2DLKA

Solution structure of the first and the second zf-c2h2 domains of zinc finger protein 692
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
GSSGSSGMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first and the second zf-C2H2 domains of zinc finger protein 692
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords novel protein
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA01
3VHTB 2EMBA 2EOEA 2EOXA 2ENAA 3UK3C 1ZR9A 2EPCA 2A25A 2YRMA 1A1HA 2JP9A 3EPHA 5KL4A 2EMAA 2EN4A 2EM0A 2YTIA 2LCEA 1TF6A 2EN8A 2MDGA 2VRDA 3MHSC 1X6HA 4R2EA 2EOZA 4R2DA 2YSOA 2EOJA 2J7JA 2BB8A 2DMIA 2HGHA 2EMHA 1X6EA 1X3CA 2EQ0A 2EPUA 2EPXA 4FK5C 2EPRA 2EMZA 4M9VC 2GLIA 4F6NA 2EMKA 1NCSA 1AAYA 1TN9A 2ENHA 2EN6A 2EORA 2YTFA 2WCC3 2EM4A 2EOIA 2RPCA 5KL6A 2EM3A 2CT1A 1JK2A 2EQ3A 2EMIA 1BB8A 1UBDC 2YSPA 2YTNA 2WBSA 2WBTA 2ELYA 1A1GA 2EOSA 1G2FC 4IJDA 2PRTA 2ELZA 4IS1C 2EJ4A 2YTJA 2MKNA 2M9AA 2EP3A 2ADRA 2DGCA 2EOYA 3EPKA 2EMXA 4WSGA 1A1LA 5KL3A 1MEYC 2YRHA 2EM7A 2MKDA 2YU5A 1WJPA 4F2JC 1A1JA 2EMCA 1BBOA 2EE8A 1DGCA 2CSHA 2JPAA 1X6FA 2EM5A 2YTDA 1P47A 2EOHA 2R1FA 1YUJA 1YUIA 2EM2A 1A1FA 2EL5A 2YRKA 3EPJA 2EM9A 2EMFA 5KL7A 2EMLA 2EN7A 5KL5A 4R2AA 2EL6A 2EMGA 2DLKA 2EOFA 2EOQA 2EM8A 1X5WA 2EN1A 2NABA 4R2CA 1ZU1A 2LV2A 1G2DC 2DLQA 2CTDA 2YU8A 4R2PA 1JK1A 2EMWA 3EPLA 2EOMA 4GZNC 2EPZA 2YTPA 1A1KA 1UN6B 2EMYA 2WBUA 1ZAAC 1KJKA 2EN2A 2EM6A 4R2SA 1LLMC 1RMDA 2ENCA 1A1IA 4X9JA 2EPAA 2EPPA 3MHHC 2EN3A 2D9HA 1B69A 2LO3A 5KL2A 4R2RA 1TF3A 2E72A 2DRPA 1YSAC 2RSIA 2EL4A 2LT7A 4R2QA 4F6MA 1F2IG 2YTEA 2I13A 2EQ1A 2YTGA 2EOOA 2GHFA 2LVHA 2YTQA 2YTOA 1Z1BA 3M99B
chains in the Genus database with same CATH superfamily
1YYWA 3HXLA 3VHTB 4LF4E 1ZR9A 1A1HA 2A25A 4MLQA 2B7TA 2N8XA 2JP9A 5DNYA 2EMAA 3ADIA 1GTKA 2EM0A 3BIDA 2VRDA 1SR9A 2NUEA 2EOZA 4DR2E 4WYQB 3J7AG 1T4OA 1T38A 1UHZA 1X3CA 2G7HA 4OX9E 2LJHA 3RMPA 2EORA 2M7QA 2Q8UA 2EPKX 4DV3E 1FKAE 2EPMX 4K0KE 2LMZA 4B3TE 3THNA 2RTXA 4M0VA 1DQ3A 2YSPA 2YTNA 1YYOA 2WBTA 2ELYA 3DF6A 2EOSA 4IJDA 2ELZA 4IS1C 2IHR1 1WHNA 2V89A 2EJ4A 4J8ZA 2EP3A 4WXDA 4TUGA 2ADRA 5LL6R 4B3RE 4HTGA 3KZYA 1A1LA 4ZYGA 4I8OA 1T39A 3VYYA 1PJSA 4DMIA 5IV8B 4X65E 2YRHA 4LF7E 2MC6A 2YU5A 5FLXC 5IT9C 3JAMC 2B7VA 1PJQA 3BGHA 1XMQE 2CSHA 4F9CB 4WXCA 2HJJA 1X6FA 1N34E 2YTDA 2EM2A 1N32E 3EPJA 2VF1A 4DR6E 3C6KA 2EMFA 2EMLA 2EMGA 1HR0E 1IQSA 5A6JA 1YFHA 2CTDA 3EQ1A 1L4SA 2YU8A 2E1MA 2EMWA 2EMYA 1PKPA 2WBUA 1ZAAC 1KJKA 4NXNE 2LTRA 2ENCA 2EPOA 1A1IA 4NZVA 2EPAA 2EPPA 4OOGC 4DV7E 1SFEA 1B69A 5KL2A 2YPNA 4DUYE 5LLQA 2RSMA 3IWCA 4Q35B 2LT7A 4R2QA 2I13A 2YTGA 5A6KA 5AE1A 2GHFA 4DKKA 4BMJA 4LF8E 3M99B 1RQ0A 4JI0E 2M4IA 2L3CA 2FGGA 2EMBA 2EOEA 1ZBTA 3UK3C 3EPHA 1N33E 2RS6A 5KL4A 4LF6E 4LFCE 2LTSA 2L2MA 1IBME 2F4VE 2E5LE 3AV0A 1NEIA 4BS9A 4DV4E 4BC9A 2LE2A 2YSOA 2EOJA 2EWLA 4R2DA 1X47A 2I9IA 4NHRA 1T4LB 2HGHA 4M2ZA 1X6EA 5AE3A 3JTZA 4F9BB 5TSEA 4M9VC 3ECRA 2EZ6A 3LMLA 5A6BA 5CFFE 4DR4E 2EOIA 1HNWE 4BHBA 4L5NC 2B3TB 4R03A 5KL6A 5A2QC 2CT1A 5BR8E 1EH7A 3LLHA 1UBDC 4JYAE 2DSYA 2WBSA 1PJTA 1ZBQA 1XNRE 2L2NA 1G2FC 4BBYA 2FV4B 2HC5A 2EMXA 4WSGA 5AE2A 2EM7A 2MKDA 1WJPA 2GPIA 1BBOA 4O24A 5A6AA 2EM5A 4X66E 1P47A 2CPNA 2EOHA 1A1FA 2YRKA 2EM9A 2JR1A 4B3SE 3MSWA 2DLKA 4TUIA 2EM8A 3J7Yp 1YZ9A 3ADLA 4R2CA 1ZU1A 2LV2A 1KYQA 2K7IA 4R2PA 4P78A 5IXMB 4NXME 3C4BA 2NA2A 2YTPA 1WRJA 1QNTA 1RC7A 1A1KA 2JOBA 1WXRA 4DV0E 3HTXA 2EM6A 4LFBE 4L8NA 4BC7A 2BBGA 4X8WA 4X62E 4LU9A 4LF9E 2RS7A 3MHHC 1GZ6A 5F3WA 2MDRA 2YZTA 1TF3A 3VK6A 4WX9A 4DV2E 3OTOE 1HNZE 1N3GA 4N4RB 2EQ1A 2KONA 2NUGA 1X49A 1Z1BA 2LUQA 1XNQE 3BF2A 2EOXA 2EPCA 1EH6A 2EN4A 5T6JA 2YTIA 2LCEA 4RHBB 4GKKE 4R2EA 4F9AB 2M1SA 3ADGA 3BBGA 3HPSA 2BB8A 2DMIA 4M30A 3HQ1A 4ZYEA 4DV5E 1FJGE 4FK5C 4GEQB 4F6NA 1AAYA 1TN9A 1DI2A 2WCC3 2EM4A 4DR1E 3IWBA 1J5EE 3T1HE 2L2KB 2EQ3A 2V86A 2V88A 2EMIA 4DV6E 4JI3E 3ZOQB 4KHPE 2PRTA 2LJUA 4WPYA 2YTJA 2M9AA 1YPNA 2EOYA 3EPKA 4RH8A 2JY9A 5AC5A 2UXDE 1MGTA 1MEYC 1EH8A 2YWQA 2ODRD 1PDAA 4F2JC 1A1JA 4DR5E 2UUAE 2EMCA 4JI4E 1DGCA 2DIXA 2JPAA 2WZOA 1AH5A 2EL5A 4YY3E 5KL7A 4R2AA 5AC4A 5KL5A 3C4TA 2EOFA 1EKZA 2LBSB 4F54A 1X5WA 2EN1A 4LF5E 2L6MA 2UUBE 4LFAE 5A69A 1JK1A 2UXBE 1IBLE 1J26A 2UU9E 3EPLA 2EOMA 4GZNC 1UN6B 1XMOE 3C6MA 2ZM6E 2EN2A 1LLMC 1RMDA 2HHHE 4O43A 3THOB 2EN3A 4DR3E 3KZZA 3QG5C 1WHQA 3FIGA 2UXCE 2E72A 3J80C 3AUZA 2LRSA 1YSAC 2KHXA 1F2IG 1QU6A 2V87A 5ADZA 4MLVA 3P1XA 4BCAA 4B3ME 2YTQA 4LTYA 2L3JA 4JI5E 5A6BD 3H09A 1N36E 4X64E 2ENAA 2JWOA 2YRMA 2DB2A 2JVAA 4BHCA 1TF6A 2EN8A 2MDGA 3MHSC 1X6HA 2KOUA 4JI1E 2MC5A 4JI6E 2J7JA 2L33A 3DJWA 3IWDA 4O5GA 5AASA 2ODRC 3T1YE 2EMHA 1X48A 2EQ0A 2EPUA 2EPXA 1IMUA 2EPRA 4JI7E 2EMZA 2GLIA 2LUPB 2EMKA 1NCSA 2ENHA 2EN6A 2YTFA 1GQEA 2UUCE 4HEIA 2DMYA 2EPNA 5LMNE 2RPCA 4Q28A 3TQMA 2EM3A 4JI8E 2V85A 1JK2A 2NUFA 3VYXA 4KZSA 1BB8A 1T4NA 1O0WA 4DUZE 1A1GA 2VQEE 4O4KA 4WSPA 2YT4A 2MKNA 2EPLX 2DGCA 2V83A 4JI2E 1YYKA 5KL3A 4GKJE 3JU0A 3ADJA 4YHHE 2JOXA 1UILA 3F6GA 2EE8A 2K4VA 4KWYA 3F6HA 3K6QA 1STUA 2H36X 2R1FA 1YUJA 4DR7E 1YUIA 5IWAE 4DV1E 2EN7A 3HPZA 2EL6A 2F8BA 2EOQA 4ZYDA 1BBGA 2B9DA 2NABA 1G2DC 2DLQA 2L92A 2RQLA 1HNXE 2VQFE 3L00A 2L8TA 2EPZA 4JV5E 1I94E 2JXPA 2N3GA 4R2SA 4ZYHA 4WFTA 2JYAA 2V8QB 4X9JA 1IBKE 1IQOA 2FTXB 2D9HA 3OMLA 2LO3A 4R2RA 2VE7C 2DRPA 2R76A 4P7DA 2RSIA 3J81C 2EL4A 3KWRA 4F6MA 4R8OA 5LMUE 2YTEA 2N3HA 2EOOA 2YTOA 2LVHA 4AQYE
chains in the Genus database with same CATH topology
3VHTB 2EMBA 2EOEA 2EOXA 2ENAA 3UK3C 1ZR9A 2EPCA 2A25A 2YRMA 1A1HA 2JP9A 3EPHA 5KL4A 2EMAA 2EN4A 2EM0A 2YTIA 2LCEA 1TF6A 2EN8A 2MDGA 2VRDA 3MHSC 1X6HA 4R2EA 2EOZA 4R2DA 2YSOA 2EOJA 2J7JA 2BB8A 2DMIA 2HGHA 2EMHA 1X6EA 1X3CA 2EQ0A 2EPUA 2EPXA 4FK5C 2EPRA 2EMZA 4M9VC 2GLIA 4F6NA 2EMKA 1NCSA 1AAYA 1TN9A 2ENHA 2EN6A 2EORA 2YTFA 2WCC3 2EM4A 2EOIA 2RPCA 5KL6A 2EM3A 2CT1A 1JK2A 2EQ3A 2EMIA 1BB8A 1UBDC 2YSPA 2YTNA 2WBSA 2WBTA 2ELYA 1A1GA 2EOSA 1G2FC 4IJDA 2PRTA 2ELZA 4IS1C 2EJ4A 2YTJA 2MKNA 2M9AA 2EP3A 2ADRA 2DGCA 2EOYA 3EPKA 2EMXA 4WSGA 1A1LA 5KL3A 1MEYC 2YRHA 2EM7A 2MKDA 2YU5A 1WJPA 4F2JC 1A1JA 2EMCA 1BBOA 2EE8A 1DGCA 2CSHA 2JPAA 1X6FA 2EM5A 2YTDA 1P47A 2EOHA 2R1FA 1YUJA 1YUIA 2EM2A 1A1FA 2EL5A 2YRKA 3EPJA 2EM9A 2EMFA 5KL7A 2EMLA 2EN7A 5KL5A 4R2AA 2EL6A 2EMGA 2DLKA 2EOFA 2EOQA 2EM8A 1X5WA 2EN1A 2NABA 4R2CA 1ZU1A 2LV2A 1G2DC 2DLQA 2CTDA 2YU8A 4R2PA 1JK1A 2EMWA 3EPLA 2EOMA 4GZNC 2EPZA 2YTPA 1A1KA 1UN6B 2EMYA 2WBUA 1ZAAC 1KJKA 2EN2A 2EM6A 4R2SA 1LLMC 1RMDA 2ENCA 1A1IA 4X9JA 2EPAA 2EPPA 3MHHC 2EN3A 2D9HA 1B69A 2LO3A 5KL2A 4R2RA 1TF3A 2E72A 2DRPA 1YSAC 2RSIA 2EL4A 2LT7A 4R2QA 4F6MA 1F2IG 2YTEA 2I13A 2EQ1A 2YTGA 2EOOA 2GHFA 2LVHA 2YTQA 2YTOA 1Z1BA 3M99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHT B;  2EMB A;  2EOE A;  2EOX A;  2ENA A;  3UK3 C;  1ZR9 A;  2EPC A;  2A25 A;  2YRM A;  1A1H A;  2JP9 A;  3EPH A;  5KL4 A;  2EMA A;  2EN4 A;  2EM0 A;  2YTI A;  2LCE A;  1TF6 A;  2EN8 A;  2MDG A;  2VRD A;  3MHS C;  1X6H A;  4R2E A;  2EOZ A;  4R2D A;  2YSO A;  2EOJ A;  2J7J A;  2BB8 A;  2DMI A;  2HGH A;  2EMH A;  1X6E A;  1X3C A;  2EQ0 A;  2EPU A;  2EPX A;  4FK5 C;  2EPR A;  2EMZ A;  4M9V C;  2GLI A;  4F6N A;  2EMK A;  1NCS A;  1AAY A;  1TN9 A;  2ENH A;  2EN6 A;  2EOR A;  2YTF A;  2WCC 3;  2EM4 A;  2EOI A;  2RPC A;  5KL6 A;  2EM3 A;  2CT1 A;  1JK2 A;  2EQ3 A;  2EMI A;  1BB8 A;  1UBD C;  2YSP A;  2YTN A;  2WBS A;  2WBT A;  2ELY A;  1A1G A;  2EOS A;  1G2F C;  4IJD A;  2PRT A;  2ELZ A;  4IS1 C;  2EJ4 A;  2YTJ A;  2MKN A;  2M9A A;  2EP3 A;  2ADR A;  2DGC A;  2EOY A;  3EPK A;  2EMX A;  4WSG A;  1A1L A;  5KL3 A;  1MEY C;  2YRH A;  2EM7 A;  2MKD A;  2YU5 A;  1WJP A;  4F2J C;  1A1J A;  2EMC A;  1BBO A;  2EE8 A;  1DGC A;  2CSH A;  2JPA A;  1X6F A;  2EM5 A;  2YTD A;  1P47 A;  2EOH A;  2R1F A;  1YUJ A;  1YUI A;  2EM2 A;  1A1F A;  2EL5 A;  2YRK A;  3EPJ A;  2EM9 A;  2EMF A;  5KL7 A;  2EML A;  2EN7 A;  5KL5 A;  4R2A A;  2EL6 A;  2EMG A;  2DLK A;  2EOF A;  2EOQ A;  2EM8 A;  1X5W A;  2EN1 A;  2NAB A;  4R2C A;  1ZU1 A;  2LV2 A;  1G2D C;  2DLQ A;  2CTD A;  2YU8 A;  4R2P A;  1JK1 A;  2EMW A;  3EPL A;  2EOM A;  4GZN C;  2EPZ A;  2YTP A;  1A1K A;  1UN6 B;  2EMY A;  2WBU A;  1ZAA C;  1KJK A;  2EN2 A;  2EM6 A;  4R2S A;  1LLM C;  1RMD A;  2ENC A;  1A1I A;  4X9J A;  2EPA A;  2EPP A;  3MHH C;  2EN3 A;  2D9H A;  1B69 A;  2LO3 A;  5KL2 A;  4R2R A;  1TF3 A;  2E72 A;  2DRP A;  1YSA C;  2RSI A;  2EL4 A;  2LT7 A;  4R2Q A;  4F6M A;  1F2I G;  2YTE A;  2I13 A;  2EQ1 A;  2YTG A;  2EOO A;  2GHF A;  2LVH A;  2YTQ A;  2YTO A;  1Z1B A;  3M99 B; 
#chains in the Genus database with same CATH topology
 1YYW A;  3HXL A;  3VHT B;  4LF4 E;  1ZR9 A;  1A1H A;  2A25 A;  4MLQ A;  2B7T A;  2N8X A;  2JP9 A;  5DNY A;  2EMA A;  3ADI A;  1GTK A;  2EM0 A;  3BID A;  2VRD A;  1SR9 A;  2NUE A;  2EOZ A;  4DR2 E;  4WYQ B;  3J7A G;  1T4O A;  1T38 A;  1UHZ A;  1X3C A;  2G7H A;  4OX9 E;  2LJH A;  3RMP A;  2EOR A;  2M7Q A;  2Q8U A;  2EPK X;  4DV3 E;  1FKA E;  2EPM X;  4K0K E;  2LMZ A;  4B3T E;  3THN A;  2RTX A;  4M0V A;  1DQ3 A;  2YSP A;  2YTN A;  1YYO A;  2WBT A;  2ELY A;  3DF6 A;  2EOS A;  4IJD A;  2ELZ A;  4IS1 C;  2IHR 1;  1WHN A;  2V89 A;  2EJ4 A;  4J8Z A;  2EP3 A;  4WXD A;  4TUG A;  2ADR A;  5LL6 R;  4B3R E;  4HTG A;  3KZY A;  1A1L A;  4ZYG A;  4I8O A;  1T39 A;  3VYY A;  1PJS A;  4DMI A;  5IV8 B;  4X65 E;  2YRH A;  4LF7 E;  2MC6 A;  2YU5 A;  5FLX C;  5IT9 C;  3JAM C;  2B7V A;  1PJQ A;  3BGH A;  1XMQ E;  2CSH A;  4F9C B;  4WXC A;  2HJJ A;  1X6F A;  1N34 E;  2YTD A;  2EM2 A;  1N32 E;  3EPJ A;  2VF1 A;  4DR6 E;  3C6K A;  2EMF A;  2EML A;  2EMG A;  1HR0 E;  1IQS A;  5A6J A;  1YFH A;  2CTD A;  3EQ1 A;  1L4S A;  2YU8 A;  2E1M A;  2EMW A;  2EMY A;  1PKP A;  2WBU A;  1ZAA C;  1KJK A;  4NXN E;  2LTR A;  2ENC A;  2EPO A;  1A1I A;  4NZV A;  2EPA A;  2EPP A;  4OOG C;  4DV7 E;  1SFE A;  1B69 A;  5KL2 A;  2YPN A;  4DUY E;  5LLQ A;  2RSM A;  3IWC A;  4Q35 B;  2LT7 A;  4R2Q A;  2I13 A;  2YTG A;  5A6K A;  5AE1 A;  2GHF A;  4DKK A;  4BMJ A;  4LF8 E;  3M99 B;  1RQ0 A;  4JI0 E;  2M4I A;  2L3C A;  2FGG A;  2EMB A;  2EOE A;  1ZBT A;  3UK3 C;  3EPH A;  1N33 E;  2RS6 A;  5KL4 A;  4LF6 E;  4LFC E;  2LTS A;  2L2M A;  1IBM E;  2F4V E;  2E5L E;  3AV0 A;  1NEI A;  4BS9 A;  4DV4 E;  4BC9 A;  2LE2 A;  2YSO A;  2EOJ A;  2EWL A;  4R2D A;  1X47 A;  2I9I A;  4NHR A;  1T4L B;  2HGH A;  4M2Z A;  1X6E A;  5AE3 A;  3JTZ A;  4F9B B;  5TSE A;  4M9V C;  3ECR A;  2EZ6 A;  3LML A;  5A6B A;  5CFF E;  4DR4 E;  2EOI A;  1HNW E;  4BHB A;  4L5N C;  2B3T B;  4R03 A;  5KL6 A;  5A2Q C;  2CT1 A;  5BR8 E;  1EH7 A;  3LLH A;  1UBD C;  4JYA E;  2DSY A;  2WBS A;  1PJT A;  1ZBQ A;  1XNR E;  2L2N A;  1G2F C;  4BBY A;  2FV4 B;  2HC5 A;  2EMX A;  4WSG A;  5AE2 A;  2EM7 A;  2MKD A;  1WJP A;  2GPI A;  1BBO A;  4O24 A;  5A6A A;  2EM5 A;  4X66 E;  1P47 A;  2CPN A;  2EOH A;  1A1F A;  2YRK A;  2EM9 A;  2JR1 A;  4B3S E;  3MSW A;  2DLK A;  4TUI A;  2EM8 A;  3J7Y p;  1YZ9 A;  3ADL A;  4R2C A;  1ZU1 A;  2LV2 A;  1KYQ A;  2K7I A;  4R2P A;  4P78 A;  5IXM B;  4NXM E;  3C4B A;  2NA2 A;  2YTP A;  1WRJ A;  1QNT A;  1RC7 A;  1A1K A;  2JOB A;  1WXR A;  4DV0 E;  3HTX A;  2EM6 A;  4LFB E;  4L8N A;  4BC7 A;  2BBG A;  4X8W A;  4X62 E;  4LU9 A;  4LF9 E;  2RS7 A;  3MHH C;  1GZ6 A;  5F3W A;  2MDR A;  2YZT A;  1TF3 A;  3VK6 A;  4WX9 A;  4DV2 E;  3OTO E;  1HNZ E;  1N3G A;  4N4R B;  2EQ1 A;  2KON A;  2NUG A;  1X49 A;  1Z1B A;  2LUQ A;  1XNQ E;  3BF2 A;  2EOX A;  2EPC A;  1EH6 A;  2EN4 A;  5T6J A;  2YTI A;  2LCE A;  4RHB B;  4GKK E;  4R2E A;  4F9A B;  2M1S A;  3ADG A;  3BBG A;  3HPS A;  2BB8 A;  2DMI A;  4M30 A;  3HQ1 A;  4ZYE A;  4DV5 E;  1FJG E;  4FK5 C;  4GEQ B;  4F6N A;  1AAY A;  1TN9 A;  1DI2 A;  2WCC 3;  2EM4 A;  4DR1 E;  3IWB A;  1J5E E;  3T1H E;  2L2K B;  2EQ3 A;  2V86 A;  2V88 A;  2EMI A;  4DV6 E;  4JI3 E;  3ZOQ B;  4KHP E;  2PRT A;  2LJU A;  4WPY A;  2YTJ A;  2M9A A;  1YPN A;  2EOY A;  3EPK A;  4RH8 A;  2JY9 A;  5AC5 A;  2UXD E;  1MGT A;  1MEY C;  1EH8 A;  2YWQ A;  2ODR D;  1PDA A;  4F2J C;  1A1J A;  4DR5 E;  2UUA E;  2EMC A;  4JI4 E;  1DGC A;  2DIX A;  2JPA A;  2WZO A;  1AH5 A;  2EL5 A;  4YY3 E;  5KL7 A;  4R2A A;  5AC4 A;  5KL5 A;  3C4T A;  2EOF A;  1EKZ A;  2LBS B;  4F54 A;  1X5W A;  2EN1 A;  4LF5 E;  2L6M A;  2UUB E;  4LFA E;  5A69 A;  1JK1 A;  2UXB E;  1IBL E;  1J26 A;  2UU9 E;  3EPL A;  2EOM A;  4GZN C;  1UN6 B;  1XMO E;  3C6M A;  2ZM6 E;  2EN2 A;  1LLM C;  1RMD A;  2HHH E;  4O43 A;  3THO B;  2EN3 A;  4DR3 E;  3KZZ A;  3QG5 C;  1WHQ A;  3FIG A;  2UXC E;  2E72 A;  3J80 C;  3AUZ A;  2LRS A;  1YSA C;  2KHX A;  1F2I G;  1QU6 A;  2V87 A;  5ADZ A;  4MLV A;  3P1X A;  4BCA A;  4B3M E;  2YTQ A;  4LTY A;  2L3J A;  4JI5 E;  5A6B D;  3H09 A;  1N36 E;  4X64 E;  2ENA A;  2JWO A;  2YRM A;  2DB2 A;  2JVA A;  4BHC A;  1TF6 A;  2EN8 A;  2MDG A;  3MHS C;  1X6H A;  2KOU A;  4JI1 E;  2MC5 A;  4JI6 E;  2J7J A;  2L33 A;  3DJW A;  3IWD A;  4O5G A;  5AAS A;  2ODR C;  3T1Y E;  2EMH A;  1X48 A;  2EQ0 A;  2EPU A;  2EPX A;  1IMU A;  2EPR A;  4JI7 E;  2EMZ A;  2GLI A;  2LUP B;  2EMK A;  1NCS A;  2ENH A;  2EN6 A;  2YTF A;  1GQE A;  2UUC E;  4HEI A;  2DMY A;  2EPN A;  5LMN E;  2RPC A;  4Q28 A;  3TQM A;  2EM3 A;  4JI8 E;  2V85 A;  1JK2 A;  2NUF A;  3VYX A;  4KZS A;  1BB8 A;  1T4N A;  1O0W A;  4DUZ E;  1A1G A;  2VQE E;  4O4K A;  4WSP A;  2YT4 A;  2MKN A;  2EPL X;  2DGC A;  2V83 A;  4JI2 E;  1YYK A;  5KL3 A;  4GKJ E;  3JU0 A;  3ADJ A;  4YHH E;  2JOX A;  1UIL A;  3F6G A;  2EE8 A;  2K4V A;  4KWY A;  3F6H A;  3K6Q A;  1STU A;  2H36 X;  2R1F A;  1YUJ A;  4DR7 E;  1YUI A;  5IWA E;  4DV1 E;  2EN7 A;  3HPZ A;  2EL6 A;  2F8B A;  2EOQ A;  4ZYD A;  1BBG A;  2B9D A;  2NAB A;  1G2D C;  2DLQ A;  2L92 A;  2RQL A;  1HNX E;  2VQF E;  3L00 A;  2L8T A;  2EPZ A;  4JV5 E;  1I94 E;  2JXP A;  2N3G A;  4R2S A;  4ZYH A;  4WFT A;  2JYA A;  2V8Q B;  4X9J A;  1IBK E;  1IQO A;  2FTX B;  2D9H A;  3OML A;  2LO3 A;  4R2R A;  2VE7 C;  2DRP A;  2R76 A;  4P7D A;  2RSI A;  3J81 C;  2EL4 A;  3KWR A;  4F6M A;  4R8O A;  5LMU E;  2YTE A;  2N3H A;  2EOO A;  2YTO A;  2LVH A;  4AQY E; 
#chains in the Genus database with same CATH homology
 3VHT B;  2EMB A;  2EOE A;  2EOX A;  2ENA A;  3UK3 C;  1ZR9 A;  2EPC A;  2A25 A;  2YRM A;  1A1H A;  2JP9 A;  3EPH A;  5KL4 A;  2EMA A;  2EN4 A;  2EM0 A;  2YTI A;  2LCE A;  1TF6 A;  2EN8 A;  2MDG A;  2VRD A;  3MHS C;  1X6H A;  4R2E A;  2EOZ A;  4R2D A;  2YSO A;  2EOJ A;  2J7J A;  2BB8 A;  2DMI A;  2HGH A;  2EMH A;  1X6E A;  1X3C A;  2EQ0 A;  2EPU A;  2EPX A;  4FK5 C;  2EPR A;  2EMZ A;  4M9V C;  2GLI A;  4F6N A;  2EMK A;  1NCS A;  1AAY A;  1TN9 A;  2ENH A;  2EN6 A;  2EOR A;  2YTF A;  2WCC 3;  2EM4 A;  2EOI A;  2RPC A;  5KL6 A;  2EM3 A;  2CT1 A;  1JK2 A;  2EQ3 A;  2EMI A;  1BB8 A;  1UBD C;  2YSP A;  2YTN A;  2WBS A;  2WBT A;  2ELY A;  1A1G A;  2EOS A;  1G2F C;  4IJD A;  2PRT A;  2ELZ A;  4IS1 C;  2EJ4 A;  2YTJ A;  2MKN A;  2M9A A;  2EP3 A;  2ADR A;  2DGC A;  2EOY A;  3EPK A;  2EMX A;  4WSG A;  1A1L A;  5KL3 A;  1MEY C;  2YRH A;  2EM7 A;  2MKD A;  2YU5 A;  1WJP A;  4F2J C;  1A1J A;  2EMC A;  1BBO A;  2EE8 A;  1DGC A;  2CSH A;  2JPA A;  1X6F A;  2EM5 A;  2YTD A;  1P47 A;  2EOH A;  2R1F A;  1YUJ A;  1YUI A;  2EM2 A;  1A1F A;  2EL5 A;  2YRK A;  3EPJ A;  2EM9 A;  2EMF A;  5KL7 A;  2EML A;  2EN7 A;  5KL5 A;  4R2A A;  2EL6 A;  2EMG A;  2DLK A;  2EOF A;  2EOQ A;  2EM8 A;  1X5W A;  2EN1 A;  2NAB A;  4R2C A;  1ZU1 A;  2LV2 A;  1G2D C;  2DLQ A;  2CTD A;  2YU8 A;  4R2P A;  1JK1 A;  2EMW A;  3EPL A;  2EOM A;  4GZN C;  2EPZ A;  2YTP A;  1A1K A;  1UN6 B;  2EMY A;  2WBU A;  1ZAA C;  1KJK A;  2EN2 A;  2EM6 A;  4R2S A;  1LLM C;  1RMD A;  2ENC A;  1A1I A;  4X9J A;  2EPA A;  2EPP A;  3MHH C;  2EN3 A;  2D9H A;  1B69 A;  2LO3 A;  5KL2 A;  4R2R A;  1TF3 A;  2E72 A;  2DRP A;  1YSA C;  2RSI A;  2EL4 A;  2LT7 A;  4R2Q A;  4F6M A;  1F2I G;  2YTE A;  2I13 A;  2EQ1 A;  2YTG A;  2EOO A;  2GHF A;  2LVH A;  2YTQ A;  2YTO A;  1Z1B A;  3M99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...