2DLKA

Solution structure of the first and the second zf-c2h2 domains of zinc finger protein 692
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
GSSGSSGMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first and the second zf-C2H2 domains of zinc finger protein 692
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords novel protein
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA01
2I13A 5KL3A 2WBTA 2LT7A 2HGHA 2WBSA 2D9HA 2EN3A 2EOIA 4R2PA 2EPCA 2YTNA 2WBUA 2EMIA 2DLQA 2ELYA 2EQ1A 3EPJA 4R2AA 2EOHA 4GZNC 2EN7A 2YTDA 2PRTA 1A1KA 4M9VC 2YTIA 1RMDA 5KL2A 2YU8A 2YTFA 1B69A 2EM0A 4R2CA 1WJPA 2EL4A 1LLMC 1A1FA 2EMAA 2YRKA 4R2SA 1AAYA 2R1FA 2EM2A 1KJKA 4F2JC 1UBDC 2EMFA 4R2EA 2ADRA 2EPRA 1TF6A 2GLIA 1MEYC 1X6HA 2ENAA 2DRPA 2YRMA 3M99B 1BB8A 2EMZA 2EN1A 4F6MA 2A25A 1X6EA 2EPXA 2EMKA 2NABA 2YTPA 1G2FC 2EM4A 1BBOA 1X5WA 2YU5A 2MDGA 1P47A 3EPKA 2YTOA 2EORA 3MHHC 1JK2A 2EN2A 5KL4A 1A1LA 2YTGA 1A1GA 2YRHA 1YSAC 2EMYA 2EPAA 1ZR9A 1ZAAC 4R2RA 2RPCA 2E72A 1UN6B 2CT1A 5KL6A 1Z1BA 2EJ4A 2EL5A 1A1JA 1YUJA 2EMXA 2LVHA 4IS1C 2EOXA 2EOMA 2BB8A 2EOEA 2EL6A 1G2DC 2GHFA 2YTJA 4IJDA 4FK5C 2LCEA 2EE8A 2WCC3 1F2IG 1JK1A 2ENHA 2EP3A 3EPLA 2EPZA 4F6NA 2EM3A 2EOJA 2EOFA 2EMCA 2EPUA 2MKNA 2CTDA 2YTQA 4X9JA 1A1HA 4WSGA 3VHTB 2YSPA 2DLKA 2EOYA 2EOOA 2RSIA 1X6FA 2DMIA 2VRDA 1X3CA 2EPPA 2EMBA 2M9AA 1YUIA 5KL5A 2EM7A 2EN8A 2JPAA 2EMHA 1TN9A 2EN6A 2EOZA 2EQ3A 2EOQA 2ELZA 2MKDA 2LV2A 2CSHA 2EQ0A 2EM6A 2J7JA 2JP9A 2EOSA 3UK3C 2EN4A 2YSOA 2EM8A 5KL7A 4R2DA 3EPHA 2EM5A 2EMWA 1A1IA 2LO3A 4R2QA 1TF3A 2DGCA 3MHSC 1ZU1A 2YTEA 2EMLA 2EMGA 1DGCA 2ENCA 1NCSA 2EM9A
chains in the Genus database with same CATH superfamily
4DV3E 5AE2A 2LT7A 2D9HA 2EZ6A 2EOIA 2ODRD 5TSEA 4BBYA 5LL6R 2EQ1A 3EPJA 1IBLE 1XNQE 4WFTA 2M7QA 4OOGC 2YTIA 4OX9E 3BBGA 1DI2A 2H36X 2YU8A 2YTFA 4TUGA 1B69A 2KHXA 2VQFE 2EM0A 2EL4A 4NHRA 4DR3E 3LLHA 2R1FA 4BHBA 4F2JC 4Q35B 1UBDC 2RTXA 2L3CA 4R2EA 1MEYC 1X6HA 4M30A 4JI8E 3M99B 3OMLA 4F9CB 5IWAE 4F6MA 2A25A 1X6EA 3C4TA 2EMKA 1MGTA 2EM4A 2HJJA 1BBOA 4JI7E 2YTOA 2RSMA 3J81C 4O43A 2EMYA 2EPAA 4LF5E 4P7DA 1WRJA 3C4BA 4X66E 4R2RA 2E72A 2JYAA 2B7TA 5F3WA 4KHPE 2EJ4A 2L3JA 4F9BB 2I9IA 2EMXA 2CPNA 2YZTA 2EOMA 2BB8A 3VYYA 2V8QB 2MDRA 2GHFA 4IJDA 4FK5C 2LCEA 4X65E 2YT4A 4B3ME 4DUZE 2EP3A 3EPLA 2EM3A 2EOJA 3THOB 2V83A 2VF1A 4WSGA 5A6AA 2YSPA 3F6GA 2L92A 5LLQA 2DMIA 2EPMX 2LJHA 2VRDA 5DNYA 2LUQA 4LFAE 2M9AA 4NXNE 5KL5A 2EN8A 1GTKA 1AH5A 3VK6A 5IXMB 4M0VA 2EOQA 3FIGA 2MKDA 2L6MA 2CSHA 2EM6A 1J5EE 2B7VA 2R76A 2EOSA 2UXCE 1EH8A 2EN4A 4MLQA 3UK3C 4LF4E 1N3GA 4LU9A 1HR0E 3EPHA 2MC6A 5AE3A 4R2QA 4ZYGA 1T4LB 2YTEA 3H09A 4JI4E 4DR6E 4ZYHA 4R8OA 2ENCA 2IHR1 2ZM6E 3HTXA 5KL3A 3LMLA 3VYXA 1X47A 2HGHA 2WBSA 2EN3A 1PKPA 3T1HE 4R2PA 2WBUA 4I8OA 2EMIA 5CFFE 2UXBE 2PRTA 1O0WA 1IQOA 1XMOE 1X49A 5BR8E 2EMAA 2YRKA 4HTGA 4MLVA 4R2SA 2EPLX 1AAYA 1KJKA 2LBSB 2LMZA 4LTYA 3JU0A 4YHHE 2EPRA 1TF6A 2V86A 3TQMA 4L8NA 4NZVA 2EMZA 2LTSA 5IV8B 2BBGA 2YTPA 1WHQA 2L2NA 1G2FC 5A6KA 1PJQA 3EPKA 2UUBE 2V87A 2EORA 4O24A 4AQYE 1A1GA 1A1LA 2JWOA 2RS6A 1ZR9A 2LTRA 1ZAAC 2MC5A 2N3HA 1DQ3A 4WXDA 1GZ6A 1T38A 2YPNA 1PJTA 1Z1BA 4DV7E 4BC7A 1A1JA 2KONA 2LVHA 3BF2A 2L33A 4NXME 4WXCA 2RQLA 4GKKE 2EL6A 1G2DC 2WCC3 4X64E 3J7AG 2ENHA 3F6HA 2V89A 4WX9A 4F6NA 1YZ9A 4WYQB 2B3TB 2VE7C 2YTQA 3VHTB 1HNXE 1N32E 2K7IA 1YPNA 2EOOA 2RSIA 2F8BA 4ZYEA 4R03A 2E5LE 1T4NA 4TUIA 1SR9A 4DV0E 1N33E 5A6BD 1TN9A 4O4KA 2M4IA 4LFCE 1HNZE 3T1YE 3ADIA 2JOXA 4RHBB 1I94E 4LF8E 2EM5A 2N3GA 1A1IA 2LO3A 3DJWA 3C6MA 3IWCA 1TF3A 1ZU1A 3BGHA 4JV5E 2FV4B 2EM9A 2I13A 2WBTA 3HXLA 1IBME 1L4SA 1PJSA 2DLQA 4R2AA 2EOHA 3ADGA 2EN7A 2FTXB 2L8TA 2YTDA 1A1KA 4JI3E 1RMDA 5KL2A 4F9AB 4GKJE 5T6JA 3KZYA 4J8ZA 4P78A 5AC5A 3EQ1A 2G7HA 4R2CA 2EPNA 2V85A 5A6BA 2EMFA 4Q28A 1QNTA 4WPYA 3J80C 4DR7E 1NEIA 2ENAA 4X62E 3HPSA 2DRPA 2YRMA 3KWRA 2HC5A 1BB8A 4LFBE 2EPXA 2EPKX 2F4VE 4O5GA 1YFHA 1X5WA 1UHZA 2YU5A 2MDGA 4DR5E 1N36E 5A2QC 5KL4A 1BBGA 4JYAE 2YRHA 1YSAC 3KZZA 3AV0A 2RPCA 2VQEE 4JI0E 5KL6A 1UN6B 2DB2A 1YUJA 4X8WA 2YWQA 2LRSA 1KYQA 2LE2A 2EOEA 3RMPA 2L2MA 1JK1A 4DV5E 2GPIA 2UUAE 3P1XA 5AC4A 2EPZA 2EOFA 1RQ0A 2EMCA 4DR1E 5A6JA 4M2ZA 2MKNA 5LMNE 2JXPA 4X9JA 2UU9E 2EOYA 1X6FA 1RC7A 2EMBA 3JAMC 1IBKE 4JI1E 1YUIA 2EM7A 2B9DA 2JPAA 4B3SE 1IQSA 2EN6A 2EOZA 2LJUA 2EQ3A 2LUPB 2ELZA 3HPZA 1QU6A 2NUGA 4DV6E 1IMUA 2EQ0A 4JI5E 2YSOA 2EM8A 5KL7A 4LF7E 2DMYA 4R2DA 4DV1E 2DIXA 2JR1A 4WSPA 2E1MA 2DGCA 2RS7A 3MHSC 2JY9A 2EMLA 3L00A 2EMGA 1DGCA 2UUCE 4HEIA 4DKKA 1YYOA 4KWYA 4DMIA 1ZBTA 4DUYE 2EPCA 2YTNA 2JOBA 2ELYA 1EH7A 3JTZA 3ZOQB 4JI2E 4GZNC 2EPOA 1PDAA 1HNWE 4M9VC 4K0KE 2WZOA 1EKZA 1T39A 3THNA 2JVAA 4DR4E 4L5NC 1WJPA 1LLMC 1SFEA 1A1FA 4B3TE 2EM2A 4YY3E 4LF6E 2ADRA 2GLIA 3C6KA 2K4VA 2EN1A 3J7Yp 2NABA 1UILA 5FLXC 2ODRC 3QG5C 1EH6A 2KOUA 1P47A 1XMQE 1X48A 1GQEA 3OTOE 3MHHC 4BMJA 1WHNA 5AASA 1JK2A 2EN2A 2YTGA 2Q8UA 2N8XA 4LF9E 3AUZA 2CT1A 2HHHE 2EL5A 4N4RB 4IS1C 2EOXA 1FKAE 4JI6E 4DV2E 2M1SA 3IWBA 4DR2E 2YTJA 1YYKA 2DSYA 2EE8A 3MSWA 1F2IG 3HQ1A 4RH8A 2EPUA 2CTDA 1A1HA 4F54A 2NA2A 2DLKA 4DV4E 1N34E 2NUEA 2FGGA 1X3CA 2EPPA 2L2KB 5A69A 1J26A 5AE1A 4BCAA 3K6QA 2EMHA 4KZSA 3ECRA 4BHCA 1YYWA 1STUA 5ADZA 2LV2A 5LMUE 2JP9A 2J7JA 2UXDE 5IT9C 2NUFA 1XNRE 1T4OA 3BIDA 2V88A 4B3RE 3IWDA 3DF6A 2EMWA 3ADLA 1ZBQA 4GEQB 4BS9A 1FJGE 4ZYDA 3ADJA 2EWLA 1WXRA 4BC9A 1NCSA
chains in the Genus database with same CATH topology
2I13A 5KL3A 2WBTA 2LT7A 2HGHA 2WBSA 2D9HA 2EN3A 2EOIA 4R2PA 2EPCA 2YTNA 2WBUA 2EMIA 2DLQA 2ELYA 2EQ1A 3EPJA 4R2AA 2EOHA 4GZNC 2EN7A 2YTDA 2PRTA 1A1KA 4M9VC 2YTIA 1RMDA 5KL2A 2YU8A 2YTFA 1B69A 2EM0A 4R2CA 1WJPA 2EL4A 1LLMC 1A1FA 2EMAA 2YRKA 4R2SA 1AAYA 2R1FA 2EM2A 1KJKA 4F2JC 1UBDC 2EMFA 4R2EA 2ADRA 2EPRA 1TF6A 2GLIA 1MEYC 1X6HA 2ENAA 2DRPA 2YRMA 3M99B 1BB8A 2EMZA 2EN1A 4F6MA 2A25A 1X6EA 2EPXA 2EMKA 2NABA 2YTPA 1G2FC 2EM4A 1BBOA 1X5WA 2YU5A 2MDGA 1P47A 3EPKA 2YTOA 2EORA 3MHHC 1JK2A 2EN2A 5KL4A 1A1LA 2YTGA 1A1GA 2YRHA 1YSAC 2EMYA 2EPAA 1ZR9A 1ZAAC 4R2RA 2RPCA 2E72A 1UN6B 2CT1A 5KL6A 1Z1BA 2EJ4A 2EL5A 1A1JA 1YUJA 2EMXA 2LVHA 4IS1C 2EOXA 2EOMA 2BB8A 2EOEA 2EL6A 1G2DC 2GHFA 2YTJA 4IJDA 4FK5C 2LCEA 2EE8A 2WCC3 1F2IG 1JK1A 2ENHA 2EP3A 3EPLA 2EPZA 4F6NA 2EM3A 2EOJA 2EOFA 2EMCA 2EPUA 2MKNA 2CTDA 2YTQA 4X9JA 1A1HA 4WSGA 3VHTB 2YSPA 2DLKA 2EOYA 2EOOA 2RSIA 1X6FA 2DMIA 2VRDA 1X3CA 2EPPA 2EMBA 2M9AA 1YUIA 5KL5A 2EM7A 2EN8A 2JPAA 2EMHA 1TN9A 2EN6A 2EOZA 2EQ3A 2EOQA 2ELZA 2MKDA 2LV2A 2CSHA 2EQ0A 2EM6A 2J7JA 2JP9A 2EOSA 3UK3C 2EN4A 2YSOA 2EM8A 5KL7A 4R2DA 3EPHA 2EM5A 2EMWA 1A1IA 2LO3A 4R2QA 1TF3A 2DGCA 3MHSC 1ZU1A 2YTEA 2EMLA 2EMGA 1DGCA 2ENCA 1NCSA 2EM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I13 A;  5KL3 A;  2WBT A;  2LT7 A;  2HGH A;  2WBS A;  2D9H A;  2EN3 A;  2EOI A;  4R2P A;  2EPC A;  2YTN A;  2WBU A;  2EMI A;  2DLQ A;  2ELY A;  2EQ1 A;  3EPJ A;  4R2A A;  2EOH A;  4GZN C;  2EN7 A;  2YTD A;  2PRT A;  1A1K A;  4M9V C;  2YTI A;  1RMD A;  5KL2 A;  2YU8 A;  2YTF A;  1B69 A;  2EM0 A;  4R2C A;  1WJP A;  2EL4 A;  1LLM C;  1A1F A;  2EMA A;  2YRK A;  4R2S A;  1AAY A;  2R1F A;  2EM2 A;  1KJK A;  4F2J C;  1UBD C;  2EMF A;  4R2E A;  2ADR A;  2EPR A;  1TF6 A;  2GLI A;  1MEY C;  1X6H A;  2ENA A;  2DRP A;  2YRM A;  3M99 B;  1BB8 A;  2EMZ A;  2EN1 A;  4F6M A;  2A25 A;  1X6E A;  2EPX A;  2EMK A;  2NAB A;  2YTP A;  1G2F C;  2EM4 A;  1BBO A;  1X5W A;  2YU5 A;  2MDG A;  1P47 A;  3EPK A;  2YTO A;  2EOR A;  3MHH C;  1JK2 A;  2EN2 A;  5KL4 A;  1A1L A;  2YTG A;  1A1G A;  2YRH A;  1YSA C;  2EMY A;  2EPA A;  1ZR9 A;  1ZAA C;  4R2R A;  2RPC A;  2E72 A;  1UN6 B;  2CT1 A;  5KL6 A;  1Z1B A;  2EJ4 A;  2EL5 A;  1A1J A;  1YUJ A;  2EMX A;  2LVH A;  4IS1 C;  2EOX A;  2EOM A;  2BB8 A;  2EOE A;  2EL6 A;  1G2D C;  2GHF A;  2YTJ A;  4IJD A;  4FK5 C;  2LCE A;  2EE8 A;  2WCC 3;  1F2I G;  1JK1 A;  2ENH A;  2EP3 A;  3EPL A;  2EPZ A;  4F6N A;  2EM3 A;  2EOJ A;  2EOF A;  2EMC A;  2EPU A;  2MKN A;  2CTD A;  2YTQ A;  4X9J A;  1A1H A;  4WSG A;  3VHT B;  2YSP A;  2DLK A;  2EOY A;  2EOO A;  2RSI A;  1X6F A;  2DMI A;  2VRD A;  1X3C A;  2EPP A;  2EMB A;  2M9A A;  1YUI A;  5KL5 A;  2EM7 A;  2EN8 A;  2JPA A;  2EMH A;  1TN9 A;  2EN6 A;  2EOZ A;  2EQ3 A;  2EOQ A;  2ELZ A;  2MKD A;  2LV2 A;  2CSH A;  2EQ0 A;  2EM6 A;  2J7J A;  2JP9 A;  2EOS A;  3UK3 C;  2EN4 A;  2YSO A;  2EM8 A;  5KL7 A;  4R2D A;  3EPH A;  2EM5 A;  2EMW A;  1A1I A;  2LO3 A;  4R2Q A;  1TF3 A;  2DGC A;  3MHS C;  1ZU1 A;  2YTE A;  2EML A;  2EMG A;  1DGC A;  2ENC A;  1NCS A;  2EM9 A; 
#chains in the Genus database with same CATH topology
 4DV3 E;  5AE2 A;  2LT7 A;  2D9H A;  2EZ6 A;  2EOI A;  2ODR D;  5TSE A;  4BBY A;  5LL6 R;  2EQ1 A;  3EPJ A;  1IBL E;  1XNQ E;  4WFT A;  2M7Q A;  4OOG C;  2YTI A;  4OX9 E;  3BBG A;  1DI2 A;  2H36 X;  2YU8 A;  2YTF A;  4TUG A;  1B69 A;  2KHX A;  2VQF E;  2EM0 A;  2EL4 A;  4NHR A;  4DR3 E;  3LLH A;  2R1F A;  4BHB A;  4F2J C;  4Q35 B;  1UBD C;  2RTX A;  2L3C A;  4R2E A;  1MEY C;  1X6H A;  4M30 A;  4JI8 E;  3M99 B;  3OML A;  4F9C B;  5IWA E;  4F6M A;  2A25 A;  1X6E A;  3C4T A;  2EMK A;  1MGT A;  2EM4 A;  2HJJ A;  1BBO A;  4JI7 E;  2YTO A;  2RSM A;  3J81 C;  4O43 A;  2EMY A;  2EPA A;  4LF5 E;  4P7D A;  1WRJ A;  3C4B A;  4X66 E;  4R2R A;  2E72 A;  2JYA A;  2B7T A;  5F3W A;  4KHP E;  2EJ4 A;  2L3J A;  4F9B B;  2I9I A;  2EMX A;  2CPN A;  2YZT A;  2EOM A;  2BB8 A;  3VYY A;  2V8Q B;  2MDR A;  2GHF A;  4IJD A;  4FK5 C;  2LCE A;  4X65 E;  2YT4 A;  4B3M E;  4DUZ E;  2EP3 A;  3EPL A;  2EM3 A;  2EOJ A;  3THO B;  2V83 A;  2VF1 A;  4WSG A;  5A6A A;  2YSP A;  3F6G A;  2L92 A;  5LLQ A;  2DMI A;  2EPM X;  2LJH A;  2VRD A;  5DNY A;  2LUQ A;  4LFA E;  2M9A A;  4NXN E;  5KL5 A;  2EN8 A;  1GTK A;  1AH5 A;  3VK6 A;  5IXM B;  4M0V A;  2EOQ A;  3FIG A;  2MKD A;  2L6M A;  2CSH A;  2EM6 A;  1J5E E;  2B7V A;  2R76 A;  2EOS A;  2UXC E;  1EH8 A;  2EN4 A;  4MLQ A;  3UK3 C;  4LF4 E;  1N3G A;  4LU9 A;  1HR0 E;  3EPH A;  2MC6 A;  5AE3 A;  4R2Q A;  4ZYG A;  1T4L B;  2YTE A;  3H09 A;  4JI4 E;  4DR6 E;  4ZYH A;  4R8O A;  2ENC A;  2IHR 1;  2ZM6 E;  3HTX A;  5KL3 A;  3LML A;  3VYX A;  1X47 A;  2HGH A;  2WBS A;  2EN3 A;  1PKP A;  3T1H E;  4R2P A;  2WBU A;  4I8O A;  2EMI A;  5CFF E;  2UXB E;  2PRT A;  1O0W A;  1IQO A;  1XMO E;  1X49 A;  5BR8 E;  2EMA A;  2YRK A;  4HTG A;  4MLV A;  4R2S A;  2EPL X;  1AAY A;  1KJK A;  2LBS B;  2LMZ A;  4LTY A;  3JU0 A;  4YHH E;  2EPR A;  1TF6 A;  2V86 A;  3TQM A;  4L8N A;  4NZV A;  2EMZ A;  2LTS A;  5IV8 B;  2BBG A;  2YTP A;  1WHQ A;  2L2N A;  1G2F C;  5A6K A;  1PJQ A;  3EPK A;  2UUB E;  2V87 A;  2EOR A;  4O24 A;  4AQY E;  1A1G A;  1A1L A;  2JWO A;  2RS6 A;  1ZR9 A;  2LTR A;  1ZAA C;  2MC5 A;  2N3H A;  1DQ3 A;  4WXD A;  1GZ6 A;  1T38 A;  2YPN A;  1PJT A;  1Z1B A;  4DV7 E;  4BC7 A;  1A1J A;  2KON A;  2LVH A;  3BF2 A;  2L33 A;  4NXM E;  4WXC A;  2RQL A;  4GKK E;  2EL6 A;  1G2D C;  2WCC 3;  4X64 E;  3J7A G;  2ENH A;  3F6H A;  2V89 A;  4WX9 A;  4F6N A;  1YZ9 A;  4WYQ B;  2B3T B;  2VE7 C;  2YTQ A;  3VHT B;  1HNX E;  1N32 E;  2K7I A;  1YPN A;  2EOO A;  2RSI A;  2F8B A;  4ZYE A;  4R03 A;  2E5L E;  1T4N A;  4TUI A;  1SR9 A;  4DV0 E;  1N33 E;  5A6B D;  1TN9 A;  4O4K A;  2M4I A;  4LFC E;  1HNZ E;  3T1Y E;  3ADI A;  2JOX A;  4RHB B;  1I94 E;  4LF8 E;  2EM5 A;  2N3G A;  1A1I A;  2LO3 A;  3DJW A;  3C6M A;  3IWC A;  1TF3 A;  1ZU1 A;  3BGH A;  4JV5 E;  2FV4 B;  2EM9 A;  2I13 A;  2WBT A;  3HXL A;  1IBM E;  1L4S A;  1PJS A;  2DLQ A;  4R2A A;  2EOH A;  3ADG A;  2EN7 A;  2FTX B;  2L8T A;  2YTD A;  1A1K A;  4JI3 E;  1RMD A;  5KL2 A;  4F9A B;  4GKJ E;  5T6J A;  3KZY A;  4J8Z A;  4P78 A;  5AC5 A;  3EQ1 A;  2G7H A;  4R2C A;  2EPN A;  2V85 A;  5A6B A;  2EMF A;  4Q28 A;  1QNT A;  4WPY A;  3J80 C;  4DR7 E;  1NEI A;  2ENA A;  4X62 E;  3HPS A;  2DRP A;  2YRM A;  3KWR A;  2HC5 A;  1BB8 A;  4LFB E;  2EPX A;  2EPK X;  2F4V E;  4O5G A;  1YFH A;  1X5W A;  1UHZ A;  2YU5 A;  2MDG A;  4DR5 E;  1N36 E;  5A2Q C;  5KL4 A;  1BBG A;  4JYA E;  2YRH A;  1YSA C;  3KZZ A;  3AV0 A;  2RPC A;  2VQE E;  4JI0 E;  5KL6 A;  1UN6 B;  2DB2 A;  1YUJ A;  4X8W A;  2YWQ A;  2LRS A;  1KYQ A;  2LE2 A;  2EOE A;  3RMP A;  2L2M A;  1JK1 A;  4DV5 E;  2GPI A;  2UUA E;  3P1X A;  5AC4 A;  2EPZ A;  2EOF A;  1RQ0 A;  2EMC A;  4DR1 E;  5A6J A;  4M2Z A;  2MKN A;  5LMN E;  2JXP A;  4X9J A;  2UU9 E;  2EOY A;  1X6F A;  1RC7 A;  2EMB A;  3JAM C;  1IBK E;  4JI1 E;  1YUI A;  2EM7 A;  2B9D A;  2JPA A;  4B3S E;  1IQS A;  2EN6 A;  2EOZ A;  2LJU A;  2EQ3 A;  2LUP B;  2ELZ A;  3HPZ A;  1QU6 A;  2NUG A;  4DV6 E;  1IMU A;  2EQ0 A;  4JI5 E;  2YSO A;  2EM8 A;  5KL7 A;  4LF7 E;  2DMY A;  4R2D A;  4DV1 E;  2DIX A;  2JR1 A;  4WSP A;  2E1M A;  2DGC A;  2RS7 A;  3MHS C;  2JY9 A;  2EML A;  3L00 A;  2EMG A;  1DGC A;  2UUC E;  4HEI A;  4DKK A;  1YYO A;  4KWY A;  4DMI A;  1ZBT A;  4DUY E;  2EPC A;  2YTN A;  2JOB A;  2ELY A;  1EH7 A;  3JTZ A;  3ZOQ B;  4JI2 E;  4GZN C;  2EPO A;  1PDA A;  1HNW E;  4M9V C;  4K0K E;  2WZO A;  1EKZ A;  1T39 A;  3THN A;  2JVA A;  4DR4 E;  4L5N C;  1WJP A;  1LLM C;  1SFE A;  1A1F A;  4B3T E;  2EM2 A;  4YY3 E;  4LF6 E;  2ADR A;  2GLI A;  3C6K A;  2K4V A;  2EN1 A;  3J7Y p;  2NAB A;  1UIL A;  5FLX C;  2ODR C;  3QG5 C;  1EH6 A;  2KOU A;  1P47 A;  1XMQ E;  1X48 A;  1GQE A;  3OTO E;  3MHH C;  4BMJ A;  1WHN A;  5AAS A;  1JK2 A;  2EN2 A;  2YTG A;  2Q8U A;  2N8X A;  4LF9 E;  3AUZ A;  2CT1 A;  2HHH E;  2EL5 A;  4N4R B;  4IS1 C;  2EOX A;  1FKA E;  4JI6 E;  4DV2 E;  2M1S A;  3IWB A;  4DR2 E;  2YTJ A;  1YYK A;  2DSY A;  2EE8 A;  3MSW A;  1F2I G;  3HQ1 A;  4RH8 A;  2EPU A;  2CTD A;  1A1H A;  4F54 A;  2NA2 A;  2DLK A;  4DV4 E;  1N34 E;  2NUE A;  2FGG A;  1X3C A;  2EPP A;  2L2K B;  5A69 A;  1J26 A;  5AE1 A;  4BCA A;  3K6Q A;  2EMH A;  4KZS A;  3ECR A;  4BHC A;  1YYW A;  1STU A;  5ADZ A;  2LV2 A;  5LMU E;  2JP9 A;  2J7J A;  2UXD E;  5IT9 C;  2NUF A;  1XNR E;  1T4O A;  3BID A;  2V88 A;  4B3R E;  3IWD A;  3DF6 A;  2EMW A;  3ADL A;  1ZBQ A;  4GEQ B;  4BS9 A;  1FJG E;  4ZYD A;  3ADJ A;  2EWL A;  1WXR A;  4BC9 A;  1NCS A; 
#chains in the Genus database with same CATH homology
 2I13 A;  5KL3 A;  2WBT A;  2LT7 A;  2HGH A;  2WBS A;  2D9H A;  2EN3 A;  2EOI A;  4R2P A;  2EPC A;  2YTN A;  2WBU A;  2EMI A;  2DLQ A;  2ELY A;  2EQ1 A;  3EPJ A;  4R2A A;  2EOH A;  4GZN C;  2EN7 A;  2YTD A;  2PRT A;  1A1K A;  4M9V C;  2YTI A;  1RMD A;  5KL2 A;  2YU8 A;  2YTF A;  1B69 A;  2EM0 A;  4R2C A;  1WJP A;  2EL4 A;  1LLM C;  1A1F A;  2EMA A;  2YRK A;  4R2S A;  1AAY A;  2R1F A;  2EM2 A;  1KJK A;  4F2J C;  1UBD C;  2EMF A;  4R2E A;  2ADR A;  2EPR A;  1TF6 A;  2GLI A;  1MEY C;  1X6H A;  2ENA A;  2DRP A;  2YRM A;  3M99 B;  1BB8 A;  2EMZ A;  2EN1 A;  4F6M A;  2A25 A;  1X6E A;  2EPX A;  2EMK A;  2NAB A;  2YTP A;  1G2F C;  2EM4 A;  1BBO A;  1X5W A;  2YU5 A;  2MDG A;  1P47 A;  3EPK A;  2YTO A;  2EOR A;  3MHH C;  1JK2 A;  2EN2 A;  5KL4 A;  1A1L A;  2YTG A;  1A1G A;  2YRH A;  1YSA C;  2EMY A;  2EPA A;  1ZR9 A;  1ZAA C;  4R2R A;  2RPC A;  2E72 A;  1UN6 B;  2CT1 A;  5KL6 A;  1Z1B A;  2EJ4 A;  2EL5 A;  1A1J A;  1YUJ A;  2EMX A;  2LVH A;  4IS1 C;  2EOX A;  2EOM A;  2BB8 A;  2EOE A;  2EL6 A;  1G2D C;  2GHF A;  2YTJ A;  4IJD A;  4FK5 C;  2LCE A;  2EE8 A;  2WCC 3;  1F2I G;  1JK1 A;  2ENH A;  2EP3 A;  3EPL A;  2EPZ A;  4F6N A;  2EM3 A;  2EOJ A;  2EOF A;  2EMC A;  2EPU A;  2MKN A;  2CTD A;  2YTQ A;  4X9J A;  1A1H A;  4WSG A;  3VHT B;  2YSP A;  2DLK A;  2EOY A;  2EOO A;  2RSI A;  1X6F A;  2DMI A;  2VRD A;  1X3C A;  2EPP A;  2EMB A;  2M9A A;  1YUI A;  5KL5 A;  2EM7 A;  2EN8 A;  2JPA A;  2EMH A;  1TN9 A;  2EN6 A;  2EOZ A;  2EQ3 A;  2EOQ A;  2ELZ A;  2MKD A;  2LV2 A;  2CSH A;  2EQ0 A;  2EM6 A;  2J7J A;  2JP9 A;  2EOS A;  3UK3 C;  2EN4 A;  2YSO A;  2EM8 A;  5KL7 A;  4R2D A;  3EPH A;  2EM5 A;  2EMW A;  1A1I A;  2LO3 A;  4R2Q A;  1TF3 A;  2DGC A;  3MHS C;  1ZU1 A;  2YTE A;  2EML A;  2EMG A;  1DGC A;  2ENC A;  1NCS A;  2EM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...