2KONA

Nmr solution structure of cv_2116 from chromobacterium violaceum. northeast structural genomics consortium target cvt4(1-82)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
b'MNVAHYRGYEIEPGHQYRDDIRKYVPYALIRKVGVPDRTPIPTTYPEFYDLEADAERVSIACAKIIIDSHLDRHDQGLADLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR solution structure of CV_2116 from Chromobacterium violaceum.Northeast Structural Genomics Consortium Target CvT4(1-82)
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.350 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2konA00
2KONA
chains in the Genus database with same CATH superfamily
2YRHA 2ZM6E 4OOGC 4DR3E 3T1HE 1FKAE 2NUGA 4ZYEA 4J8ZA 2V8QB 2EPOA 3BBGA 2H36X 2LV2A 2EPKX 2V89A 1XNRE 2EMCA 2LRSA 4F6NA 2WBTA 4TUIA 2EOMA 2KONA 4X9JA 4AQYE 3ZOQB 4IJDA 4F9BB 2L6MA 2L3CA 2EPXA 2KHXA 2FV4B 2RSMA 2EPAA 2M1SA 4KZSA 2EQ0A 2ELYA 5LMUE 4TUGA 4K0KE 1DQ3A 2LE2A 1TF6A 2YTJA 1ZBQA 4P7DA 1TN9A 4O43A 2DB2A 3EQ1A 2KOUA 3AV0A 1B69A 2EMBA 3BF2A 2EOQA 1TF3A 2L33A 3VK6A 2EMHA 2FGGA 4DUZE 3VYYA 5AE1A 3EPLA 5A2QC 2CPNA 2ENAA 1SR9A 2JOXA 3L00A 3C4TA 4I8OA 2J7JA 1GZ6A 1RC7A 3FIGA 4LFAE 4WX9A 2YU8A 2EPRA 1X6EA 2EM9A 1HNWE 4DR2E 2CT1A 3HPSA 2EM3A 1IBLE 3DJWA 5AE2A 3BIDA 2I9IA 4MLQA 4BCAA 1RMDA 4B3TE 3ADJA 4JYAE 2G7HA 2N8XA 3K6QA 3HQ1A 4GKKE 1YFHA 5A69A 1Z1BA 4X8WA 4DR6E 3VYXA 4Q35B 4M2ZA 4R2RA 2EN3A 4WXDA 4LF4E 5A6AA 1X6HA 2CTDA 4ZYGA 1YYOA 1UILA 1N3GA 4R2EA 2EN4A 1XMQE 4WPYA 2E1MA 2JWOA 4DR7E 4JI0E 1YYKA 1NCSA 2EN6A 4LF8E 1J5EE 2E72A 2VQEE 2NA2A 2EOZA 5LLQA 1JK2A 2WCC3 2YWQA 3J80C 2EM8A 2DMIA 1WHNA 2YTIA 2JXPA 4F9AB 1EKZA 1A1IA 2DRPA 1J26A 1T4LB 3EPKA 2EMFA 3HPZA 3KZZA 1YUJA 2B9DA 1YSAC 5FLXC 4M0VA 1T38A 2YTEA 5KL5A 2DIXA 1N34E 2YZTA 5TSEA 2EOEA 2EM0A 2YTFA 1LLMC 1EH7A 1GQEA 3IWDA 2Q8UA 2EMGA 3J7AG 2EWLA 4BMJA 2YRKA 4B3SE 5IT9C 2EN1A 5A6BA 1WXRA 1T4OA 4KWYA 3EPHA 2EPLX 2MKNA 5IWAE 2EOIA 2LTRA 2UXDE 2VE7C 1A1KA 4F9CB 2MDGA 3MHHC 1N33E 2EMYA 2EN8A 1IQOA 3VHTB 3F6HA 1UN6B 1RQ0A 3DF6A 1MEYC 4DV5E 5KL4A 4DR4E 3JTZA 1PKPA 3P1XA 5LL6R 4O4KA 2L92A 5A6KA 1EH8A 1YYWA 4R2QA 2YTPA 4O5GA 4DV6E 2EQ1A 1YZ9A 4DV4E 4GEQB 2LCEA 1AAYA 4YHHE 1ZR9A 2HC5A 2D9HA 1WHQA 2EOYA 2RTXA 3UK3C 4DKKA 1IBKE 4WYQB 2EPPA 2EM7A 4BBYA 3THNA 2EMWA 4WSGA 2YTQA 3IWCA 2M7QA 1MGTA 3ADIA 2UUCE 4X64E 2R76A 2L3JA 3F6GA 2YU5A 1FJGE 2RS6A 2ADRA 4WFTA 5IXMB 1N36E 2GLIA 4DV2E 4JI5E 2E5LE 1X48A 2BBGA 2MC5A 5A6BD 2FTXB 3ADLA 2EL6A 4JI7E 4DV3E 4GKJE 4FK5C 3MSWA 4RHBB 4O24A 4M30A 3OTOE 2DLKA 4LFCE 4DV1E 4B3ME 2WBSA 3ECRA 1BBGA 2LVHA 2DLQA 1PJSA 1PJQA 2EOFA 2EL5A 3C4BA 2EOXA 2LO3A 4BHBA 1F2IG 2EPNA 2EMIA 2EZ6A 2NUEA 1YUIA 1X6FA 2GHFA 2JVAA 2MDRA 2WBUA 2EOJA 2LJHA 5T6JA 1T39A 2HGHA 1X49A 1PJTA 3J7Yp 4OX9E 1I94E 4ZYDA 2L2NA 1ZBTA 4JV5E 1XMOE 2CSHA 1DGCA 2YSPA 4MLVA 2EM6A 4R8OA 2EPZA 2EM4A 5LMNE 2YT4A 1A1HA 3KWRA 2JPAA 3RMPA 3JAMC 4JI8E 1WRJA 1KYQA 4LF5E 2HHHE 2EE8A 5BR8E 4JI4E 2YSOA 1EH6A 4M9VC 2B7VA 2EP3A 2B3TB 2I13A 4BC9A 1ZU1A 2NUFA 5F3WA 4LFBE 2EN2A 2EN7A 3OMLA 2UUBE 2UXBE 2R1FA 3AUZA 2A25A 5CFFE 4L8NA 3BGHA 4LTYA 2RQLA 4NXME 4N4RB 2YTGA 1DI2A 5A6JA 1ZAAC 4JI1E 1A1LA 4BS9A 1BBOA 2NABA 3EPJA 2LTSA 2ODRD 3MHSC 2V87A 1IMUA 4DR1E 2EM2A 1G2FC 2LUQA 4X62E 2V83A 2ENHA 2L2KB 4HTGA 3KZYA 2ODRC 2L2MA 4LU9A 5DNYA 2LT7A 4NXNE 5AE3A 2YTDA 1UHZA 4Q28A 1BB8A 4X66E 3J81C 1XNQE 4DMIA 4WSPA 4R2DA 1QU6A 4JI6E 1GTKA 4DV7E 2EMZA 2HJJA 1SFEA 3H09A 2YTNA 2JP9A 4F54A 4L5NC 1HR0E 4GZNC 1NEIA 1T4NA 2EMLA 5ADZA 4R2SA 4F2JC 5KL6A 2PRTA 5AC4A 2VF1A 3HXLA 3ADGA 2DSYA 1N32E 1STUA 1YPNA 4YY3E 3THOB 1O0WA 2M4IA 4DV0E 2WZOA 2L8TA 4R2CA 4R2PA 4KHPE 2V85A 1UBDC 1QNTA 3QG5C 1P47A 2F4VE 2B7TA 2UUAE 2JY9A 1JK1A 2EJ4A 4HEIA 2RS7A 2IHR1 2LJUA 2EOOA 2RPCA 2N3HA 4NZVA 1IBME 1A1FA 2VQFE 2V86A 3LMLA 4X65E 4BC7A 1HNXE 2UXCE 2UU9E 2EM5A 2EMXA 3LLHA 4DR5E 5IV8B 2MKDA 4ZYHA 3C6KA 1PDAA 4R03A 2N3GA 1KJKA 2JR1A 3TQMA 4P78A 1WJPA 2EPUA 2LBSB 5KL2A 2EPCA 2LUPB 2M9AA 4NHRA 4IS1C 2VRDA 3C6MA 1HNZE 4DUYE 4RH8A 5AC5A 1G2DC 4WXCA 2LMZA 5KL3A 1L4SA 2DMYA 4R2AA 3T1YE 2DGCA 2EQ3A 2EMKA 3M99B 2GPIA 2MC6A 1A1GA 1AH5A 2BB8A 2EL4A 4F6MA 4JI2E 4LF7E 2YRMA 1A1JA 2YTOA 2ENCA 4JI3E 2JOBA 3HTXA 2RSIA 3IWBA 2EMAA 4LF6E 1X47A 2EOSA 5KL7A 2EPMX 2K4VA 5AASA 2V88A 3JU0A 1X3CA 2EOHA 2JYAA 2F8BA 2YPNA 4BHCA 2K7IA 4B3RE 1IQSA 1X5WA 2ELZA 4LF9E 2EORA
chains in the Genus database with same CATH topology
4JI7E 4DV3E 1XNQE 2ZM6E 4OOGC 3J80C 4DR3E 3T1HE 4DMIA 3MSWA 1FKAE 3ADLA 4GKJE 1WHNA 4F9AB 4WSPA 4M30A 3OTOE 2NUGA 1EKZA 1QU6A 4JI6E 4J8ZA 2V8QB 4DV7E 4DV1E 1T4LB 2H36X 3HPZA 2V89A 3H09A 4B3ME 4LFCE 1XNRE 2B9DA 5FLXC 2LRSA 4M0VA 4TUIA 4AQYE 2KONA 4F54A 3C4BA 2DIXA 4L5NC 3ZOQB 1HR0E 1T4NA 1N34E 4F9BB 2YZTA 5ADZA 2L6MA 2L3CA 2EZ6A 2NUEA 2KHXA 1GQEA 2FV4B 2JVAA 3IWDA 2RSMA 2M1SA 4KZSA 3J7AG 2EWLA 5LMUE 4TUGA 2MDRA 2VF1A 3HXLA 2LE2A 1DQ3A 2DSYA 3ADGA 4BMJA 1N32E 4K0KE 1STUA 2LJHA 1ZBQA 5T6JA 4YY3E 1X49A 4B3SE 4P7DA 1O0WA 2M4IA 2DB2A 4DV0E 2KOUA 5IT9C 2WZOA 3AV0A 2L8TA 1WXRA 3J7Yp 1T4OA 4KHPE 2V85A 4OX9E 1I94E 2L2NA 1ZBTA 5IWAE 2L33A 1XMOE 2LTRA 2B7TA 2UUAE 2F4VE 3VK6A 2VE7C 2FGGA 2JY9A 4DUZE 3VYYA 2UXDE 2RS7A 2IHR1 4F9CB 5AE1A 4R8OA 5A2QC 3J81C 2N3HA 5LMNE 2YT4A 2CPNA 1N33E 3KWRA 1SR9A 2JOXA 1IBME 3RMPA 2VQFE 2V86A 3LMLA 3JAMC 4BC7A 4JI8E 4X65E 1HNXE 2UXCE 2UU9E 3C4TA 3F6HA 3LLHA 4I8OA 1RQ0A 3DF6A 4DR5E 4LF5E 2HHHE 1GZ6A 1RC7A 3FIGA 5BR8E 4DV5E 4LFAE 4JI4E 2B7VA 4R03A 2B3TB 2N3GA 2JR1A 1HNWE 4BC9A 3JTZA 2NUFA 1PKPA 4DR4E 3P1XA 5LL6R 4P78A 5F3WA 4DR2E 2L92A 3HPSA 4JV5E 1IBLE 4LFBE 3DJWA 5AE2A 2LBSB 1YYWA 3OMLA 2UUBE 2LUPB 4DV6E 2UXBE 1HNZE 1J26A 4DUYE 4BCAA 1YZ9A 4DV4E 3AUZA 4GEQB 2LMZA 5CFFE 3ADJA 4YHHE 4B3TE 4L8NA 4LTYA 2DMYA 4NXME 4JYAE 2G7HA 3K6QA 3T1YE 1DI2A 1WHQA 3HQ1A 4GKKE 4JI1E 2MC6A 2RTXA 4DKKA 4BS9A 1IBKE 4WYQB 4X8WA 4BBYA 4JI2E 3VYXA 4LF7E 4DR6E 2M7QA 3IWCA 2LTSA 2ODRD 4M2ZA 3ADIA 2UUCE 4LF4E 4JI3E 4X64E 2V87A 2JOBA 1YYOA 3HTXA 4DR1E 1UILA 2L3JA 3IWBA 2LUQA 4WPYA 1XMQE 1X47A 4LF6E 4X62E 2V83A 2K4VA 5AASA 2E1MA 2ODRC 2JWOA 2L2MA 2V88A 3F6GA 3JU0A 4LU9A 5DNYA 2L2KB 4JI0E 1FJGE 1YYKA 2F8BA 2RS6A 4DR7E 4LF8E 4WFTA 1N36E 1J5EE 2VQEE 5AE3A 4NXNE 4DV2E 4B3RE 4JI5E 2E5LE 2NA2A 1UHZA 1X48A 2MC5A 4Q28A 4X66E 2FTXB 4LF9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KON A; 
#chains in the Genus database with same CATH topology
 2YRH A;  2ZM6 E;  4OOG C;  4DR3 E;  3T1H E;  1FKA E;  2NUG A;  4ZYE A;  4J8Z A;  2V8Q B;  2EPO A;  3BBG A;  2H36 X;  2LV2 A;  2EPK X;  2V89 A;  1XNR E;  2EMC A;  2LRS A;  4F6N A;  2WBT A;  4TUI A;  2EOM A;  2KON A;  4X9J A;  4AQY E;  3ZOQ B;  4IJD A;  4F9B B;  2L6M A;  2L3C A;  2EPX A;  2KHX A;  2FV4 B;  2RSM A;  2EPA A;  2M1S A;  4KZS A;  2EQ0 A;  2ELY A;  5LMU E;  4TUG A;  4K0K E;  1DQ3 A;  2LE2 A;  1TF6 A;  2YTJ A;  1ZBQ A;  4P7D A;  1TN9 A;  4O43 A;  2DB2 A;  3EQ1 A;  2KOU A;  3AV0 A;  1B69 A;  2EMB A;  3BF2 A;  2EOQ A;  1TF3 A;  2L33 A;  3VK6 A;  2EMH A;  2FGG A;  4DUZ E;  3VYY A;  5AE1 A;  3EPL A;  5A2Q C;  2CPN A;  2ENA A;  1SR9 A;  2JOX A;  3L00 A;  3C4T A;  4I8O A;  2J7J A;  1GZ6 A;  1RC7 A;  3FIG A;  4LFA E;  4WX9 A;  2YU8 A;  2EPR A;  1X6E A;  2EM9 A;  1HNW E;  4DR2 E;  2CT1 A;  3HPS A;  2EM3 A;  1IBL E;  3DJW A;  5AE2 A;  3BID A;  2I9I A;  4MLQ A;  4BCA A;  1RMD A;  4B3T E;  3ADJ A;  4JYA E;  2G7H A;  2N8X A;  3K6Q A;  3HQ1 A;  4GKK E;  1YFH A;  5A69 A;  1Z1B A;  4X8W A;  4DR6 E;  3VYX A;  4Q35 B;  4M2Z A;  4R2R A;  2EN3 A;  4WXD A;  4LF4 E;  5A6A A;  1X6H A;  2CTD A;  4ZYG A;  1YYO A;  1UIL A;  1N3G A;  4R2E A;  2EN4 A;  1XMQ E;  4WPY A;  2E1M A;  2JWO A;  4DR7 E;  4JI0 E;  1YYK A;  1NCS A;  2EN6 A;  4LF8 E;  1J5E E;  2E72 A;  2VQE E;  2NA2 A;  2EOZ A;  5LLQ A;  1JK2 A;  2WCC 3;  2YWQ A;  3J80 C;  2EM8 A;  2DMI A;  1WHN A;  2YTI A;  2JXP A;  4F9A B;  1EKZ A;  1A1I A;  2DRP A;  1J26 A;  1T4L B;  3EPK A;  2EMF A;  3HPZ A;  3KZZ A;  1YUJ A;  2B9D A;  1YSA C;  5FLX C;  4M0V A;  1T38 A;  2YTE A;  5KL5 A;  2DIX A;  1N34 E;  2YZT A;  5TSE A;  2EOE A;  2EM0 A;  2YTF A;  1LLM C;  1EH7 A;  1GQE A;  3IWD A;  2Q8U A;  2EMG A;  3J7A G;  2EWL A;  4BMJ A;  2YRK A;  4B3S E;  5IT9 C;  2EN1 A;  5A6B A;  1WXR A;  1T4O A;  4KWY A;  3EPH A;  2EPL X;  2MKN A;  5IWA E;  2EOI A;  2LTR A;  2UXD E;  2VE7 C;  1A1K A;  4F9C B;  2MDG A;  3MHH C;  1N33 E;  2EMY A;  2EN8 A;  1IQO A;  3VHT B;  3F6H A;  1UN6 B;  1RQ0 A;  3DF6 A;  1MEY C;  4DV5 E;  5KL4 A;  4DR4 E;  3JTZ A;  1PKP A;  3P1X A;  5LL6 R;  4O4K A;  2L92 A;  5A6K A;  1EH8 A;  1YYW A;  4R2Q A;  2YTP A;  4O5G A;  4DV6 E;  2EQ1 A;  1YZ9 A;  4DV4 E;  4GEQ B;  2LCE A;  1AAY A;  4YHH E;  1ZR9 A;  2HC5 A;  2D9H A;  1WHQ A;  2EOY A;  2RTX A;  3UK3 C;  4DKK A;  1IBK E;  4WYQ B;  2EPP A;  2EM7 A;  4BBY A;  3THN A;  2EMW A;  4WSG A;  2YTQ A;  3IWC A;  2M7Q A;  1MGT A;  3ADI A;  2UUC E;  4X64 E;  2R76 A;  2L3J A;  3F6G A;  2YU5 A;  1FJG E;  2RS6 A;  2ADR A;  4WFT A;  5IXM B;  1N36 E;  2GLI A;  4DV2 E;  4JI5 E;  2E5L E;  1X48 A;  2BBG A;  2MC5 A;  5A6B D;  2FTX B;  3ADL A;  2EL6 A;  4JI7 E;  4DV3 E;  4GKJ E;  4FK5 C;  3MSW A;  4RHB B;  4O24 A;  4M30 A;  3OTO E;  2DLK A;  4LFC E;  4DV1 E;  4B3M E;  2WBS A;  3ECR A;  1BBG A;  2LVH A;  2DLQ A;  1PJS A;  1PJQ A;  2EOF A;  2EL5 A;  3C4B A;  2EOX A;  2LO3 A;  4BHB A;  1F2I G;  2EPN A;  2EMI A;  2EZ6 A;  2NUE A;  1YUI A;  1X6F A;  2GHF A;  2JVA A;  2MDR A;  2WBU A;  2EOJ A;  2LJH A;  5T6J A;  1T39 A;  2HGH A;  1X49 A;  1PJT A;  3J7Y p;  4OX9 E;  1I94 E;  4ZYD A;  2L2N A;  1ZBT A;  4JV5 E;  1XMO E;  2CSH A;  1DGC A;  2YSP A;  4MLV A;  2EM6 A;  4R8O A;  2EPZ A;  2EM4 A;  5LMN E;  2YT4 A;  1A1H A;  3KWR A;  2JPA A;  3RMP A;  3JAM C;  4JI8 E;  1WRJ A;  1KYQ A;  4LF5 E;  2HHH E;  2EE8 A;  5BR8 E;  4JI4 E;  2YSO A;  1EH6 A;  4M9V C;  2B7V A;  2EP3 A;  2B3T B;  2I13 A;  4BC9 A;  1ZU1 A;  2NUF A;  5F3W A;  4LFB E;  2EN2 A;  2EN7 A;  3OML A;  2UUB E;  2UXB E;  2R1F A;  3AUZ A;  2A25 A;  5CFF E;  4L8N A;  3BGH A;  4LTY A;  2RQL A;  4NXM E;  4N4R B;  2YTG A;  1DI2 A;  5A6J A;  1ZAA C;  4JI1 E;  1A1L A;  4BS9 A;  1BBO A;  2NAB A;  3EPJ A;  2LTS A;  2ODR D;  3MHS C;  2V87 A;  1IMU A;  4DR1 E;  2EM2 A;  1G2F C;  2LUQ A;  4X62 E;  2V83 A;  2ENH A;  2L2K B;  4HTG A;  3KZY A;  2ODR C;  2L2M A;  4LU9 A;  5DNY A;  2LT7 A;  4NXN E;  5AE3 A;  2YTD A;  1UHZ A;  4Q28 A;  1BB8 A;  4X66 E;  3J81 C;  1XNQ E;  4DMI A;  4WSP A;  4R2D A;  1QU6 A;  4JI6 E;  1GTK A;  4DV7 E;  2EMZ A;  2HJJ A;  1SFE A;  3H09 A;  2YTN A;  2JP9 A;  4F54 A;  4L5N C;  1HR0 E;  4GZN C;  1NEI A;  1T4N A;  2EML A;  5ADZ A;  4R2S A;  4F2J C;  5KL6 A;  2PRT A;  5AC4 A;  2VF1 A;  3HXL A;  3ADG A;  2DSY A;  1N32 E;  1STU A;  1YPN A;  4YY3 E;  3THO B;  1O0W A;  2M4I A;  4DV0 E;  2WZO A;  2L8T A;  4R2C A;  4R2P A;  4KHP E;  2V85 A;  1UBD C;  1QNT A;  3QG5 C;  1P47 A;  2F4V E;  2B7T A;  2UUA E;  2JY9 A;  1JK1 A;  2EJ4 A;  4HEI A;  2RS7 A;  2IHR 1;  2LJU A;  2EOO A;  2RPC A;  2N3H A;  4NZV A;  1IBM E;  1A1F A;  2VQF E;  2V86 A;  3LML A;  4X65 E;  4BC7 A;  1HNX E;  2UXC E;  2UU9 E;  2EM5 A;  2EMX A;  3LLH A;  4DR5 E;  5IV8 B;  2MKD A;  4ZYH A;  3C6K A;  1PDA A;  4R03 A;  2N3G A;  1KJK A;  2JR1 A;  3TQM A;  4P78 A;  1WJP A;  2EPU A;  2LBS B;  5KL2 A;  2EPC A;  2LUP B;  2M9A A;  4NHR A;  4IS1 C;  2VRD A;  3C6M A;  1HNZ E;  4DUY E;  4RH8 A;  5AC5 A;  1G2D C;  4WXC A;  2LMZ A;  5KL3 A;  1L4S A;  2DMY A;  4R2A A;  3T1Y E;  2DGC A;  2EQ3 A;  2EMK A;  3M99 B;  2GPI A;  2MC6 A;  1A1G A;  1AH5 A;  2BB8 A;  2EL4 A;  4F6M A;  4JI2 E;  4LF7 E;  2YRM A;  1A1J A;  2YTO A;  2ENC A;  4JI3 E;  2JOB A;  3HTX A;  2RSI A;  3IWB A;  2EMA A;  4LF6 E;  1X47 A;  2EOS A;  5KL7 A;  2EPM X;  2K4V A;  5AAS A;  2V88 A;  3JU0 A;  1X3C A;  2EOH A;  2JYA A;  2F8B A;  2YPN A;  4BHC A;  2K7I A;  4B3R E;  1IQS A;  1X5W A;  2ELZ A;  4LF9 E;  2EOR A; 
#chains in the Genus database with same CATH homology
 4JI7 E;  4DV3 E;  1XNQ E;  2ZM6 E;  4OOG C;  3J80 C;  4DR3 E;  3T1H E;  4DMI A;  3MSW A;  1FKA E;  3ADL A;  4GKJ E;  1WHN A;  4F9A B;  4WSP A;  4M30 A;  3OTO E;  2NUG A;  1EKZ A;  1QU6 A;  4JI6 E;  4J8Z A;  2V8Q B;  4DV7 E;  4DV1 E;  1T4L B;  2H36 X;  3HPZ A;  2V89 A;  3H09 A;  4B3M E;  4LFC E;  1XNR E;  2B9D A;  5FLX C;  2LRS A;  4M0V A;  4TUI A;  4AQY E;  2KON A;  4F54 A;  3C4B A;  2DIX A;  4L5N C;  3ZOQ B;  1HR0 E;  1T4N A;  1N34 E;  4F9B B;  2YZT A;  5ADZ A;  2L6M A;  2L3C A;  2EZ6 A;  2NUE A;  2KHX A;  1GQE A;  2FV4 B;  2JVA A;  3IWD A;  2RSM A;  2M1S A;  4KZS A;  3J7A G;  2EWL A;  5LMU E;  4TUG A;  2MDR A;  2VF1 A;  3HXL A;  2LE2 A;  1DQ3 A;  2DSY A;  3ADG A;  4BMJ A;  1N32 E;  4K0K E;  1STU A;  2LJH A;  1ZBQ A;  5T6J A;  4YY3 E;  1X49 A;  4B3S E;  4P7D A;  1O0W A;  2M4I A;  2DB2 A;  4DV0 E;  2KOU A;  5IT9 C;  2WZO A;  3AV0 A;  2L8T A;  1WXR A;  3J7Y p;  1T4O A;  4KHP E;  2V85 A;  4OX9 E;  1I94 E;  2L2N A;  1ZBT A;  5IWA E;  2L33 A;  1XMO E;  2LTR A;  2B7T A;  2UUA E;  2F4V E;  3VK6 A;  2VE7 C;  2FGG A;  2JY9 A;  4DUZ E;  3VYY A;  2UXD E;  2RS7 A;  2IHR 1;  4F9C B;  5AE1 A;  4R8O A;  5A2Q C;  3J81 C;  2N3H A;  5LMN E;  2YT4 A;  2CPN A;  1N33 E;  3KWR A;  1SR9 A;  2JOX A;  1IBM E;  3RMP A;  2VQF E;  2V86 A;  3LML A;  3JAM C;  4BC7 A;  4JI8 E;  4X65 E;  1HNX E;  2UXC E;  2UU9 E;  3C4T A;  3F6H A;  3LLH A;  4I8O A;  1RQ0 A;  3DF6 A;  4DR5 E;  4LF5 E;  2HHH E;  1GZ6 A;  1RC7 A;  3FIG A;  5BR8 E;  4DV5 E;  4LFA E;  4JI4 E;  2B7V A;  4R03 A;  2B3T B;  2N3G A;  2JR1 A;  1HNW E;  4BC9 A;  3JTZ A;  2NUF A;  1PKP A;  4DR4 E;  3P1X A;  5LL6 R;  4P78 A;  5F3W A;  4DR2 E;  2L92 A;  3HPS A;  4JV5 E;  1IBL E;  4LFB E;  3DJW A;  5AE2 A;  2LBS B;  1YYW A;  3OML A;  2UUB E;  2LUP B;  4DV6 E;  2UXB E;  1HNZ E;  1J26 A;  4DUY E;  4BCA A;  1YZ9 A;  4DV4 E;  3AUZ A;  4GEQ B;  2LMZ A;  5CFF E;  3ADJ A;  4YHH E;  4B3T E;  4L8N A;  4LTY A;  2DMY A;  4NXM E;  4JYA E;  2G7H A;  3K6Q A;  3T1Y E;  1DI2 A;  1WHQ A;  3HQ1 A;  4GKK E;  4JI1 E;  2MC6 A;  2RTX A;  4DKK A;  4BS9 A;  1IBK E;  4WYQ B;  4X8W A;  4BBY A;  4JI2 E;  3VYX A;  4LF7 E;  4DR6 E;  2M7Q A;  3IWC A;  2LTS A;  2ODR D;  4M2Z A;  3ADI A;  2UUC E;  4LF4 E;  4JI3 E;  4X64 E;  2V87 A;  2JOB A;  1YYO A;  3HTX A;  4DR1 E;  1UIL A;  2L3J A;  3IWB A;  2LUQ A;  4WPY A;  1XMQ E;  1X47 A;  4LF6 E;  4X62 E;  2V83 A;  2K4V A;  5AAS A;  2E1M A;  2ODR C;  2JWO A;  2L2M A;  2V88 A;  3F6G A;  3JU0 A;  4LU9 A;  5DNY A;  2L2K B;  4JI0 E;  1FJG E;  1YYK A;  2F8B A;  2RS6 A;  4DR7 E;  4LF8 E;  4WFT A;  1N36 E;  1J5E E;  2VQE E;  5AE3 A;  4NXN E;  4DV2 E;  4B3R E;  4JI5 E;  2E5L E;  2NA2 A;  1UHZ A;  1X48 A;  2MC5 A;  4Q28 A;  4X66 E;  2FTX B;  4LF9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...