2KONA

Nmr solution structure of cv_2116 from chromobacterium violaceum. northeast structural genomics consortium target cvt4(1-82)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MNVAHYRGYEIEPGHQYRDDIRKYVPYALIRKVGVPDRTPIPTTYPEFYDLEADAERVSIACAKIIIDSHLDRHDQGLADLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title NMR solution structure of CV_2116 from Chromobacterium violaceum.Northeast Structural Genomics Consortium Target CvT4(1-82)
rcsb
source organism Chromobacterium violaceum
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.350 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2konA00
2KONA
chains in the Genus database with same CATH superfamily
2CSHA 1T39A 1X6EA 3THOB 3ADGA 4Q28A 2EMZA 3ADLA 4X8WA 4O43A 4BCAA 2YTGA 1O0WA 1QNTA 1PKPA 2L3CA 2DMIA 5T6JA 4DR3E 4R2PA 2MC5A 2EL4A 1P47A 2EPRA 1T4LB 2LO3A 2RSMA 1MGTA 2DLKA 4DV0E 2JP9A 1NEIA 2J7JA 4TUIA 4X64E 2B7VA 2JVAA 3EPKA 2LUPB 3J81C 2EPNA 2EM2A 2LE2A 1RC7A 1JK1A 5CFFE 3HPZA 2V89A 1IQOA 1WHQA 4DR4E 4YHHE 4LF6E 5KL5A 1UN6B 2YU5A 3BBGA 4DV3E 1A1JA 1IBLE 1FJGE 2EOXA 2NA2A 2EN7A 2EPXA 2MDRA 2EQ0A 4BC9A 3VYYA 1UHZA 4DV1E 2EPPA 4M2ZA 3J80C 2VRDA 2DMYA 2DB2A 4LF7E 1PJQA 4K0KE 2VQFE 2LTRA 2ELYA 4NHRA 4FK5C 2YZTA 5A6BA 4JYAE 1IQSA 4J8ZA 2EJ4A 2L2NA 2HGHA 4B3TE 2ODRC 1ZAAC 1BB8A 5IV8B 2YTEA 5KL2A 4P78A 3K6QA 2M4IA 2EZ6A 2VF1A 4F9AB 2L33A 4ZYDA 1HNZE 2V86A 1EH7A 2EMXA 5LMUE 1RQ0A 3OMLA 1N3GA 2EE8A 4DR6E 3FIGA 4P7DA 2LUQA 2EPKX 2LMZA 1A1LA 2M1SA 4DV5E 4L8NA 1G2DC 2MKNA 2L2KB 1YYKA 4RHBB 4WFTA 2RQLA 1TF6A 4JI5E 2K4VA 2EOIA 2L8TA 4B3ME 2EN3A 4DR2E 1YSAC 4Q35B 2EMBA 2EOMA 1X6FA 5KL6A 1YYWA 2EOEA 1TN9A 2EPMX 2RS7A 1A1GA 1BBOA 2HC5A 1X47A 2EQ1A 3ADIA 4MLQA 2RPCA 3LMLA 4O24A 2R76A 2KOUA 4HTGA 4BMJA 2A25A 2JY9A 1PJSA 4JI2E 2EN2A 2JOBA 4JI6E 5LLQA 2VE7C 3DF6A 1QU6A 4O5GA 4R2QA 1WHNA 2RSIA 2EMAA 2EMYA 1X6HA 2EM9A 2YT4A 3MHSC 5IXMB 1FKAE 4R2CA 2YTDA 2YTFA 1PJTA 4BBYA 4JI1E 2YWQA 4LFBE 1WXRA 3EPHA 1SR9A 2YRMA 4KZSA 2RTXA 1GTKA 4JI8E 2E5LE 5A6AA 2YTQA 2EMIA 2YTJA 3C6MA 2L2MA 1YYOA 3HPSA 2EORA 2EMFA 4LTYA 3J7Yp 4MLVA 2F8BA 3ECRA 2BBGA 2EL6A 4DV6E 4DR5E 1YZ9A 2NABA 1X3CA 2UXDE 5AE3A 4LF8E 4IS1C 4WYQB 4WXCA 4WX9A 1UBDC 4DKKA 2I13A 3AUZA 2WBUA 2EP3A 4F9BB 2WZOA 1MEYC 2WBTA 2ELZA 2V83A 3THNA 2EMGA 2K7IA 4BC7A 2IHR1 2YSPA 1ZU1A 2NUEA 1ZR9A 1UILA 3TQMA 2L3JA 4L5NC 3KZZA 2CPNA 1J5EE 4X65E 4JV5E 3ADJA 4WXDA 2GHFA 2V87A 4F6MA 2YRKA 3HQ1A 3IWCA 2MDGA 2YTIA 1KJKA 2DIXA 1GZ6A 4DUZE 4ZYEA 3L00A 2EOFA 2MC6A 4BHCA 4JI7E 3LLHA 1IMUA 4DV7E 4M9VC 3T1HE 1AH5A 1L4SA 1N34E 5F3WA 2EOOA 5BR8E 3RMPA 4F6NA 3KWRA 1BBGA 5ADZA 4GEQB 2EMLA 2EOJA 2L92A 5LL6R 4LF9E 3EPJA 3IWDA 2PRTA 1Z1BA 1GQEA 2VQEE 2CTDA 2EN8A 3H09A 3ZOQB 2EMCA 1HNWE 5AC4A 1T4NA 2B3TB 2UUBE 3OTOE 1G2FC 4JI0E 3JU0A 3BIDA 2UXCE 3JAMC 1J26A 1DI2A 1YUIA 4HEIA 4KHPE 1A1IA 1XNRE 2DGCA 1A1FA 4LF4E 5AE2A 5TSEA 2D9HA 2HJJA 2V8QB 4NXME 2UUAE 2ODRD 1JK2A 4F54A 1HR0E 2LCEA 5IT9C 2LV2A 2FGGA 2EM4A 4R2AA 1PDAA 1EH6A 2N3GA 2GLIA 4LFAE 5A6BD 2M9AA 5AASA 2EM8A 4DV4E 4R2EA 2EN4A 2MKDA 3F6GA 1B69A 4OX9E 4X66E 4R03A 1T38A 4WPYA 2CT1A 2R1FA 4GKKE 4DR1E 2EPZA 1N36E 2V85A 2Q8UA 2EPAA 3BF2A 3QG5C 1A1KA 2EOQA 3M99B 2JWOA 2JR1A 4M30A 2YTOA 3EPLA 2ADRA 1IBKE 1T4OA 4M0VA 1LLMC 1XNQE 4F2JC 4O4KA 2EMWA 2EOSA 4YY3E 2DLQA 1WRJA 2RS6A 2EOZA 5AC5A 2ZM6E 2B9DA 2E72A 3HXLA 4B3RE 1A1HA 5FLXC 3VHTB 1AAYA 2N3HA 1F2IG 2EWLA 4F9CB 4DMIA 1ZBTA 2NUFA 3C4TA 3KZYA 3BGHA 1X5WA 3T1YE 2E1MA 5A69A 2LJHA 3VK6A 2EN1A 4X62E 2L6MA 1WJPA 1TF3A 1YFHA 1X49A 3EQ1A 5A2QC 2ENAA 1RMDA 4R2DA 4KWYA 2G7HA 4TUGA 3HTXA 2EPCA 5KL7A 2ENHA 5DNYA 2I9IA 4BHBA 3MHHC 3AV0A 4LU9A 1EH8A 2F4VE 1SFEA 2BB8A 3DJWA 2LBSB 2EL5A 2UXBE 2EMKA 4GZNC 4R2RA 2YRHA 1STUA 2EM5A 1DGCA 4WSGA 5LMNE 3UK3C 1X48A 4JI3E 2YU8A 2UUCE 4NZVA 1I94E 4LFCE 4IJDA 2EM6A 2LT7A 5A6KA 2YSOA 2V88A 4LF5E 2JPAA 2DRPA 2EN6A 4ZYGA 1YUJA 2HHHE 1NCSA 2EM0A 1KYQA 1XMOE 1ZBQA 2GPIA 2YTPA 1YPNA 5KL3A 2FTXB 2JXPA 5AE1A 2EPOA 2N8XA 2EPUA 4B3SE 2YPNA 4DV2E 3J7AG 2ENCA 2FV4B 1DQ3A 2LJUA 2EOHA 4R2SA 4X9JA 5IWAE 2JOXA 3C6KA 2JYAA 2EOYA 2LTSA 2WBSA 1N33E 4GKJE 3F6HA 4I8OA 4ZYHA 4DR7E 3JTZA 2WCC3 2KHXA 1N32E 2H36X 4NXNE 2DSYA 2NUGA 2EQ3A 4JI4E 2KONA 3IWBA 3VYXA 4RH8A 5KL4A 4BS9A 2EM7A 2LVHA 4R8OA 1HNXE 3P1XA 4OOGC 4WSPA 3MSWA 2EPLX 1EKZA 2B7TA 4N4RB 1IBME 5A6JA 2M7QA 2UU9E 2EMHA 2LRSA 2YTNA 4DUYE 1XMQE 2EM3A 3C4BA 4AQYE
chains in the Genus database with same CATH topology
4X62E 4GEQB 2L6MA 3LMLA 3ADGA 4Q28A 2KOUA 1X49A 2L92A 4BMJA 2JY9A 4X8WA 4BCAA 5LL6R 5A2QC 3ADLA 4JI2E 2JOBA 4LF9E 4JI6E 1O0WA 1PKPA 3IWDA 2L3CA 2VE7C 3DF6A 1QU6A 5T6JA 1GQEA 1WHNA 4DR3E 2VQEE 3H09A 3ZOQB 2G7HA 4TUGA 3HTXA 2MC5A 2YT4A 5DNYA 1HNWE 1T4LB 2RSMA 1T4NA 2B3TB 1FKAE 3AV0A 2UUBE 3OTOE 4LU9A 2F4VE 3DJWA 4BBYA 4DV0E 4JI0E 3JU0A 2UXCE 4TUIA 2LBSB 4X64E 3JAMC 2B7VA 4JI1E 2JVAA 4DR6E 2LUPB 4LFBE 1WXRA 2UXBE 1SR9A 1DI2A 3J81C 4KZSA 2RTXA 1STUA 1XNRE 4KHPE 4JI8E 2LE2A 2E5LE 1RC7A 5LMNE 5CFFE 4LF4E 2L2MA 1X48A 5AE2A 3HPZA 3HPSA 2V89A 1YYOA 1WHQA 4JI3E 2V8QB 4NXME 1N32E 4LTYA 4YHHE 2ODRD 2UUAE 4LF6E 4DR4E 4F54A 3J7Yp 2UUCE 2F8BA 1I94E 4DV3E 4LFCE 1HR0E 1IBLE 1FJGE 4DV6E 5IT9C 2NA2A 4DR5E 2FGGA 1YZ9A 2V88A 2MDRA 4LF5E 2UXDE 2N3GA 4BC9A 4LFAE 5AE3A 4LF8E 3VYYA 5AASA 1UHZA 4WYQB 4DV1E 4DV4E 2HHHE 4M2ZA 3J80C 4DKKA 3AUZA 2DMYA 1ZBQA 1XMOE 2DB2A 4F9BB 2WZOA 1J26A 3F6GA 4LF7E 2FTXB 4OX9E 4K0KE 2V83A 5AE1A 4X66E 2LTRA 4R03A 2VQFE 4WPYA 4GKKE 4B3SE 2YZTA 4BC7A 4DR1E 2IHR1 4DV2E 2NUEA 3J7AG 1UILA 4JYAE 4J8ZA 2FV4B 1DQ3A 2L3JA 1N36E 2L2NA 4B3TE 2ODRC 4L5NC 5IWAE 2JOXA 2CPNA 1J5EE 2V85A 4P78A 3K6QA 4X65E 2M4IA 4JV5E 3ADJA 2EZ6A 2VF1A 2LTSA 1N33E 2JWOA 2JR1A 4F9AB 4GKJE 3F6HA 2L33A 2V87A 1HNZE 2V86A 4I8OA 4DR7E 3JTZA 4M30A 5LMUE 1RQ0A 3OMLA 2KHXA 3HQ1A 2H36X 4NXNE 3IWCA 1IBKE 2DSYA 3FIGA 2DIXA 4P7DA 2LUQA 3KWRA 1T4OA 1GZ6A 4M0VA 2NUGA 4DUZE 1XNQE 3ADIA 4JI4E 2KONA 3IWBA 4YY3E 2LMZA 3VYXA 2RS6A 2M1SA 2ZM6E 4DV5E 2B9DA 2MC6A 4L8NA 4BS9A 3HXLA 4B3RE 5FLXC 4JI7E 2N3HA 2EWLA 4R8OA 1HNXE 2L2KB 1YYKA 3P1XA 4OOGC 3LLHA 4WFTA 4WSPA 4DMIA 4F9CB 3MSWA 1ZBTA 4DV7E 3T1HE 2K4VA 2L8TA 1EKZA 2NUFA 4B3ME 4JI5E 4DR2E 3C4TA 2B7TA 5F3WA 1N34E 1IBME 5BR8E 3T1YE 2E1MA 2M7QA 2LJHA 3RMPA 2UU9E 1YYWA 2RS7A 2LRSA 3VK6A 4DUYE 1XMQE 1X47A 3C4BA 5ADZA 4AQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KON A; 
#chains in the Genus database with same CATH topology
 2CSH A;  1T39 A;  1X6E A;  3THO B;  3ADG A;  4Q28 A;  2EMZ A;  3ADL A;  4X8W A;  4O43 A;  4BCA A;  2YTG A;  1O0W A;  1QNT A;  1PKP A;  2L3C A;  2DMI A;  5T6J A;  4DR3 E;  4R2P A;  2MC5 A;  2EL4 A;  1P47 A;  2EPR A;  1T4L B;  2LO3 A;  2RSM A;  1MGT A;  2DLK A;  4DV0 E;  2JP9 A;  1NEI A;  2J7J A;  4TUI A;  4X64 E;  2B7V A;  2JVA A;  3EPK A;  2LUP B;  3J81 C;  2EPN A;  2EM2 A;  2LE2 A;  1RC7 A;  1JK1 A;  5CFF E;  3HPZ A;  2V89 A;  1IQO A;  1WHQ A;  4DR4 E;  4YHH E;  4LF6 E;  5KL5 A;  1UN6 B;  2YU5 A;  3BBG A;  4DV3 E;  1A1J A;  1IBL E;  1FJG E;  2EOX A;  2NA2 A;  2EN7 A;  2EPX A;  2MDR A;  2EQ0 A;  4BC9 A;  3VYY A;  1UHZ A;  4DV1 E;  2EPP A;  4M2Z A;  3J80 C;  2VRD A;  2DMY A;  2DB2 A;  4LF7 E;  1PJQ A;  4K0K E;  2VQF E;  2LTR A;  2ELY A;  4NHR A;  4FK5 C;  2YZT A;  5A6B A;  4JYA E;  1IQS A;  4J8Z A;  2EJ4 A;  2L2N A;  2HGH A;  4B3T E;  2ODR C;  1ZAA C;  1BB8 A;  5IV8 B;  2YTE A;  5KL2 A;  4P78 A;  3K6Q A;  2M4I A;  2EZ6 A;  2VF1 A;  4F9A B;  2L33 A;  4ZYD A;  1HNZ E;  2V86 A;  1EH7 A;  2EMX A;  5LMU E;  1RQ0 A;  3OML A;  1N3G A;  2EE8 A;  4DR6 E;  3FIG A;  4P7D A;  2LUQ A;  2EPK X;  2LMZ A;  1A1L A;  2M1S A;  4DV5 E;  4L8N A;  1G2D C;  2MKN A;  2L2K B;  1YYK A;  4RHB B;  4WFT A;  2RQL A;  1TF6 A;  4JI5 E;  2K4V A;  2EOI A;  2L8T A;  4B3M E;  2EN3 A;  4DR2 E;  1YSA C;  4Q35 B;  2EMB A;  2EOM A;  1X6F A;  5KL6 A;  1YYW A;  2EOE A;  1TN9 A;  2EPM X;  2RS7 A;  1A1G A;  1BBO A;  2HC5 A;  1X47 A;  2EQ1 A;  3ADI A;  4MLQ A;  2RPC A;  3LML A;  4O24 A;  2R76 A;  2KOU A;  4HTG A;  4BMJ A;  2A25 A;  2JY9 A;  1PJS A;  4JI2 E;  2EN2 A;  2JOB A;  4JI6 E;  5LLQ A;  2VE7 C;  3DF6 A;  1QU6 A;  4O5G A;  4R2Q A;  1WHN A;  2RSI A;  2EMA A;  2EMY A;  1X6H A;  2EM9 A;  2YT4 A;  3MHS C;  5IXM B;  1FKA E;  4R2C A;  2YTD A;  2YTF A;  1PJT A;  4BBY A;  4JI1 E;  2YWQ A;  4LFB E;  1WXR A;  3EPH A;  1SR9 A;  2YRM A;  4KZS A;  2RTX A;  1GTK A;  4JI8 E;  2E5L E;  5A6A A;  2YTQ A;  2EMI A;  2YTJ A;  3C6M A;  2L2M A;  1YYO A;  3HPS A;  2EOR A;  2EMF A;  4LTY A;  3J7Y p;  4MLV A;  2F8B A;  3ECR A;  2BBG A;  2EL6 A;  4DV6 E;  4DR5 E;  1YZ9 A;  2NAB A;  1X3C A;  2UXD E;  5AE3 A;  4LF8 E;  4IS1 C;  4WYQ B;  4WXC A;  4WX9 A;  1UBD C;  4DKK A;  2I13 A;  3AUZ A;  2WBU A;  2EP3 A;  4F9B B;  2WZO A;  1MEY C;  2WBT A;  2ELZ A;  2V83 A;  3THN A;  2EMG A;  2K7I A;  4BC7 A;  2IHR 1;  2YSP A;  1ZU1 A;  2NUE A;  1ZR9 A;  1UIL A;  3TQM A;  2L3J A;  4L5N C;  3KZZ A;  2CPN A;  1J5E E;  4X65 E;  4JV5 E;  3ADJ A;  4WXD A;  2GHF A;  2V87 A;  4F6M A;  2YRK A;  3HQ1 A;  3IWC A;  2MDG A;  2YTI A;  1KJK A;  2DIX A;  1GZ6 A;  4DUZ E;  4ZYE A;  3L00 A;  2EOF A;  2MC6 A;  4BHC A;  4JI7 E;  3LLH A;  1IMU A;  4DV7 E;  4M9V C;  3T1H E;  1AH5 A;  1L4S A;  1N34 E;  5F3W A;  2EOO A;  5BR8 E;  3RMP A;  4F6N A;  3KWR A;  1BBG A;  5ADZ A;  4GEQ B;  2EML A;  2EOJ A;  2L92 A;  5LL6 R;  4LF9 E;  3EPJ A;  3IWD A;  2PRT A;  1Z1B A;  1GQE A;  2VQE E;  2CTD A;  2EN8 A;  3H09 A;  3ZOQ B;  2EMC A;  1HNW E;  5AC4 A;  1T4N A;  2B3T B;  2UUB E;  3OTO E;  1G2F C;  4JI0 E;  3JU0 A;  3BID A;  2UXC E;  3JAM C;  1J26 A;  1DI2 A;  1YUI A;  4HEI A;  4KHP E;  1A1I A;  1XNR E;  2DGC A;  1A1F A;  4LF4 E;  5AE2 A;  5TSE A;  2D9H A;  2HJJ A;  2V8Q B;  4NXM E;  2UUA E;  2ODR D;  1JK2 A;  4F54 A;  1HR0 E;  2LCE A;  5IT9 C;  2LV2 A;  2FGG A;  2EM4 A;  4R2A A;  1PDA A;  1EH6 A;  2N3G A;  2GLI A;  4LFA E;  5A6B D;  2M9A A;  5AAS A;  2EM8 A;  4DV4 E;  4R2E A;  2EN4 A;  2MKD A;  3F6G A;  1B69 A;  4OX9 E;  4X66 E;  4R03 A;  1T38 A;  4WPY A;  2CT1 A;  2R1F A;  4GKK E;  4DR1 E;  2EPZ A;  1N36 E;  2V85 A;  2Q8U A;  2EPA A;  3BF2 A;  3QG5 C;  1A1K A;  2EOQ A;  3M99 B;  2JWO A;  2JR1 A;  4M30 A;  2YTO A;  3EPL A;  2ADR A;  1IBK E;  1T4O A;  4M0V A;  1LLM C;  1XNQ E;  4F2J C;  4O4K A;  2EMW A;  2EOS A;  4YY3 E;  2DLQ A;  1WRJ A;  2RS6 A;  2EOZ A;  5AC5 A;  2ZM6 E;  2B9D A;  2E72 A;  3HXL A;  4B3R E;  1A1H A;  5FLX C;  3VHT B;  1AAY A;  2N3H A;  1F2I G;  2EWL A;  4F9C B;  4DMI A;  1ZBT A;  2NUF A;  3C4T A;  3KZY A;  3BGH A;  1X5W A;  3T1Y E;  2E1M A;  5A69 A;  2LJH A;  3VK6 A;  2EN1 A;  4X62 E;  2L6M A;  1WJP A;  1TF3 A;  1YFH A;  1X49 A;  3EQ1 A;  5A2Q C;  2ENA A;  1RMD A;  4R2D A;  4KWY A;  2G7H A;  4TUG A;  3HTX A;  2EPC A;  5KL7 A;  2ENH A;  5DNY A;  2I9I A;  4BHB A;  3MHH C;  3AV0 A;  4LU9 A;  1EH8 A;  2F4V E;  1SFE A;  2BB8 A;  3DJW A;  2LBS B;  2EL5 A;  2UXB E;  2EMK A;  4GZN C;  4R2R A;  2YRH A;  1STU A;  2EM5 A;  1DGC A;  4WSG A;  5LMN E;  3UK3 C;  1X48 A;  4JI3 E;  2YU8 A;  2UUC E;  4NZV A;  1I94 E;  4LFC E;  4IJD A;  2EM6 A;  2LT7 A;  5A6K A;  2YSO A;  2V88 A;  4LF5 E;  2JPA A;  2DRP A;  2EN6 A;  4ZYG A;  1YUJ A;  2HHH E;  1NCS A;  2EM0 A;  1KYQ A;  1XMO E;  1ZBQ A;  2GPI A;  2YTP A;  1YPN A;  5KL3 A;  2FTX B;  2JXP A;  5AE1 A;  2EPO A;  2N8X A;  2EPU A;  4B3S E;  2YPN A;  4DV2 E;  3J7A G;  2ENC A;  2FV4 B;  1DQ3 A;  2LJU A;  2EOH A;  4R2S A;  4X9J A;  5IWA E;  2JOX A;  3C6K A;  2JYA A;  2EOY A;  2LTS A;  2WBS A;  1N33 E;  4GKJ E;  3F6H A;  4I8O A;  4ZYH A;  4DR7 E;  3JTZ A;  2WCC 3;  2KHX A;  1N32 E;  2H36 X;  4NXN E;  2DSY A;  2NUG A;  2EQ3 A;  4JI4 E;  2KON A;  3IWB A;  3VYX A;  4RH8 A;  5KL4 A;  4BS9 A;  2EM7 A;  2LVH A;  4R8O A;  1HNX E;  3P1X A;  4OOG C;  4WSP A;  3MSW A;  2EPL X;  1EKZ A;  2B7T A;  4N4R B;  1IBM E;  5A6J A;  2M7Q A;  2UU9 E;  2EMH A;  2LRS A;  2YTN A;  4DUY E;  1XMQ E;  2EM3 A;  3C4B A;  4AQY E; 
#chains in the Genus database with same CATH homology
 4X62 E;  4GEQ B;  2L6M A;  3LML A;  3ADG A;  4Q28 A;  2KOU A;  1X49 A;  2L92 A;  4BMJ A;  2JY9 A;  4X8W A;  4BCA A;  5LL6 R;  5A2Q C;  3ADL A;  4JI2 E;  2JOB A;  4LF9 E;  4JI6 E;  1O0W A;  1PKP A;  3IWD A;  2L3C A;  2VE7 C;  3DF6 A;  1QU6 A;  5T6J A;  1GQE A;  1WHN A;  4DR3 E;  2VQE E;  3H09 A;  3ZOQ B;  2G7H A;  4TUG A;  3HTX A;  2MC5 A;  2YT4 A;  5DNY A;  1HNW E;  1T4L B;  2RSM A;  1T4N A;  2B3T B;  1FKA E;  3AV0 A;  2UUB E;  3OTO E;  4LU9 A;  2F4V E;  3DJW A;  4BBY A;  4DV0 E;  4JI0 E;  3JU0 A;  2UXC E;  4TUI A;  2LBS B;  4X64 E;  3JAM C;  2B7V A;  4JI1 E;  2JVA A;  4DR6 E;  2LUP B;  4LFB E;  1WXR A;  2UXB E;  1SR9 A;  1DI2 A;  3J81 C;  4KZS A;  2RTX A;  1STU A;  1XNR E;  4KHP E;  4JI8 E;  2LE2 A;  2E5L E;  1RC7 A;  5LMN E;  5CFF E;  4LF4 E;  2L2M A;  1X48 A;  5AE2 A;  3HPZ A;  3HPS A;  2V89 A;  1YYO A;  1WHQ A;  4JI3 E;  2V8Q B;  4NXM E;  1N32 E;  4LTY A;  4YHH E;  2ODR D;  2UUA E;  4LF6 E;  4DR4 E;  4F54 A;  3J7Y p;  2UUC E;  2F8B A;  1I94 E;  4DV3 E;  4LFC E;  1HR0 E;  1IBL E;  1FJG E;  4DV6 E;  5IT9 C;  2NA2 A;  4DR5 E;  2FGG A;  1YZ9 A;  2V88 A;  2MDR A;  4LF5 E;  2UXD E;  2N3G A;  4BC9 A;  4LFA E;  5AE3 A;  4LF8 E;  3VYY A;  5AAS A;  1UHZ A;  4WYQ B;  4DV1 E;  4DV4 E;  2HHH E;  4M2Z A;  3J80 C;  4DKK A;  3AUZ A;  2DMY A;  1ZBQ A;  1XMO E;  2DB2 A;  4F9B B;  2WZO A;  1J26 A;  3F6G A;  4LF7 E;  2FTX B;  4OX9 E;  4K0K E;  2V83 A;  5AE1 A;  4X66 E;  2LTR A;  4R03 A;  2VQF E;  4WPY A;  4GKK E;  4B3S E;  2YZT A;  4BC7 A;  4DR1 E;  2IHR 1;  4DV2 E;  2NUE A;  3J7A G;  1UIL A;  4JYA E;  4J8Z A;  2FV4 B;  1DQ3 A;  2L3J A;  1N36 E;  2L2N A;  4B3T E;  2ODR C;  4L5N C;  5IWA E;  2JOX A;  2CPN A;  1J5E E;  2V85 A;  4P78 A;  3K6Q A;  4X65 E;  2M4I A;  4JV5 E;  3ADJ A;  2EZ6 A;  2VF1 A;  2LTS A;  1N33 E;  2JWO A;  2JR1 A;  4F9A B;  4GKJ E;  3F6H A;  2L33 A;  2V87 A;  1HNZ E;  2V86 A;  4I8O A;  4DR7 E;  3JTZ A;  4M30 A;  5LMU E;  1RQ0 A;  3OML A;  2KHX A;  3HQ1 A;  2H36 X;  4NXN E;  3IWC A;  1IBK E;  2DSY A;  3FIG A;  2DIX A;  4P7D A;  2LUQ A;  3KWR A;  1T4O A;  1GZ6 A;  4M0V A;  2NUG A;  4DUZ E;  1XNQ E;  3ADI A;  4JI4 E;  2KON A;  3IWB A;  4YY3 E;  2LMZ A;  3VYX A;  2RS6 A;  2M1S A;  2ZM6 E;  4DV5 E;  2B9D A;  2MC6 A;  4L8N A;  4BS9 A;  3HXL A;  4B3R E;  5FLX C;  4JI7 E;  2N3H A;  2EWL A;  4R8O A;  1HNX E;  2L2K B;  1YYK A;  3P1X A;  4OOG C;  3LLH A;  4WFT A;  4WSP A;  4DMI A;  4F9C B;  3MSW A;  1ZBT A;  4DV7 E;  3T1H E;  2K4V A;  2L8T A;  1EKZ A;  2NUF A;  4B3M E;  4JI5 E;  4DR2 E;  3C4T A;  2B7T A;  5F3W A;  1N34 E;  1IBM E;  5BR8 E;  3T1Y E;  2E1M A;  2M7Q A;  2LJH A;  3RMP A;  2UU9 E;  1YYW A;  2RS7 A;  2LRS A;  3VK6 A;  4DUY E;  1XMQ E;  1X47 A;  3C4B A;  5ADZ A;  4AQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...