6E 4LF8E 2MC6A 2EPUA 2M9AA 4DKKA 2RS6A 4F9BB 5KL6A 3EPLA 1SFEA 2D9HA 2YTGA 3BGHA 2E5LE 4X8WA 5A6BD 2UUAE 2YU8A 1HNWE 1N32E 3JTZA 2NA2A 3J7AG 2YSOA 3C4TA 2YTJA 2LCEA 2ADRA 3T1YE 2PRTA 4RHBB 2EL4A 2EOSA 2LJUA 5A6BA 2EPOA 2FGGA 4DV5E 2V83A 2EE8A 1WJPA 3THNA 2RTXA 2MKDA 3HPSA 5A6JA 1A1IA 4Q28A 1N36E 1T4LB 1DQ3A 5DNYA 4LF5E 5AE1A 2EPNA 1RC7A 4AQYE 4LTYA 4BCAA 4JI2E 4I8OA 5KL7A 4JYAE 1Z1BA 4X66E 1F2IG 3KZYA 2LT7A 2UUCE 2EM0A 5T6JA 3BF2A 4X65E 2NUGA 4RH8A 2JP9A 3VYXA 2EMXA 2ELZA 4OX9E 1SR9A 2VQEE 2YPNA 1G2FC 3EPHA 4L5NC 1WRJA 1L4SA 2WCC3 1EKZA 2LO3A 4IS1C 5IWAE 2B9DA 1KYQA 4LF6E 1NCSA 4WYQB 4ZYEA 2EM2A 2EP3A 2I13A 4O24A 4ZYDA 2MC5A 4JI8E 4NHRA 2YTFA 5IXMB 4O4KA 4WXCA 2YTQA 2E72A 2FTXB 1LLMC 2EOMA 2K7IA 1G2DC 1X49A 1A1GA 1IBLE 1PJQA 2N3HA 2IHR1 4WPYA 2J7JA 4R2AA 4TUGA 2L3CA 2LTRA 2YSPA 4ZYGA 3J7Yp 1X48A 1AH5A 1X5WA 1T39A 3ADJA 2WZOA 4GEQB
chains in the Genus database with same CATH topology
2EPPA 1UBDC 2EMCA 2CT1A 2EN7A 2EPUA 2M9AA 2EMBA 1TF6A 1BB8A 2RPCA 2VRDA 4R2SA 5KL2A 5KL6A 2CTDA 3EPLA 1RMDA 2D9HA 2YTGA 2YU8A 1A1FA 2EOQA 2WBTA 1YSAC 1YUJA 1A1LA 4F2JC 2YSOA 2DGCA 2JPAA 1X6HA 3EPKA 1KJKA 2EM7A 2EJ4A 2EMGA 2EQ1A 2YTJA 2LCEA 2ADRA 1AAYA 2DLKA 1DGCA 2PRTA 2YRKA 2YTIA 1A1KA 2EOSA 2EL4A 1B69A 2EQ0A 4R2RA 2A25A 2EE8A 3M99B 1A1HA 2GLIA 2EN4A 1WJPA 2YTNA 2EMAA 3MHHC 2DMIA 2MKDA 2EOZA 2EOIA 1A1IA 1X6EA 5KL3A 1TN9A 2NABA 2EPZA 2DRPA 3EPJA 4X9JA 4IJDA 3UK3C 2LVHA 1X6FA 2YTDA 2WBSA 2YRHA 1TF3A 4F6NA 2EM4A 2R1FA 2EM8A 2EPCA 4FK5C 2EOOA 4WSGA 4R2QA 1Z1BA 1F2IG 4R2PA 2ENCA 2ENAA 2MDGA 2LT7A 2EM0A 4R2DA 2EOFA 2EM9A 3MHSC 2RSIA 5KL4A 2JP9A 2YTOA 2EM3A 2EMFA 2EMXA 2ELZA 2YRMA 1ZR9A 2ELYA 4F6MA 2EL5A 2EN3A 4R2EA 1G2FC 1ZU1A 2EORA 3EPHA 2EN8A 2EMYA 2GHFA 3VHTB 1A1JA 2WCC3 2EMHA 2EL6A 1ZAAC 2EOJA 2ENHA 5KL5A 1P47A 2EMZA 2EN2A 2LO3A 2EQ3A 4R2CA 2WBUA 2EM6A 2EMKA 4IS1C 1JK1A 2EN6A 1NCSA 2EPRA 2EM2A 2EM5A 2EOEA 2EP3A 2I13A 2EPXA 2EMWA 2EOHA 1YUIA 2DLQA 2EMLA 2EOYA 2YU5A 1UN6B 2YTFA 1X3CA 2EN1A 2YTQA 2E72A 4M9VC 2EOXA 1LLMC 1MEYC 2YTPA 2EOMA 2EMIA 1G2DC 2CSHA 1JK2A 2HGHA 2LV2A 4GZNC 1A1GA 2EPAA 2J7JA 4R2AA 2BB8A 2MKNA 2YTEA 2YSPA 1X5WA 5KL7A 1BBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPP A;  1UBD C;  2EMC A;  2CT1 A;  2EN7 A;  2EPU A;  2M9A A;  2EMB A;  1TF6 A;  1BB8 A;  2RPC A;  2VRD A;  4R2S A;  5KL2 A;  5KL6 A;  2CTD A;  3EPL A;  1RMD A;  2D9H A;  2YTG A;  2YU8 A;  1A1F A;  2EOQ A;  2WBT A;  1YSA C;  1YUJ A;  1A1L A;  4F2J C;  2YSO A;  2DGC A;  2JPA A;  1X6H A;  3EPK A;  1KJK A;  2EM7 A;  2EJ4 A;  2EMG A;  2EQ1 A;  2YTJ A;  2LCE A;  2ADR A;  1AAY A;  2DLK A;  1DGC A;  2PRT A;  2YRK A;  2YTI A;  1A1K A;  2EOS A;  2EL4 A;  1B69 A;  2EQ0 A;  4R2R A;  2A25 A;  2EE8 A;  3M99 B;  1A1H A;  2GLI A;  2EN4 A;  1WJP A;  2YTN A;  2EMA A;  3MHH C;  2DMI A;  2MKD A;  2EOZ A;  2EOI A;  1A1I A;  1X6E A;  5KL3 A;  1TN9 A;  2NAB A;  2EPZ A;  2DRP A;  3EPJ A;  4X9J A;  4IJD A;  3UK3 C;  2LVH A;  1X6F A;  2YTD A;  2WBS A;  2YRH A;  1TF3 A;  4F6N A;  2EM4 A;  2R1F A;  2EM8 A;  2EPC A;  4FK5 C;  2EOO A;  4WSG A;  4R2Q A;  1Z1B A;  1F2I G;  4R2P A;  2ENC A;  2ENA A;  2MDG A;  2LT7 A;  2EM0 A;  4R2D A;  2EOF A;  2EM9 A;  3MHS C;  2RSI A;  5KL4 A;  2JP9 A;  2YTO A;  2EM3 A;  2EMF A;  2EMX A;  2ELZ A;  2YRM A;  1ZR9 A;  2ELY A;  4F6M A;  2EL5 A;  2EN3 A;  4R2E A;  1G2F C;  1ZU1 A;  2EOR A;  3EPH A;  2EN8 A;  2EMY A;  2GHF A;  3VHT B;  1A1J A;  2WCC 3;  2EMH A;  2EL6 A;  1ZAA C;  2EOJ A;  2ENH A;  5KL5 A;  1P47 A;  2EMZ A;  2EN2 A;  2LO3 A;  2EQ3 A;  4R2C A;  2WBU A;  2EM6 A;  2EMK A;  4IS1 C;  1JK1 A;  2EN6 A;  1NCS A;  2EPR A;  2EM2 A;  2EM5 A;  2EOE A;  2EP3 A;  2I13 A;  2EPX A;  2EMW A;  2EOH A;  1YUI A;  2DLQ A;  2EML A;  2EOY A;  2YU5 A;  1UN6 B;  2YTF A;  1X3C A;  2EN1 A;  2YTQ A;  2E72 A;  4M9V C;  2EOX A;  1LLM C;  1MEY C;  2YTP A;  2EOM A;  2EMI A;  1G2D C;  2CSH A;  1JK2 A;  2HGH A;  2LV2 A;  4GZN C;  1A1G A;  2EPA A;  2J7J A;  4R2A A;  2BB8 A;  2MKN A;  2YTE A;  2YSP A;  1X5W A;  5KL7 A;  1BBO A; 
#chains in the Genus database with same CATH topology
 2EPP A;  3OTO E;  1YYW A;  4BHC A;  1WHQ A;  4F9A B;  4DV3 E;  2JR1 A;  5LLQ A;  3AV0 A;  1A1F A;  1IQO A;  4DR6 E;  2LJH A;  2N3G A;  1X6H A;  3EPK A;  1KJK A;  2EM7 A;  2EJ4 A;  4R8O A;  4DR5 E;  4LF9 E;  2DLK A;  1DGC A;  2B3T B;  1A1K A;  1FJG E;  3DJW A;  2YWQ A;  2A25 A;  4GKK E;  3MHH C;  2DMI A;  1WHN A;  5AE2 A;  1PKP A;  2EOZ A;  4O43 A;  2FV4 B;  2UU9 E;  3C6M A;  5KL3 A;  1GQE A;  2EPZ A;  2DRP A;  5AE3 A;  3EPJ A;  2F4V E;  2LVH A;  1X6F A;  2YTD A;  2WBS A;  2YRH A;  4B3R E;  2EM8 A;  4WSG A;  2ENA A;  4DR4 E;  4BC9 A;  4JI7 E;  5A6A A;  5F3W A;  2EMF A;  3BBG A;  3K6Q A;  2H36 X;  1YYO A;  4F6M A;  2L2N A;  2EL5 A;  2EN3 A;  4R2E A;  4GKJ E;  1ZU1 A;  3KZZ A;  1T4O A;  2GHF A;  2JYA A;  1N34 E;  1UHZ A;  1ZAA C;  2EOJ A;  3HXL A;  5KL5 A;  2LMZ A;  2BBG A;  2EN2 A;  2EPL X;  4R2C A;  2EM6 A;  4M30 A;  2EN6 A;  3QG5 C;  1GTK A;  4DUY E;  2HHH E;  2YU5 A;  1X3C A;  4ZYH A;  2LBS B;  3DF6 A;  2LRS A;  2GPI A;  2YT4 A;  2EWL A;  2YTP A;  2EMI A;  4NXN E;  1IMU A;  4F9C B;  2EPA A;  2JVA A;  1I94 E;  4DV0 E;  4LF4 E;  2MKN A;  1XNQ E;  2CPN A;  2YTE A;  5AC5 A;  2KOU A;  4DR2 E;  4KZS A;  1BBO A;  4DV2 E;  1J26 A;  2EN7 A;  2EMB A;  1BB8 A;  2RPC A;  2VRD A;  4R2S A;  5KL2 A;  2JOX A;  4OOG C;  2CTD A;  3BID A;  2JOB A;  1N3G A;  1HNX E;  3F6G A;  4TUI A;  4DR1 E;  4R03 A;  1YSA C;  1YUJ A;  1A1L A;  2HJJ A;  4Q35 B;  1IQS A;  2L92 A;  1HNZ E;  4JI6 E;  4X62 E;  1T38 A;  1XMO E;  5ADZ A;  2YRK A;  2YTI A;  2V87 A;  2EQ0 A;  1EH6 A;  1X47 A;  3M99 B;  2GLI A;  2EN4 A;  4BBY A;  4BHB A;  2JWO A;  1TN9 A;  2NAB A;  2M1S A;  3THO B;  4MLQ A;  3EQ1 A;  1IBM E;  2EPK X;  4X9J A;  2DMY A;  4IJD A;  3UK3 C;  5CFF E;  1YFH A;  4YY3 E;  3IWB A;  4J8Z A;  5IV8 B;  4N4R B;  4WSP A;  1T4N A;  2LE2 A;  1TF3 A;  2M4I A;  4R2Q A;  4F6N A;  2EPC A;  4FK5 C;  2EOO A;  4NZV A;  5A2Q C;  4R2P A;  1IBK E;  4B3T E;  4KHP E;  2MDG A;  2VQF E;  2UXC E;  2EOF A;  2YZT A;  2EM9 A;  3MHS C;  3C6K A;  5KL4 A;  2Q8U A;  2YTO A;  4WXD A;  3HPZ A;  1DI2 A;  4NXM E;  4LF7 E;  4DUZ E;  3ADL A;  1ZR9 A;  2ELY A;  2MDR A;  5A6K A;  4M0V A;  3JU0 A;  2V89 A;  2NUF A;  1QNT A;  3IWD A;  2JY9 A;  4JI0 E;  2B7V A;  2M7Q A;  2EMY A;  3HQ1 A;  1GZ6 A;  3VHT B;  1QU6 A;  2EMH A;  4JI1 E;  4BS9 A;  2RS7 A;  2ENH A;  1P47 A;  2EMZ A;  3ADI A;  3C4B A;  2WBU A;  1JK1 A;  2EMK A;  4DR7 E;  2EM5 A;  2EOE A;  2EPM X;  4P78 A;  2DIX A;  2EPX A;  4JI4 E;  2EML A;  2EOY A;  2V88 A;  1UN6 B;  1ZBQ A;  4WX9 A;  5LMN E;  4DV4 E;  5AAS A;  4M9V C;  2ODR D;  1J5E E;  3OML A;  1UIL A;  4LFC E;  3ZOQ B;  3VK6 A;  3TQM A;  4GZN C;  4LU9 A;  1PDA A;  2LTS A;  2RSM A;  1RQ0 A;  1XNR E;  4LFA E;  1ZBT A;  3LLH A;  3AUZ A;  3LML A;  3P1X A;  4B3M E;  4BMJ A;  1UBD C;  2EMC A;  2L33 A;  2CT1 A;  1FKA E;  4X64 E;  2K4V A;  1TF6 A;  1O0W A;  2G7H A;  2L2M A;  5TSE A;  1RMD A;  3HTX A;  2EOQ A;  2L6M A;  2V86 A;  2WBT A;  2DB2 A;  2V85 A;  3RMP A;  3T1H E;  4B3S E;  2KHX A;  4F2J C;  2ODR C;  3MSW A;  2DGC A;  2JPA A;  4JI5 E;  1BBG A;  2L2K B;  2EMG A;  2EQ1 A;  1N33 E;  2KON A;  1AAY A;  2L3J A;  1EH7 A;  1B69 A;  1STU A;  4R2R A;  4DR3 E;  1A1H A;  4LFB E;  2YTN A;  2DSY A;  4M2Z A;  2EMA A;  3FIG A;  2LUP B;  2ZM6 E;  2HC5 A;  2EOI A;  3ADG A;  1X6E A;  2L8T A;  1MGT A;  2E1M A;  3J81 C;  5LMU E;  2RQL A;  5FLX C;  2NUE A;  3H09 A;  4DMI A;  1XMQ E;  1PJS A;  1YPN A;  3ECR A;  2EM4 A;  2R1F A;  3F6H A;  2UXB E;  3JAM C;  1HR0 E;  1PJT A;  1YYK A;  2ENC A;  2I9I A;  4JV5 E;  2JXP A;  4R2D A;  2VF1 A;  2B7T A;  2RSI A;  2N8X A;  2EM3 A;  3VYY A;  4L8N A;  2R76 A;  2YRM A;  2EOR A;  5LL6 R;  3J80 C;  2EN8 A;  4DV7 E;  2EZ6 A;  1A1J A;  2EL6 A;  4HTG A;  5A69 A;  4F54 A;  2F8B A;  2VE7 C;  2EQ3 A;  4O5G A;  4HEI A;  1WXR A;  2EPR A;  1NEI A;  4BC7 A;  2EOH A;  2EMW A;  2LUQ A;  1YUI A;  2DLQ A;  3L00 A;  5BR8 E;  2UUB E;  3KWR A;  4K0K E;  2EN1 A;  4P7D A;  2EOX A;  1YZ9 A;  1MEY C;  4YHH E;  2CSH A;  4MLV A;  2V8Q B;  5AC4 A;  1JK2 A;  2HGH A;  2LV2 A;  4DV1 E;  1EH8 A;  4KWY A;  4WFT A;  4JI3 E;  2BB8 A;  5IT9 C;  3IWC A;  2UXD E;  4DV6 E;  4LF8 E;  2MC6 A;  2EPU A;  2M9A A;  4DKK A;  2RS6 A;  4F9B B;  5KL6 A;  3EPL A;  1SFE A;  2D9H A;  2YTG A;  3BGH A;  2E5L E;  4X8W A;  5A6B D;  2UUA E;  2YU8 A;  1HNW E;  1N32 E;  3JTZ A;  2NA2 A;  3J7A G;  2YSO A;  3C4T A;  2YTJ A;  2LCE A;  2ADR A;  3T1Y E;  2PRT A;  4RHB B;  2EL4 A;  2EOS A;  2LJU A;  5A6B A;  2EPO A;  2FGG A;  4DV5 E;  2V83 A;  2EE8 A;  1WJP A;  3THN A;  2RTX A;  2MKD A;  3HPS A;  5A6J A;  1A1I A;  4Q28 A;  1N36 E;  1T4L B;  1DQ3 A;  5DNY A;  4LF5 E;  5AE1 A;  2EPN A;  1RC7 A;  4AQY E;  4LTY A;  4BCA A;  4JI2 E;  4I8O A;  5KL7 A;  4JYA E;  1Z1B A;  4X66 E;  1F2I G;  3KZY A;  2LT7 A;  2UUC E;  2EM0 A;  5T6J A;  3BF2 A;  4X65 E;  2NUG A;  4RH8 A;  2JP9 A;  3VYX A;  2EMX A;  2ELZ A;  4OX9 E;  1SR9 A;  2VQE E;  2YPN A;  1G2F C;  3EPH A;  4L5N C;  1WRJ A;  1L4S A;  2WCC 3;  1EKZ A;  2LO3 A;  4IS1 C;  5IWA E;  2B9D A;  1KYQ A;  4LF6 E;  1NCS A;  4WYQ B;  4ZYE A;  2EM2 A;  2EP3 A;  2I13 A;  4O24 A;  4ZYD A;  2MC5 A;  4JI8 E;  4NHR A;  2YTF A;  5IXM B;  4O4K A;  4WXC A;  2YTQ A;  2E72 A;  2FTX B;  1LLM C;  2EOM A;  2K7I A;  1G2D C;  1X49 A;  1A1G A;  1IBL E;  1PJQ A;  2N3H A;  2IHR 1;  4WPY A;  2J7J A;  4R2A A;  4TUG A;  2L3C A;  2LTR A;  2YSP A;  4ZYG A;  3J7Y p;  1X48 A;  1AH5 A;  1X5W A;  1T39 A;  3ADJ A;  2WZO A;  4GEQ B; 
#chains in the Genus database with same CATH homology
 2EPP A;  1UBD C;  2EMC A;  2CT1 A;  2EN7 A;  2EPU A;  2M9A A;  2EMB A;  1TF6 A;  1BB8 A;  2RPC A;  2VRD A;  4R2S A;  5KL2 A;  5KL6 A;  2CTD A;  3EPL A;  1RMD A;  2D9H A;  2YTG A;  2YU8 A;  1A1F A;  2EOQ A;  2WBT A;  1YSA C;  1YUJ A;  1A1L A;  4F2J C;  2YSO A;  2DGC A;  2JPA A;  1X6H A;  3EPK A;  1KJK A;  2EM7 A;  2EJ4 A;  2EMG A;  2EQ1 A;  2YTJ A;  2LCE A;  2ADR A;  1AAY A;  2DLK A;  1DGC A;  2PRT A;  2YRK A;  2YTI A;  1A1K A;  2EOS A;  2EL4 A;  1B69 A;  2EQ0 A;  4R2R A;  2A25 A;  2EE8 A;  3M99 B;  1A1H A;  2GLI A;  2EN4 A;  1WJP A;  2YTN A;  2EMA A;  3MHH C;  2DMI A;  2MKD A;  2EOZ A;  2EOI A;  1A1I A;  1X6E A;  5KL3 A;  1TN9 A;  2NAB A;  2EPZ A;  2DRP A;  3EPJ A;  4X9J A;  4IJD A;  3UK3 C;  2LVH A;  1X6F A;  2YTD A;  2WBS A;  2YRH A;  1TF3 A;  4F6N A;  2EM4 A;  2R1F A;  2EM8 A;  2EPC A;  4FK5 C;  2EOO A;  4WSG A;  4R2Q A;  1Z1B A;  1F2I G;  4R2P A;  2ENC A;  2ENA A;  2MDG A;  2LT7 A;  2EM0 A;  4R2D A;  2EOF A;  2EM9 A;  3MHS C;  2RSI A;  5KL4 A;  2JP9 A;  2YTO A;  2EM3 A;  2EMF A;  2EMX A;  2ELZ A;  2YRM A;  1ZR9 A;  2ELY A;  4F6M A;  2EL5 A;  2EN3 A;  4R2E A;  1G2F C;  1ZU1 A;  2EOR A;  3EPH A;  2EN8 A;  2EMY A;  2GHF A;  3VHT B;  1A1J A;  2WCC 3;  2EMH A;  2EL6 A;  1ZAA C;  2EOJ A;  2ENH A;  5KL5 A;  1P47 A;  2EMZ A;  2EN2 A;  2LO3 A;  2EQ3 A;  4R2C A;  2WBU A;  2EM6 A;  2EMK A;  4IS1 C;  1JK1 A;  2EN6 A;  1NCS A;  2EPR A;  2EM2 A;  2EM5 A;  2EOE A;  2EP3 A;  2I13 A;  2EPX A;  2EMW A;  2EOH A;  1YUI A;  2DLQ A;  2EML A;  2EOY A;  2YU5 A;  1UN6 B;  2YTF A;  1X3C A;  2EN1 A;  2YTQ A;  2E72 A;  4M9V C;  2EOX A;  1LLM C;  1MEY C;  2YTP A;  2EOM A;  2EMI A;  1G2D C;  2CSH A;  1JK2 A;  2HGH A;  2LV2 A;  4GZN C;  1A1G A;  2EPA A;  2J7J A;  4R2A A;  2BB8 A;  2MKN A;  2YTE A;  2YSP A;  1X5W A;  5KL7 A;  1BBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...