2KONA

Nmr solution structure of cv_2116 from chromobacterium violaceum. northeast structural genomics consortium target cvt4(1-82)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MNVAHYRGYEIEPGHQYRDDIRKYVPYALIRKVGVPDRTPIPTTYPEFYDLEADAERVSIACAKIIIDSHLDRHDQGLADLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR solution structure of CV_2116 from Chromobacterium violaceum.Northeast Structural Genomics Consortium Target CvT4(1-82)
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.350 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2konA00
2KONA
chains in the Genus database with same CATH superfamily
2CTDA 2DSYA 1YYKA 3EPHA 2EMFA 2EQ1A 1ZU1A 4DR2E 1YUJA 2YSOA 1WHNA 2RSIA 3ECRA 1HNXE 4ZYGA 3C4TA 2MC5A 2EMGA 3THOB 4BHBA 2YTDA 1A1KA 4BCAA 2N8XA 2LBSB 2LTRA 4IS1C 1IQOA 4O24A 1X6EA 2VE7C 1HNZE 1PJQA 1TF6A 1EH8A 3EPLA 2RTXA 4R2SA 1YFHA 4B3TE 4DUYE 2RS7A 3IWCA 2LJUA 3IWDA 3VYYA 4DV5E 1P47A 4B3RE 2E72A 3LLHA 3MSWA 4R2PA 2EWLA 1HR0E 1X6FA 4BHCA 1A1LA 3ADIA 4DR7E 1EKZA 2JVAA 3QG5C 5IT9C 3JAMC 4M2ZA 4X65E 2LUQA 1J5EE 4GEQB 2EM6A 3H09A 2EN4A 1IBLE 3ADLA 2ADRA 2NUFA 4M30A 4F9BB 1A1HA 2N3GA 5AC4A 2EM3A 2DRPA 5KL5A 1ZAAC 2EPKX 2KONA 4HTGA 4LFAE 2MDGA 1X49A 2EOZA 1YYWA 1G2DC 2KOUA 4KZSA 5A6KA 1NEIA 5LMNE 2DGCA 2EQ3A 5ADZA 1NCSA 2YWQA 2ELZA 2YTJA 1X48A 4NHRA 2NABA 4DV6E 4L8NA 4MLVA 5A6JA 1EH7A 2YTGA 2EM4A 2UU9E 2B7VA 4WXDA 1ZBQA 2YTOA 3J81C 3TQMA 1N32E 4AQYE 3RMPA 1PKPA 4JI1E 2YTIA 2EPLX 3C6KA 4JI7E 2LUPB 4GZNC 4LFBE 1X5WA 1RC7A 2V86A 2EOEA 2EL4A 3AUZA 2HJJA 1X47A 3THNA 5AE1A 1T38A 3C4BA 2I13A 2ENCA 2V89A 4N4RB 3BBGA 3J7Yp 4JI8E 4DV1E 2L3JA 4MLQA 2JPAA 2EP3A 3AV0A 1TN9A 2UUBE 4FK5C 2F8BA 5F3WA 2YRMA 4DR4E 2EOJA 1UILA 1YZ9A 4OOGC 1IBKE 2EM5A 2ELYA 1JK1A 3M99B 4LF4E 3VYXA 3C6MA 4NXNE 1BBOA 4LF7E 2YTQA 1MEYC 1DI2A 4WSGA 1N36E 2EOMA 2L92A 2UUCE 1SR9A 4ZYEA 2EE8A 1PJTA 2JYAA 2NUGA 1YYOA 2EPNA 2UUAE 4JYAE 2LO3A 5TSEA 2H36X 4LTYA 2WBSA 2EN3A 1ZBTA 2R1FA 2EN8A 2K7IA 2E5LE 2FTXB 4B3SE 2EQ0A 2JP9A 1Z1BA 4ZYHA 1XNQE 4JV5E 2EOOA 3J7AG 2L2MA 5IV8B 2F4VE 5A6BD 4BS9A 2EMAA 2V83A 4DV7E 5KL6A 1SFEA 2ODRC 3EPJA 4J8ZA 4R2AA 1KYQA 1EH6A 3HPZA 3MHSC 1F2IG 4R2DA 1YPNA 4YY3E 3L00A 2HC5A 4O5GA 3VK6A 3JTZA 5AC5A 3OMLA 5A6BA 1AH5A 4DV4E 4JI4E 2YTNA 2JY9A 2LJHA 4X8WA 3T1HE 1X6HA 2VQFE 4R2CA 3BF2A 2L2KB 2EM8A 2D9HA 2IHR1 4BC9A 4WX9A 2RS6A 3HPSA 1HNWE 2EPAA 4F6MA 2MKDA 1LLMC 2CT1A 2UXBE 2UXDE 1T4OA 1IQSA 2EN6A 2GHFA 4P78A 1WXRA 4R2RA 4DV3E 4BBYA 2LV2A 4K0KE 5KL7A 1JK2A 2K4VA 2M4IA 3F6GA 4GKKE 3BIDA 2B9DA 4JI5E 2NA2A 3VHTB 2EMYA 3EQ1A 5A2QC 2YT4A 2L33A 1B69A 3KWRA 2MC6A 2L2NA 1BB8A 4RH8A 2VQEE 2NUEA 2YU5A 4IJDA 4DR1E 2JXPA 2CPNA 4M0VA 2V8QB 1O0WA 1T4NA 2ENAA 2VRDA 2R76A 4DMIA 4JI2E 1N33E 1J26A 1YSAC 1GZ6A 2EM0A 2DIXA 2M9AA 3LMLA 1UHZA 5A6AA 1QU6A 2ZM6E 1FKAE 4DR5E 1L4SA 1XMOE 4M9VC 2N3HA 4DR3E 2LMZA 2YTEA 2RQLA 1QNTA 4X9JA 5T6JA 2V87A 4B3ME 2EMHA 5FLXC 2LTSA 2BBGA 4TUGA 2G7HA 1MGTA 2DB2A 2FV4B 4RHBB 4GKJE 1DGCA 2L3CA 2YSPA 1WHQA 2B3TB 2J7JA 2RSMA 4F6NA 2MDRA 2EL6A 2JWOA 3JU0A 1GQEA 1A1JA 2JR1A 3ADJA 1BBGA 4BMJA 4Q28A 2HHHE 2EPRA 3ADGA 2LCEA 4KWYA 3F6HA 4BC7A 2EMBA 2EOFA 2EN2A 2YZTA 2EOSA 2Q8UA 5LMUE 1UBDC 1STUA 4F54A 1DQ3A 2I9IA 1PJSA 4JI6E 4NXME 2EMKA 1UN6B 4LU9A 4WYQB 4X64E 4DV2E 1RMDA 4DR6E 2LE2A 2ENHA 5AE2A 2EOQA 2EL5A 2EORA 3KZZA 1A1IA 2EMCA 1N3GA 2HGHA 2GLIA 3DJWA 4HEIA 4F9CB 1WJPA 2ODRD 2KHXA 5BR8E 4O4KA 4JI3E 5DNYA 4R2QA 1TF3A 2L8TA 1WRJA 5LL6R 2EMLA 4YHHE 2EM7A 2PRTA 1I94E 1XNRE 2UXCE 4OX9E 2YPNA 4L5NC 4LF6E 5IXMB 3EPKA 4KHPE 5AASA 2DLQA 2V88A 2EOHA 3MHHC 2BB8A 2WBTA 4WPYA 4X66E 1T4LB 3OTOE 1GTKA 2GPIA 3ZOQB 5IWAE 3K6QA 4O43A 2YU8A 2YTPA 2MKNA 1IMUA 4I8OA 2E1MA 2DMYA 4DUZE 4ZYDA 2EZ6A 2EPZA 2LRSA 4DV0E 2YTFA 2EMZA 5AE3A 4R8OA 1N34E 5LLQA 1FJGE 4X62E 2A25A 1A1GA 2LVHA 3P1XA 3BGHA 3IWBA 2FGGA 3UK3C 2DLKA 3DF6A 2M1SA 2RPCA 1RQ0A 5KL3A 1XMQE 3T1YE 3HQ1A 1YUIA 2YRHA 1PDAA 4F9AB 2WBUA 2WCC3 4NZVA 2V85A 4LF5E 2JOXA 2EMXA 2EN1A 1X3CA 4WXCA 1G2FC 2YRKA 1A1FA 2EPMX 5CFFE 2L6MA 1T39A 2B7TA 2EPCA 3HXLA 4F2JC 2EOYA 2CSHA 2EOXA 2JOBA 4WSPA 2DMIA 2VF1A 2LT7A 2EMIA 4R2EA 2EPOA 5KL4A 2EPUA 4WFTA 2EMWA 2WZOA 2M7QA 2EM9A 4TUIA 2EOIA 3FIGA 4LF9E 4LF8E 4DKKA 2EM2A 1IBME 4Q35B 3J80C 3HTXA 2EN7A 2EPPA 3KZYA 1AAYA 1ZR9A 5A69A 4P7DA 4JI0E 1KJKA 2EPXA 4LFCE 5KL2A 4R03A 2EJ4A
chains in the Genus database with same CATH topology
2DSYA 1WXRA 4P78A 3C4BA 1YYKA 4DV3E 4BBYA 4K0KE 2V89A 3DJWA 4DR2E 2K4VA 2M4IA 3F6GA 1WHNA 4F9CB 1HNXE 4B3TE 3J7Yp 2B9DA 4JI5E 4GKKE 2NA2A 3C4TA 4JI8E 2MC5A 2ODRD 4DV1E 2KHXA 5BR8E 2L3JA 4BCAA 2LBSB 2LTRA 4JI3E 5A2QC 5DNYA 2L8TA 2L33A 2YT4A 3AV0A 5LL6R 4YHHE 2UUBE 1I94E 2VE7C 1XNRE 5F3WA 2F8BA 3KWRA 2MC6A 2L2NA 4OX9E 1HNZE 2UXCE 4L5NC 4LF6E 4KHPE 4DR4E 2VQEE 2NUEA 5AASA 2V88A 4DR1E 1UILA 1YZ9A 2CPNA 2RTXA 4M0VA 4OOGC 4WPYA 2V8QB 4X66E 2RS7A 3IWCA 4DUYE 3IWDA 3OTOE 1T4LB 3ZOQB 5IWAE 1O0WA 3VYYA 1T4NA 3K6QA 4DV5E 4B3RE 3LLHA 3MSWA 4LF4E 3VYXA 4NXNE 2EWLA 1HR0E 4I8OA 2E1MA 3ADIA 4DR7E 4DMIA 1EKZA 2JVAA 4JI2E 1N33E 1J26A 1GZ6A 2DMYA 5IT9C 4LF7E 2DIXA 3JAMC 4DUZE 4M2ZA 2EZ6A 3LMLA 4X65E 1DI2A 2LUQA 1UHZA 1J5EE 1N36E 1QU6A 2LRSA 2ZM6E 4DV0E 1FKAE 4DR5E 4GEQB 2L92A 2UUCE 1XMOE 3H09A 2N3HA 5AE3A 1SR9A 4DR3E 2LMZA 1IBLE 2NUGA 3ADLA 1YYOA 4R8OA 2NUFA 5T6JA 4M30A 4F9BB 2V87A 1N34E 2UUAE 4X62E 4B3ME 1FJGE 2N3GA 4JYAE 2H36X 5FLXC 4LTYA 2LTSA 1IBKE 3P1XA 4TUGA 3IWBA 2FGGA 1ZBTA 2KONA 2G7HA 3DF6A 2DB2A 2FTXB 2E5LE 4LFAE 1X49A 2M1SA 4B3SE 1RQ0A 1YYWA 2FV4B 2KOUA 4KZSA 1XMQE 3T1YE 3HQ1A 4GKJE 1XNQE 4JV5E 4F9AB 5LMNE 3J7AG 2L2MA 2L3CA 2F4VE 5ADZA 4BS9A 2V85A 4LF5E 1WHQA 2JOXA 2B3TB 2RSMA 2V83A 4DV7E 2ODRC 1X48A 2MDRA 2JWOA 3JU0A 4J8ZA 1GQEA 4L8NA 2JR1A 5CFFE 3ADJA 2L6MA 4DV6E 2B7TA 3HXLA 3HPZA 4BMJA 4Q28A 2UU9E 2HHHE 2B7VA 2JOBA 1ZBQA 4WSPA 3J81C 2VF1A 4YY3E 1N32E 3ADGA 4WFTA 4JI4E 4DV4E 3VK6A 3JTZA 3OMLA 2M7QA 2WZOA 4AQYE 1PKPA 3F6HA 4BC7A 4TUIA 3RMPA 2JY9A 4JI1E 2LJHA 2YZTA 4X8WA 3FIGA 3T1HE 2VQFE 4JI7E 2LUPB 5LMUE 4LF9E 1STUA 4F54A 1DQ3A 4LF8E 4LFBE 4DKKA 4JI6E 1RC7A 4NXME 2L2KB 1IBME 2V86A 4LU9A 4WYQB 4X64E 3J80C 4DV2E 3HTXA 3AUZA 4DR6E 2IHR1 4BC9A 2RS6A 3HPSA 2LE2A 4P7DA 4JI0E 1HNWE 5AE2A 4LFCE 2UXBE 4R03A 1X47A 2UXDE 1T4OA 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KON A; 
#chains in the Genus database with same CATH topology
 2CTD A;  2DSY A;  1YYK A;  3EPH A;  2EMF A;  2EQ1 A;  1ZU1 A;  4DR2 E;  1YUJ A;  2YSO A;  1WHN A;  2RSI A;  3ECR A;  1HNX E;  4ZYG A;  3C4T A;  2MC5 A;  2EMG A;  3THO B;  4BHB A;  2YTD A;  1A1K A;  4BCA A;  2N8X A;  2LBS B;  2LTR A;  4IS1 C;  1IQO A;  4O24 A;  1X6E A;  2VE7 C;  1HNZ E;  1PJQ A;  1TF6 A;  1EH8 A;  3EPL A;  2RTX A;  4R2S A;  1YFH A;  4B3T E;  4DUY E;  2RS7 A;  3IWC A;  2LJU A;  3IWD A;  3VYY A;  4DV5 E;  1P47 A;  4B3R E;  2E72 A;  3LLH A;  3MSW A;  4R2P A;  2EWL A;  1HR0 E;  1X6F A;  4BHC A;  1A1L A;  3ADI A;  4DR7 E;  1EKZ A;  2JVA A;  3QG5 C;  5IT9 C;  3JAM C;  4M2Z A;  4X65 E;  2LUQ A;  1J5E E;  4GEQ B;  2EM6 A;  3H09 A;  2EN4 A;  1IBL E;  3ADL A;  2ADR A;  2NUF A;  4M30 A;  4F9B B;  1A1H A;  2N3G A;  5AC4 A;  2EM3 A;  2DRP A;  5KL5 A;  1ZAA C;  2EPK X;  2KON A;  4HTG A;  4LFA E;  2MDG A;  1X49 A;  2EOZ A;  1YYW A;  1G2D C;  2KOU A;  4KZS A;  5A6K A;  1NEI A;  5LMN E;  2DGC A;  2EQ3 A;  5ADZ A;  1NCS A;  2YWQ A;  2ELZ A;  2YTJ A;  1X48 A;  4NHR A;  2NAB A;  4DV6 E;  4L8N A;  4MLV A;  5A6J A;  1EH7 A;  2YTG A;  2EM4 A;  2UU9 E;  2B7V A;  4WXD A;  1ZBQ A;  2YTO A;  3J81 C;  3TQM A;  1N32 E;  4AQY E;  3RMP A;  1PKP A;  4JI1 E;  2YTI A;  2EPL X;  3C6K A;  4JI7 E;  2LUP B;  4GZN C;  4LFB E;  1X5W A;  1RC7 A;  2V86 A;  2EOE A;  2EL4 A;  3AUZ A;  2HJJ A;  1X47 A;  3THN A;  5AE1 A;  1T38 A;  3C4B A;  2I13 A;  2ENC A;  2V89 A;  4N4R B;  3BBG A;  3J7Y p;  4JI8 E;  4DV1 E;  2L3J A;  4MLQ A;  2JPA A;  2EP3 A;  3AV0 A;  1TN9 A;  2UUB E;  4FK5 C;  2F8B A;  5F3W A;  2YRM A;  4DR4 E;  2EOJ A;  1UIL A;  1YZ9 A;  4OOG C;  1IBK E;  2EM5 A;  2ELY A;  1JK1 A;  3M99 B;  4LF4 E;  3VYX A;  3C6M A;  4NXN E;  1BBO A;  4LF7 E;  2YTQ A;  1MEY C;  1DI2 A;  4WSG A;  1N36 E;  2EOM A;  2L92 A;  2UUC E;  1SR9 A;  4ZYE A;  2EE8 A;  1PJT A;  2JYA A;  2NUG A;  1YYO A;  2EPN A;  2UUA E;  4JYA E;  2LO3 A;  5TSE A;  2H36 X;  4LTY A;  2WBS A;  2EN3 A;  1ZBT A;  2R1F A;  2EN8 A;  2K7I A;  2E5L E;  2FTX B;  4B3S E;  2EQ0 A;  2JP9 A;  1Z1B A;  4ZYH A;  1XNQ E;  4JV5 E;  2EOO A;  3J7A G;  2L2M A;  5IV8 B;  2F4V E;  5A6B D;  4BS9 A;  2EMA A;  2V83 A;  4DV7 E;  5KL6 A;  1SFE A;  2ODR C;  3EPJ A;  4J8Z A;  4R2A A;  1KYQ A;  1EH6 A;  3HPZ A;  3MHS C;  1F2I G;  4R2D A;  1YPN A;  4YY3 E;  3L00 A;  2HC5 A;  4O5G A;  3VK6 A;  3JTZ A;  5AC5 A;  3OML A;  5A6B A;  1AH5 A;  4DV4 E;  4JI4 E;  2YTN A;  2JY9 A;  2LJH A;  4X8W A;  3T1H E;  1X6H A;  2VQF E;  4R2C A;  3BF2 A;  2L2K B;  2EM8 A;  2D9H A;  2IHR 1;  4BC9 A;  4WX9 A;  2RS6 A;  3HPS A;  1HNW E;  2EPA A;  4F6M A;  2MKD A;  1LLM C;  2CT1 A;  2UXB E;  2UXD E;  1T4O A;  1IQS A;  2EN6 A;  2GHF A;  4P78 A;  1WXR A;  4R2R A;  4DV3 E;  4BBY A;  2LV2 A;  4K0K E;  5KL7 A;  1JK2 A;  2K4V A;  2M4I A;  3F6G A;  4GKK E;  3BID A;  2B9D A;  4JI5 E;  2NA2 A;  3VHT B;  2EMY A;  3EQ1 A;  5A2Q C;  2YT4 A;  2L33 A;  1B69 A;  3KWR A;  2MC6 A;  2L2N A;  1BB8 A;  4RH8 A;  2VQE E;  2NUE A;  2YU5 A;  4IJD A;  4DR1 E;  2JXP A;  2CPN A;  4M0V A;  2V8Q B;  1O0W A;  1T4N A;  2ENA A;  2VRD A;  2R76 A;  4DMI A;  4JI2 E;  1N33 E;  1J26 A;  1YSA C;  1GZ6 A;  2EM0 A;  2DIX A;  2M9A A;  3LML A;  1UHZ A;  5A6A A;  1QU6 A;  2ZM6 E;  1FKA E;  4DR5 E;  1L4S A;  1XMO E;  4M9V C;  2N3H A;  4DR3 E;  2LMZ A;  2YTE A;  2RQL A;  1QNT A;  4X9J A;  5T6J A;  2V87 A;  4B3M E;  2EMH A;  5FLX C;  2LTS A;  2BBG A;  4TUG A;  2G7H A;  1MGT A;  2DB2 A;  2FV4 B;  4RHB B;  4GKJ E;  1DGC A;  2L3C A;  2YSP A;  1WHQ A;  2B3T B;  2J7J A;  2RSM A;  4F6N A;  2MDR A;  2EL6 A;  2JWO A;  3JU0 A;  1GQE A;  1A1J A;  2JR1 A;  3ADJ A;  1BBG A;  4BMJ A;  4Q28 A;  2HHH E;  2EPR A;  3ADG A;  2LCE A;  4KWY A;  3F6H A;  4BC7 A;  2EMB A;  2EOF A;  2EN2 A;  2YZT A;  2EOS A;  2Q8U A;  5LMU E;  1UBD C;  1STU A;  4F54 A;  1DQ3 A;  2I9I A;  1PJS A;  4JI6 E;  4NXM E;  2EMK A;  1UN6 B;  4LU9 A;  4WYQ B;  4X64 E;  4DV2 E;  1RMD A;  4DR6 E;  2LE2 A;  2ENH A;  5AE2 A;  2EOQ A;  2EL5 A;  2EOR A;  3KZZ A;  1A1I A;  2EMC A;  1N3G A;  2HGH A;  2GLI A;  3DJW A;  4HEI A;  4F9C B;  1WJP A;  2ODR D;  2KHX A;  5BR8 E;  4O4K A;  4JI3 E;  5DNY A;  4R2Q A;  1TF3 A;  2L8T A;  1WRJ A;  5LL6 R;  2EML A;  4YHH E;  2EM7 A;  2PRT A;  1I94 E;  1XNR E;  2UXC E;  4OX9 E;  2YPN A;  4L5N C;  4LF6 E;  5IXM B;  3EPK A;  4KHP E;  5AAS A;  2DLQ A;  2V88 A;  2EOH A;  3MHH C;  2BB8 A;  2WBT A;  4WPY A;  4X66 E;  1T4L B;  3OTO E;  1GTK A;  2GPI A;  3ZOQ B;  5IWA E;  3K6Q A;  4O43 A;  2YU8 A;  2YTP A;  2MKN A;  1IMU A;  4I8O A;  2E1M A;  2DMY A;  4DUZ E;  4ZYD A;  2EZ6 A;  2EPZ A;  2LRS A;  4DV0 E;  2YTF A;  2EMZ A;  5AE3 A;  4R8O A;  1N34 E;  5LLQ A;  1FJG E;  4X62 E;  2A25 A;  1A1G A;  2LVH A;  3P1X A;  3BGH A;  3IWB A;  2FGG A;  3UK3 C;  2DLK A;  3DF6 A;  2M1S A;  2RPC A;  1RQ0 A;  5KL3 A;  1XMQ E;  3T1Y E;  3HQ1 A;  1YUI A;  2YRH A;  1PDA A;  4F9A B;  2WBU A;  2WCC 3;  4NZV A;  2V85 A;  4LF5 E;  2JOX A;  2EMX A;  2EN1 A;  1X3C A;  4WXC A;  1G2F C;  2YRK A;  1A1F A;  2EPM X;  5CFF E;  2L6M A;  1T39 A;  2B7T A;  2EPC A;  3HXL A;  4F2J C;  2EOY A;  2CSH A;  2EOX A;  2JOB A;  4WSP A;  2DMI A;  2VF1 A;  2LT7 A;  2EMI A;  4R2E A;  2EPO A;  5KL4 A;  2EPU A;  4WFT A;  2EMW A;  2WZO A;  2M7Q A;  2EM9 A;  4TUI A;  2EOI A;  3FIG A;  4LF9 E;  4LF8 E;  4DKK A;  2EM2 A;  1IBM E;  4Q35 B;  3J80 C;  3HTX A;  2EN7 A;  2EPP A;  3KZY A;  1AAY A;  1ZR9 A;  5A69 A;  4P7D A;  4JI0 E;  1KJK A;  2EPX A;  4LFC E;  5KL2 A;  4R03 A;  2EJ4 A; 
#chains in the Genus database with same CATH homology
 2DSY A;  1WXR A;  4P78 A;  3C4B A;  1YYK A;  4DV3 E;  4BBY A;  4K0K E;  2V89 A;  3DJW A;  4DR2 E;  2K4V A;  2M4I A;  3F6G A;  1WHN A;  4F9C B;  1HNX E;  4B3T E;  3J7Y p;  2B9D A;  4JI5 E;  4GKK E;  2NA2 A;  3C4T A;  4JI8 E;  2MC5 A;  2ODR D;  4DV1 E;  2KHX A;  5BR8 E;  2L3J A;  4BCA A;  2LBS B;  2LTR A;  4JI3 E;  5A2Q C;  5DNY A;  2L8T A;  2L33 A;  2YT4 A;  3AV0 A;  5LL6 R;  4YHH E;  2UUB E;  1I94 E;  2VE7 C;  1XNR E;  5F3W A;  2F8B A;  3KWR A;  2MC6 A;  2L2N A;  4OX9 E;  1HNZ E;  2UXC E;  4L5N C;  4LF6 E;  4KHP E;  4DR4 E;  2VQE E;  2NUE A;  5AAS A;  2V88 A;  4DR1 E;  1UIL A;  1YZ9 A;  2CPN A;  2RTX A;  4M0V A;  4OOG C;  4WPY A;  2V8Q B;  4X66 E;  2RS7 A;  3IWC A;  4DUY E;  3IWD A;  3OTO E;  1T4L B;  3ZOQ B;  5IWA E;  1O0W A;  3VYY A;  1T4N A;  3K6Q A;  4DV5 E;  4B3R E;  3LLH A;  3MSW A;  4LF4 E;  3VYX A;  4NXN E;  2EWL A;  1HR0 E;  4I8O A;  2E1M A;  3ADI A;  4DR7 E;  4DMI A;  1EKZ A;  2JVA A;  4JI2 E;  1N33 E;  1J26 A;  1GZ6 A;  2DMY A;  5IT9 C;  4LF7 E;  2DIX A;  3JAM C;  4DUZ E;  4M2Z A;  2EZ6 A;  3LML A;  4X65 E;  1DI2 A;  2LUQ A;  1UHZ A;  1J5E E;  1N36 E;  1QU6 A;  2LRS A;  2ZM6 E;  4DV0 E;  1FKA E;  4DR5 E;  4GEQ B;  2L92 A;  2UUC E;  1XMO E;  3H09 A;  2N3H A;  5AE3 A;  1SR9 A;  4DR3 E;  2LMZ A;  1IBL E;  2NUG A;  3ADL A;  1YYO A;  4R8O A;  2NUF A;  5T6J A;  4M30 A;  4F9B B;  2V87 A;  1N34 E;  2UUA E;  4X62 E;  4B3M E;  1FJG E;  2N3G A;  4JYA E;  2H36 X;  5FLX C;  4LTY A;  2LTS A;  1IBK E;  3P1X A;  4TUG A;  3IWB A;  2FGG A;  1ZBT A;  2KON A;  2G7H A;  3DF6 A;  2DB2 A;  2FTX B;  2E5L E;  4LFA E;  1X49 A;  2M1S A;  4B3S E;  1RQ0 A;  1YYW A;  2FV4 B;  2KOU A;  4KZS A;  1XMQ E;  3T1Y E;  3HQ1 A;  4GKJ E;  1XNQ E;  4JV5 E;  4F9A B;  5LMN E;  3J7A G;  2L2M A;  2L3C A;  2F4V E;  5ADZ A;  4BS9 A;  2V85 A;  4LF5 E;  1WHQ A;  2JOX A;  2B3T B;  2RSM A;  2V83 A;  4DV7 E;  2ODR C;  1X48 A;  2MDR A;  2JWO A;  3JU0 A;  4J8Z A;  1GQE A;  4L8N A;  2JR1 A;  5CFF E;  3ADJ A;  2L6M A;  4DV6 E;  2B7T A;  3HXL A;  3HPZ A;  4BMJ A;  4Q28 A;  2UU9 E;  2HHH E;  2B7V A;  2JOB A;  1ZBQ A;  4WSP A;  3J81 C;  2VF1 A;  4YY3 E;  1N32 E;  3ADG A;  4WFT A;  4JI4 E;  4DV4 E;  3VK6 A;  3JTZ A;  3OML A;  2M7Q A;  2WZO A;  4AQY E;  1PKP A;  3F6H A;  4BC7 A;  4TUI A;  3RMP A;  2JY9 A;  4JI1 E;  2LJH A;  2YZT A;  4X8W A;  3FIG A;  3T1H E;  2VQF E;  4JI7 E;  2LUP B;  5LMU E;  4LF9 E;  1STU A;  4F54 A;  1DQ3 A;  4LF8 E;  4LFB E;  4DKK A;  4JI6 E;  1RC7 A;  4NXM E;  2L2K B;  1IBM E;  2V86 A;  4LU9 A;  4WYQ B;  4X64 E;  3J80 C;  4DV2 E;  3HTX A;  3AUZ A;  4DR6 E;  2IHR 1;  4BC9 A;  2RS6 A;  3HPS A;  2LE2 A;  4P7D A;  4JI0 E;  1HNW E;  5AE2 A;  4LFC E;  2UXB E;  4R03 A;  1X47 A;  2UXD E;  1T4O A;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...