2DLKA

Solution structure of the first and the second zf-c2h2 domains of zinc finger protein 692
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
b'GSSGSSGMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords novel protein
publication title Solution structure of the first and the second zf-C2H2 domains of zinc finger protein 692
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dlkA01
2EOOA 2EMCA 2DLQA 3MHSC 1NCSA 2ENCA 2BB8A 1LLMC 1A1IA 1G2FC 2YTFA 2R1FA 2YTQA 2LVHA 3EPKA 2EPAA 3UK3C 1G2DC 1TF3A 4M9VC 2YU8A 2EQ1A 2MDGA 2EOHA 1X6HA 2EM9A 2EL4A 2EOYA 2EPCA 2VRDA 1ZAAC 1A1KA 2EN2A 3M99B 1KJKA 1YUJA 1YSAC 1AAYA 3EPHA 2WBUA 2J7JA 2EM8A 2M9AA 3EPJA 4R2AA 2EM6A 2JPAA 4R2RA 3EPLA 5KL2A 1UN6B 4GZNC 2EMGA 2EOZA 1TN9A 1X6EA 4F6MA 5KL3A 2CT1A 2EMYA 2EN3A 1A1JA 1MEYC 2GLIA 2RPCA 1B69A 2YU5A 2EPPA 2EJ4A 1X3CA 1RMDA 2WCC3 2YSOA 2RSIA 1A1GA 2CSHA 2ELYA 2LCEA 1DGCA 2EOEA 2EL5A 2YTJA 2EMIA 1BBOA 2EN7A 1YUIA 4R2CA 2EPXA 4F6NA 2YRHA 2EORA 2YTPA 2HGHA 2ENHA 2YTEA 2EQ3A 4FK5C 3VHTB 1P47A 2EMLA 2PRTA 1BB8A 1ZU1A 2EM2A 2YRKA 2EMKA 2EN8A 2MKDA 1ZR9A 2LV2A 2I13A 2EE8A 2YSPA 4IJDA 2EPUA 1A1FA 2EM5A 2YTOA 4IS1C 2DLKA 2EMBA 2GHFA 4F2JC 2EPZA 2ADRA 2YTNA 2EOQA 2EMAA 2EM7A 2EN4A 2YTDA 2EP3A 2A25A 2EM4A 2EMXA 2EMZA 2EMWA 2EL6A 1UBDC 3MHHC 2E72A 5KL4A 5KL5A 5KL7A 2CTDA 4R2SA 4R2EA 2YTIA 2YRMA 2D9HA 2EOSA 2DMIA 2EMFA 2EOJA 2EOMA 2WBSA 1JK2A 1A1LA 2LT7A 2EN6A 2EOIA 2EN1A 2EOXA 2EPRA 4R2QA 2EQ0A 1Z1BA 2EOFA 2EM3A 2ELZA 2LO3A 1A1HA 2ENAA 1JK1A 2DRPA 4R2DA 4R2PA 2MKNA 1X6FA 2JP9A 1F2IG 2EM0A 1TF6A 2EMHA 2YTGA 4WSGA 2WBTA 2NABA 4X9JA 2DGCA 5KL6A 1WJPA 1X5WA
chains in the Genus database with same CATH superfamily
3P1XA 2RSMA 4AQYE 3BGHA 4OX9E 1LLMC 2CPNA 4JI8E 5A6BA 2LE2A 2R1FA 2YTQA 1NEIA 3UK3C 4O43A 2L3JA 2YU8A 2ZM6E 1IBLE 1IQSA 3LLHA 1GQEA 1XMOE 1N36E 2EL4A 2VRDA 1ZAAC 1EH8A 5LMUE 3M99B 1WHNA 3EPHA 2EM6A 2KOUA 4BMJA 1IMUA 2B7TA 4L8NA 1J26A 2E1MA 4WXCA 2NA2A 5KL2A 1UN6B 1RQ0A 2UXDE 2L33A 4BC9A 1RC7A 4B3RE 2EMYA 3J80C 2GLIA 2RPCA 3C4BA 2L6MA 1B69A 2EPPA 2WCC3 2RS7A 1A1GA 2ELYA 4DR4E 2H36X 2YPNA 2BBGA 3HTXA 2EORA 2HGHA 2YTEA 4FK5C 2Q8UA 3VHTB 4B3TE 3C6KA 3DF6A 4K0KE 3FIGA 1YZ9A 2EN8A 4R8OA 1ZR9A 2JR1A 2EE8A 4JI3E 4IJDA 4F54A 2YTOA 5FLXC 4HTGA 4X65E 1GTKA 2YTDA 2DMYA 5A69A 4LF6E 2A25A 2B3TB 4M0VA 2EL6A 3MHHC 2E72A 2NUGA 5KL4A 5KL5A 4DR2E 4NXNE 4DV2E 4BHBA 4LF7E 2JVAA 3JU0A 4WX9A 4LF5E 4X8WA 2WBSA 2V85A 3ADJA 1J5EE 1HNXE 1N32E 4BC7A 2EN6A 4WYQB 4R2QA 3L00A 2EOFA 1FKAE 2ELZA 4LF4E 1A1HA 4LF8E 4BBYA 1JK1A 3THOB 4F9CB 4MLVA 4DR3E 1T4NA 4DV0E 2B9DA 2YTGA 1XNRE 3KZYA 4I8OA 4DV3E 2WBTA 4DMIA 4X64E 5KL6A 1X5WA 4ZYHA 4DR5E 1STUA 2MDRA 1YPNA 3MHSC 2FTXB 1QNTA 2MC5A 1YFHA 2LJUA 2YTFA 3IWDA 4JI0E 2LVHA 2EPAA 3J81C 4ZYGA 2HJJA 2UU9E 1X6HA 3LMLA 2LRSA 4JI4E 2M1SA 2L2NA 3IWBA 3KZZA 2J7JA 2KHXA 2M9AA 5AC5A 5CFFE 4GEQB 1N33E 2WZOA 3HPSA 3EPLA 1IBME 1KYQA 4GZNC 2N3GA 2HHHE 1HNZE 4YHHE 1TN9A 5KL3A 2CT1A 2N3HA 2F8BA 5IWAE 4Q28A 2JOXA 3ADGA 2GPIA 5LMNE 2YU5A 4O5GA 3OTOE 2V83A 1RMDA 3VYYA 2RSIA 1DGCA 2LCEA 2EOEA 1BBOA 2EPXA 4F6NA 4TUGA 2YT4A 2EQ3A 2EMLA 2PRTA 1BB8A 4BS9A 2YRKA 1AH5A 2EMKA 1L4SA 3F6GA 2MKDA 2YSPA 3JTZA 1X47A 2RQLA 1EH6A 3HQ1A 4J8ZA 2L2KB 1EKZA 1T4LB 1A1FA 3T1YE 5AASA 4DR1E 2YTNA 3ADLA 2EMAA 2VQEE 2EZ6A 4HEIA 2LTSA 4OOGC 2UUBE 1SR9A 2V86A 2DB2A 5KL7A 4R2EA 2M7QA 4LFAE 2YRMA 2D9HA 3THNA 4B3SE 2G7HA 2EOJA 5AE1A 3J7AG 1QU6A 4JI6E 2EOMA 2JY9A 1JK2A 1A1LA 2LTRA 3EQ1A 2EN1A 2EOXA 4DKKA 4F9AB 2EQ0A 2MC6A 4BCAA 1Z1BA 1YYWA 2EM3A 4DV4E 2ENAA 2V87A 2DRPA 4WSPA 5A2QC 1DQ3A 3AV0A 4R2PA 1PJSA 5IXMB 2JP9A 1F2IG 1TF6A 2L3CA 5AC4A 2R76A 5TSEA 4X62E 1WXRA 3BIDA 4DUZE 1WJPA 1N3GA 2EMCA 1NCSA 3K6QA 2BB8A 2JYAA 1DI2A 1G2FC 4X66E 2K4VA 1YYKA 5AE2A 1G2DC 1TF3A 2K7IA 4DR7E 4JV5E 2EOHA 4P78A 2EPCA 1UILA 2RS6A 5IT9C 2EN2A 1KJKA 1YSAC 1AAYA 1PDAA 1UHZA 4O4KA 3VK6A 3HPZA 1PJQA 2JPAA 4R2RA 2EPKX 3MSWA 4R03A 3TQMA 5DNYA 3QG5C 4JI5E 2ODRD 1FJGE 2F4VE 2EOZA 4LTYA 4M30A 2EN3A 1MEYC 4LU9A 2EPLX 4GKKE 2EJ4A 1X3CA 2UXBE 4RH8A 2EMIA 3C4TA 2EN7A 2DSYA 2YRHA 1SFEA 2JOBA 2ENHA 2LUQA 2N8XA 2LMZA 1IQOA 2DIXA 5IV8B 1YYOA 2LV2A 5AE3A 2I13A 2EPUA 4N4RB 2VQFE 2EM5A 2V89A 4IS1C 2DLKA 2EMBA 2YWQA 2ADRA 3C6MA 4KHPE 2EOQA 2EM7A 2NUFA 2EM4A 1PKPA 4DV6E 2EMZA 1UBDC 4KZSA 1MGTA 5ADZA 4ZYDA 3IWCA 2CTDA 4R2SA 2YTIA 2EOSA 3ECRA 1N34E 2NUEA 4NHRA 2I9IA 1WHQA 2UUAE 2LT7A 2EOIA 3DJWA 4P7DA 2EPRA 4JI2E 2UUCE 4R2DA 2MKNA 2E5LE 4YY3E 4DV5E 3J7Yp 1WRJA 5LLQA 4WSGA 1X48A 4MLQA 2KONA 2VE7C 2V8QB 2DGCA 2JWOA 2EOOA 2DLQA 2FV4B 4JYAE 2ENCA 1A1IA 4JI7E 3ADIA 3EPKA 4M9VC 2L2MA 2VF1A 4LFBE 2EQ1A 2MDGA 2EM9A 2EOYA 4LFCE 1A1KA 1X49A 1I94E 3AUZA 1YUJA 1EH7A 1GZ6A 2WBUA 2EM8A 1XMQE 4RHBB 3EPJA 4R2AA 1T4OA 4NZVA 4GKJE 3BF2A 1T39A 2FGGA 2EMGA 2EWLA 1XNQE 4WFTA 4B3ME 1X6EA 4F6MA 2LJHA 2V88A 2B7VA 1A1JA 4WPYA 1PJTA 2HC5A 2M4IA 2IHR1 1BBGA 2YZTA 4DR6E 3BBGA 1O0WA 2YSOA 2CSHA 2EL5A 2YTJA 1YUIA 4L5NC 4R2CA 4O24A 2LUPB 2YTPA 1P47A 5T6JA 4Q35B 4JI1E 3F6HA 3OMLA 4DV7E 1ZU1A 4LF9E 2EM2A 4F9BB 3JAMC 1HNWE 1HR0E 5BR8E 2EPMX 2ODRC 4TUIA 5LL6R 2GHFA 4F2JC 2EPZA 4NXME 2EN4A 2UXCE 1ZBTA 3VYXA 2EP3A 2EMXA 4M2ZA 3RMPA 2EMWA 4BHCA 2LBSB 2DMIA 3H09A 4ZYEA 2EMFA 2EPNA 2EPOA 3ZOQB 4KWYA 5F3WA 3HXLA 5A6AA 5A6BD 4WXDA 2JXPA 2LO3A 2L8TA 1T38A 2RTXA 2L92A 3KWRA 4DUYE 1ZBQA 5A6KA 4DV1E 3T1HE 1X6FA 2EM0A 2EMHA 2NABA 4X9JA 1IBKE 5A6JA
chains in the Genus database with same CATH topology
2EOOA 2EMCA 2DLQA 3MHSC 1NCSA 2ENCA 2BB8A 1LLMC 1A1IA 1G2FC 2YTFA 2R1FA 2YTQA 2LVHA 3EPKA 2EPAA 3UK3C 1G2DC 1TF3A 4M9VC 2YU8A 2EQ1A 2MDGA 2EOHA 1X6HA 2EM9A 2EL4A 2EOYA 2EPCA 2VRDA 1ZAAC 1A1KA 2EN2A 3M99B 1KJKA 1YUJA 1YSAC 1AAYA 3EPHA 2WBUA 2J7JA 2EM8A 2M9AA 3EPJA 4R2AA 2EM6A 2JPAA 4R2RA 3EPLA 5KL2A 1UN6B 4GZNC 2EMGA 2EOZA 1TN9A 1X6EA 4F6MA 5KL3A 2CT1A 2EMYA 2EN3A 1A1JA 1MEYC 2GLIA 2RPCA 1B69A 2YU5A 2EPPA 2EJ4A 1X3CA 1RMDA 2WCC3 2YSOA 2RSIA 1A1GA 2CSHA 2ELYA 2LCEA 1DGCA 2EOEA 2EL5A 2YTJA 2EMIA 1BBOA 2EN7A 1YUIA 4R2CA 2EPXA 4F6NA 2YRHA 2EORA 2YTPA 2HGHA 2ENHA 2YTEA 2EQ3A 4FK5C 3VHTB 1P47A 2EMLA 2PRTA 1BB8A 1ZU1A 2EM2A 2YRKA 2EMKA 2EN8A 2MKDA 1ZR9A 2LV2A 2I13A 2EE8A 2YSPA 4IJDA 2EPUA 1A1FA 2EM5A 2YTOA 4IS1C 2DLKA 2EMBA 2GHFA 4F2JC 2EPZA 2ADRA 2YTNA 2EOQA 2EMAA 2EM7A 2EN4A 2YTDA 2EP3A 2A25A 2EM4A 2EMXA 2EMZA 2EMWA 2EL6A 1UBDC 3MHHC 2E72A 5KL4A 5KL5A 5KL7A 2CTDA 4R2SA 4R2EA 2YTIA 2YRMA 2D9HA 2EOSA 2DMIA 2EMFA 2EOJA 2EOMA 2WBSA 1JK2A 1A1LA 2LT7A 2EN6A 2EOIA 2EN1A 2EOXA 2EPRA 4R2QA 2EQ0A 1Z1BA 2EOFA 2EM3A 2ELZA 2LO3A 1A1HA 2ENAA 1JK1A 2DRPA 4R2DA 4R2PA 2MKNA 1X6FA 2JP9A 1F2IG 2EM0A 1TF6A 2EMHA 2YTGA 4WSGA 2WBTA 2NABA 4X9JA 2DGCA 5KL6A 1WJPA 1X5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOO A;  2EMC A;  2DLQ A;  3MHS C;  1NCS A;  2ENC A;  2BB8 A;  1LLM C;  1A1I A;  1G2F C;  2YTF A;  2R1F A;  2YTQ A;  2LVH A;  3EPK A;  2EPA A;  3UK3 C;  1G2D C;  1TF3 A;  4M9V C;  2YU8 A;  2EQ1 A;  2MDG A;  2EOH A;  1X6H A;  2EM9 A;  2EL4 A;  2EOY A;  2EPC A;  2VRD A;  1ZAA C;  1A1K A;  2EN2 A;  3M99 B;  1KJK A;  1YUJ A;  1YSA C;  1AAY A;  3EPH A;  2WBU A;  2J7J A;  2EM8 A;  2M9A A;  3EPJ A;  4R2A A;  2EM6 A;  2JPA A;  4R2R A;  3EPL A;  5KL2 A;  1UN6 B;  4GZN C;  2EMG A;  2EOZ A;  1TN9 A;  1X6E A;  4F6M A;  5KL3 A;  2CT1 A;  2EMY A;  2EN3 A;  1A1J A;  1MEY C;  2GLI A;  2RPC A;  1B69 A;  2YU5 A;  2EPP A;  2EJ4 A;  1X3C A;  1RMD A;  2WCC 3;  2YSO A;  2RSI A;  1A1G A;  2CSH A;  2ELY A;  2LCE A;  1DGC A;  2EOE A;  2EL5 A;  2YTJ A;  2EMI A;  1BBO A;  2EN7 A;  1YUI A;  4R2C A;  2EPX A;  4F6N A;  2YRH A;  2EOR A;  2YTP A;  2HGH A;  2ENH A;  2YTE A;  2EQ3 A;  4FK5 C;  3VHT B;  1P47 A;  2EML A;  2PRT A;  1BB8 A;  1ZU1 A;  2EM2 A;  2YRK A;  2EMK A;  2EN8 A;  2MKD A;  1ZR9 A;  2LV2 A;  2I13 A;  2EE8 A;  2YSP A;  4IJD A;  2EPU A;  1A1F A;  2EM5 A;  2YTO A;  4IS1 C;  2DLK A;  2EMB A;  2GHF A;  4F2J C;  2EPZ A;  2ADR A;  2YTN A;  2EOQ A;  2EMA A;  2EM7 A;  2EN4 A;  2YTD A;  2EP3 A;  2A25 A;  2EM4 A;  2EMX A;  2EMZ A;  2EMW A;  2EL6 A;  1UBD C;  3MHH C;  2E72 A;  5KL4 A;  5KL5 A;  5KL7 A;  2CTD A;  4R2S A;  4R2E A;  2YTI A;  2YRM A;  2D9H A;  2EOS A;  2DMI A;  2EMF A;  2EOJ A;  2EOM A;  2WBS A;  1JK2 A;  1A1L A;  2LT7 A;  2EN6 A;  2EOI A;  2EN1 A;  2EOX A;  2EPR A;  4R2Q A;  2EQ0 A;  1Z1B A;  2EOF A;  2EM3 A;  2ELZ A;  2LO3 A;  1A1H A;  2ENA A;  1JK1 A;  2DRP A;  4R2D A;  4R2P A;  2MKN A;  1X6F A;  2JP9 A;  1F2I G;  2EM0 A;  1TF6 A;  2EMH A;  2YTG A;  4WSG A;  2WBT A;  2NAB A;  4X9J A;  2DGC A;  5KL6 A;  1WJP A;  1X5W A; 
#chains in the Genus database with same CATH topology
 3P1X A;  2RSM A;  4AQY E;  3BGH A;  4OX9 E;  1LLM C;  2CPN A;  4JI8 E;  5A6B A;  2LE2 A;  2R1F A;  2YTQ A;  1NEI A;  3UK3 C;  4O43 A;  2L3J A;  2YU8 A;  2ZM6 E;  1IBL E;  1IQS A;  3LLH A;  1GQE A;  1XMO E;  1N36 E;  2EL4 A;  2VRD A;  1ZAA C;  1EH8 A;  5LMU E;  3M99 B;  1WHN A;  3EPH A;  2EM6 A;  2KOU A;  4BMJ A;  1IMU A;  2B7T A;  4L8N A;  1J26 A;  2E1M A;  4WXC A;  2NA2 A;  5KL2 A;  1UN6 B;  1RQ0 A;  2UXD E;  2L33 A;  4BC9 A;  1RC7 A;  4B3R E;  2EMY A;  3J80 C;  2GLI A;  2RPC A;  3C4B A;  2L6M A;  1B69 A;  2EPP A;  2WCC 3;  2RS7 A;  1A1G A;  2ELY A;  4DR4 E;  2H36 X;  2YPN A;  2BBG A;  3HTX A;  2EOR A;  2HGH A;  2YTE A;  4FK5 C;  2Q8U A;  3VHT B;  4B3T E;  3C6K A;  3DF6 A;  4K0K E;  3FIG A;  1YZ9 A;  2EN8 A;  4R8O A;  1ZR9 A;  2JR1 A;  2EE8 A;  4JI3 E;  4IJD A;  4F54 A;  2YTO A;  5FLX C;  4HTG A;  4X65 E;  1GTK A;  2YTD A;  2DMY A;  5A69 A;  4LF6 E;  2A25 A;  2B3T B;  4M0V A;  2EL6 A;  3MHH C;  2E72 A;  2NUG A;  5KL4 A;  5KL5 A;  4DR2 E;  4NXN E;  4DV2 E;  4BHB A;  4LF7 E;  2JVA A;  3JU0 A;  4WX9 A;  4LF5 E;  4X8W A;  2WBS A;  2V85 A;  3ADJ A;  1J5E E;  1HNX E;  1N32 E;  4BC7 A;  2EN6 A;  4WYQ B;  4R2Q A;  3L00 A;  2EOF A;  1FKA E;  2ELZ A;  4LF4 E;  1A1H A;  4LF8 E;  4BBY A;  1JK1 A;  3THO B;  4F9C B;  4MLV A;  4DR3 E;  1T4N A;  4DV0 E;  2B9D A;  2YTG A;  1XNR E;  3KZY A;  4I8O A;  4DV3 E;  2WBT A;  4DMI A;  4X64 E;  5KL6 A;  1X5W A;  4ZYH A;  4DR5 E;  1STU A;  2MDR A;  1YPN A;  3MHS C;  2FTX B;  1QNT A;  2MC5 A;  1YFH A;  2LJU A;  2YTF A;  3IWD A;  4JI0 E;  2LVH A;  2EPA A;  3J81 C;  4ZYG A;  2HJJ A;  2UU9 E;  1X6H A;  3LML A;  2LRS A;  4JI4 E;  2M1S A;  2L2N A;  3IWB A;  3KZZ A;  2J7J A;  2KHX A;  2M9A A;  5AC5 A;  5CFF E;  4GEQ B;  1N33 E;  2WZO A;  3HPS A;  3EPL A;  1IBM E;  1KYQ A;  4GZN C;  2N3G A;  2HHH E;  1HNZ E;  4YHH E;  1TN9 A;  5KL3 A;  2CT1 A;  2N3H A;  2F8B A;  5IWA E;  4Q28 A;  2JOX A;  3ADG A;  2GPI A;  5LMN E;  2YU5 A;  4O5G A;  3OTO E;  2V83 A;  1RMD A;  3VYY A;  2RSI A;  1DGC A;  2LCE A;  2EOE A;  1BBO A;  2EPX A;  4F6N A;  4TUG A;  2YT4 A;  2EQ3 A;  2EML A;  2PRT A;  1BB8 A;  4BS9 A;  2YRK A;  1AH5 A;  2EMK A;  1L4S A;  3F6G A;  2MKD A;  2YSP A;  3JTZ A;  1X47 A;  2RQL A;  1EH6 A;  3HQ1 A;  4J8Z A;  2L2K B;  1EKZ A;  1T4L B;  1A1F A;  3T1Y E;  5AAS A;  4DR1 E;  2YTN A;  3ADL A;  2EMA A;  2VQE E;  2EZ6 A;  4HEI A;  2LTS A;  4OOG C;  2UUB E;  1SR9 A;  2V86 A;  2DB2 A;  5KL7 A;  4R2E A;  2M7Q A;  4LFA E;  2YRM A;  2D9H A;  3THN A;  4B3S E;  2G7H A;  2EOJ A;  5AE1 A;  3J7A G;  1QU6 A;  4JI6 E;  2EOM A;  2JY9 A;  1JK2 A;  1A1L A;  2LTR A;  3EQ1 A;  2EN1 A;  2EOX A;  4DKK A;  4F9A B;  2EQ0 A;  2MC6 A;  4BCA A;  1Z1B A;  1YYW A;  2EM3 A;  4DV4 E;  2ENA A;  2V87 A;  2DRP A;  4WSP A;  5A2Q C;  1DQ3 A;  3AV0 A;  4R2P A;  1PJS A;  5IXM B;  2JP9 A;  1F2I G;  1TF6 A;  2L3C A;  5AC4 A;  2R76 A;  5TSE A;  4X62 E;  1WXR A;  3BID A;  4DUZ E;  1WJP A;  1N3G A;  2EMC A;  1NCS A;  3K6Q A;  2BB8 A;  2JYA A;  1DI2 A;  1G2F C;  4X66 E;  2K4V A;  1YYK A;  5AE2 A;  1G2D C;  1TF3 A;  2K7I A;  4DR7 E;  4JV5 E;  2EOH A;  4P78 A;  2EPC A;  1UIL A;  2RS6 A;  5IT9 C;  2EN2 A;  1KJK A;  1YSA C;  1AAY A;  1PDA A;  1UHZ A;  4O4K A;  3VK6 A;  3HPZ A;  1PJQ A;  2JPA A;  4R2R A;  2EPK X;  3MSW A;  4R03 A;  3TQM A;  5DNY A;  3QG5 C;  4JI5 E;  2ODR D;  1FJG E;  2F4V E;  2EOZ A;  4LTY A;  4M30 A;  2EN3 A;  1MEY C;  4LU9 A;  2EPL X;  4GKK E;  2EJ4 A;  1X3C A;  2UXB E;  4RH8 A;  2EMI A;  3C4T A;  2EN7 A;  2DSY A;  2YRH A;  1SFE A;  2JOB A;  2ENH A;  2LUQ A;  2N8X A;  2LMZ A;  1IQO A;  2DIX A;  5IV8 B;  1YYO A;  2LV2 A;  5AE3 A;  2I13 A;  2EPU A;  4N4R B;  2VQF E;  2EM5 A;  2V89 A;  4IS1 C;  2DLK A;  2EMB A;  2YWQ A;  2ADR A;  3C6M A;  4KHP E;  2EOQ A;  2EM7 A;  2NUF A;  2EM4 A;  1PKP A;  4DV6 E;  2EMZ A;  1UBD C;  4KZS A;  1MGT A;  5ADZ A;  4ZYD A;  3IWC A;  2CTD A;  4R2S A;  2YTI A;  2EOS A;  3ECR A;  1N34 E;  2NUE A;  4NHR A;  2I9I A;  1WHQ A;  2UUA E;  2LT7 A;  2EOI A;  3DJW A;  4P7D A;  2EPR A;  4JI2 E;  2UUC E;  4R2D A;  2MKN A;  2E5L E;  4YY3 E;  4DV5 E;  3J7Y p;  1WRJ A;  5LLQ A;  4WSG A;  1X48 A;  4MLQ A;  2KON A;  2VE7 C;  2V8Q B;  2DGC A;  2JWO A;  2EOO A;  2DLQ A;  2FV4 B;  4JYA E;  2ENC A;  1A1I A;  4JI7 E;  3ADI A;  3EPK A;  4M9V C;  2L2M A;  2VF1 A;  4LFB E;  2EQ1 A;  2MDG A;  2EM9 A;  2EOY A;  4LFC E;  1A1K A;  1X49 A;  1I94 E;  3AUZ A;  1YUJ A;  1EH7 A;  1GZ6 A;  2WBU A;  2EM8 A;  1XMQ E;  4RHB B;  3EPJ A;  4R2A A;  1T4O A;  4NZV A;  4GKJ E;  3BF2 A;  1T39 A;  2FGG A;  2EMG A;  2EWL A;  1XNQ E;  4WFT A;  4B3M E;  1X6E A;  4F6M A;  2LJH A;  2V88 A;  2B7V A;  1A1J A;  4WPY A;  1PJT A;  2HC5 A;  2M4I A;  2IHR 1;  1BBG A;  2YZT A;  4DR6 E;  3BBG A;  1O0W A;  2YSO A;  2CSH A;  2EL5 A;  2YTJ A;  1YUI A;  4L5N C;  4R2C A;  4O24 A;  2LUP B;  2YTP A;  1P47 A;  5T6J A;  4Q35 B;  4JI1 E;  3F6H A;  3OML A;  4DV7 E;  1ZU1 A;  4LF9 E;  2EM2 A;  4F9B B;  3JAM C;  1HNW E;  1HR0 E;  5BR8 E;  2EPM X;  2ODR C;  4TUI A;  5LL6 R;  2GHF A;  4F2J C;  2EPZ A;  4NXM E;  2EN4 A;  2UXC E;  1ZBT A;  3VYX A;  2EP3 A;  2EMX A;  4M2Z A;  3RMP A;  2EMW A;  4BHC A;  2LBS B;  2DMI A;  3H09 A;  4ZYE A;  2EMF A;  2EPN A;  2EPO A;  3ZOQ B;  4KWY A;  5F3W A;  3HXL A;  5A6A A;  5A6B D;  4WXD A;  2JXP A;  2LO3 A;  2L8T A;  1T38 A;  2RTX A;  2L92 A;  3KWR A;  4DUY E;  1ZBQ A;  5A6K A;  4DV1 E;  3T1H E;  1X6F A;  2EM0 A;  2EMH A;  2NAB A;  4X9J A;  1IBK E;  5A6J A; 
#chains in the Genus database with same CATH homology
 2EOO A;  2EMC A;  2DLQ A;  3MHS C;  1NCS A;  2ENC A;  2BB8 A;  1LLM C;  1A1I A;  1G2F C;  2YTF A;  2R1F A;  2YTQ A;  2LVH A;  3EPK A;  2EPA A;  3UK3 C;  1G2D C;  1TF3 A;  4M9V C;  2YU8 A;  2EQ1 A;  2MDG A;  2EOH A;  1X6H A;  2EM9 A;  2EL4 A;  2EOY A;  2EPC A;  2VRD A;  1ZAA C;  1A1K A;  2EN2 A;  3M99 B;  1KJK A;  1YUJ A;  1YSA C;  1AAY A;  3EPH A;  2WBU A;  2J7J A;  2EM8 A;  2M9A A;  3EPJ A;  4R2A A;  2EM6 A;  2JPA A;  4R2R A;  3EPL A;  5KL2 A;  1UN6 B;  4GZN C;  2EMG A;  2EOZ A;  1TN9 A;  1X6E A;  4F6M A;  5KL3 A;  2CT1 A;  2EMY A;  2EN3 A;  1A1J A;  1MEY C;  2GLI A;  2RPC A;  1B69 A;  2YU5 A;  2EPP A;  2EJ4 A;  1X3C A;  1RMD A;  2WCC 3;  2YSO A;  2RSI A;  1A1G A;  2CSH A;  2ELY A;  2LCE A;  1DGC A;  2EOE A;  2EL5 A;  2YTJ A;  2EMI A;  1BBO A;  2EN7 A;  1YUI A;  4R2C A;  2EPX A;  4F6N A;  2YRH A;  2EOR A;  2YTP A;  2HGH A;  2ENH A;  2YTE A;  2EQ3 A;  4FK5 C;  3VHT B;  1P47 A;  2EML A;  2PRT A;  1BB8 A;  1ZU1 A;  2EM2 A;  2YRK A;  2EMK A;  2EN8 A;  2MKD A;  1ZR9 A;  2LV2 A;  2I13 A;  2EE8 A;  2YSP A;  4IJD A;  2EPU A;  1A1F A;  2EM5 A;  2YTO A;  4IS1 C;  2DLK A;  2EMB A;  2GHF A;  4F2J C;  2EPZ A;  2ADR A;  2YTN A;  2EOQ A;  2EMA A;  2EM7 A;  2EN4 A;  2YTD A;  2EP3 A;  2A25 A;  2EM4 A;  2EMX A;  2EMZ A;  2EMW A;  2EL6 A;  1UBD C;  3MHH C;  2E72 A;  5KL4 A;  5KL5 A;  5KL7 A;  2CTD A;  4R2S A;  4R2E A;  2YTI A;  2YRM A;  2D9H A;  2EOS A;  2DMI A;  2EMF A;  2EOJ A;  2EOM A;  2WBS A;  1JK2 A;  1A1L A;  2LT7 A;  2EN6 A;  2EOI A;  2EN1 A;  2EOX A;  2EPR A;  4R2Q A;  2EQ0 A;  1Z1B A;  2EOF A;  2EM3 A;  2ELZ A;  2LO3 A;  1A1H A;  2ENA A;  1JK1 A;  2DRP A;  4R2D A;  4R2P A;  2MKN A;  1X6F A;  2JP9 A;  1F2I G;  2EM0 A;  1TF6 A;  2EMH A;  2YTG A;  4WSG A;  2WBT A;  2NAB A;  4X9J A;  2DGC A;  5KL6 A;  1WJP A;  1X5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...