2KONA

Nmr solution structure of cv_2116 from chromobacterium violaceum. northeast structural genomics consortium target cvt4(1-82)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MNVAHYRGYEIEPGHQYRDDIRKYVPYALIRKVGVPDRTPIPTTYPEFYDLEADAERVSIACAKIIIDSHLDRHDQGLADLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of CV_2116 from Chromobacterium violaceum.Northeast Structural Genomics Consortium Target CvT4(1-82)
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2009-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.350 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2konA00
2KONA
chains in the Genus database with same CATH superfamily
1YFHA 3H09A 2VF1A 2N3GA 3EPHA 5DNYA 5IWAE 1JK2A 2K4VA 2JYAA 4R2QA 2NUEA 1KYQA 4X64E 1X5WA 2E1MA 1A1FA 4BCAA 1GTKA 2DLKA 5TSEA 5A6AA 2DMYA 4LF5E 4X62E 5CFFE 1MGTA 2NUFA 2RSMA 2EMKA 2EMCA 3IWDA 4O4KA 2EPMX 1N32E 4LF8E 3THOB 1X48A 1MEYC 4WXCA 4JI1E 2EMZA 4DV6E 2YSOA 1EKZA 4KZSA 1TN9A 2UU9E 2GPIA 2E5LE 4WXDA 4F6NA 4X66E 1WXRA 2CPNA 4BHBA 1ZR9A 3RMPA 1A1IA 2JVAA 1ZBQA 2K7IA 4WPYA 2L2KB 2WBTA 5AC5A 2LMZA 2RSIA 3AUZA 4BHCA 2NUGA 4GKJE 2EN7A 1YYOA 2EM8A 2MC6A 2EL6A 2EPUA 4DR6E 3THNA 1N33E 1IMUA 1HNXE 2EMLA 2ENHA 2WBSA 2EZ6A 3VHTB 3KWRA 2L3CA 1X47A 4F54A 3DJWA 5A2QC 4LFBE 2EPKX 2CT1A 1EH6A 1ZU1A 2V83A 1UN6B 2RTXA 3EPKA 3MHHC 1UBDC 2LTSA 5IV8B 3L00A 3TQMA 1QNTA 4DV0E 4OOGC 5A6JA 4DR2E 2EQ3A 1STUA 1X49A 1DQ3A 5F3WA 1AAYA 4HEIA 4R2SA 1XMOE 4R03A 3T1YE 5BR8E 3J7Yp 2D9HA 4M0VA 3UK3C 4WSGA 2IHR1 4TUIA 2EPZA 3KZZA 3J7AG 1EH8A 2KOUA 1HR0E 1IBKE 3JU0A 2EM4A 4JI7E 1SFEA 2VQFE 5A6KA 2YT4A 2JPAA 2ADRA 2V8QB 2EN4A 2JOXA 2G7HA 2UUBE 4ZYHA 2EM6A 2YRHA 4BC9A 2VE7C 4X9JA 4J8ZA 2MC5A 2F8BA 2EMFA 3VYYA 1YUIA 1RQ0A 2YTJA 3JAMC 3EPLA 1T38A 4LFAE 2YTPA 3ADIA 5KL2A 2L33A 1TF3A 1YZ9A 4ZYDA 2LCEA 3ZOQB 2MDRA 2ENCA 2EOYA 1PJQA 2H36X 4OX9E 2DSYA 2YTFA 2MKNA 3ADGA 2BBGA 2ELYA 4B3ME 2EOOA 2EOZA 3ADLA 4F6MA 2V88A 1UILA 2DB2A 2WZOA 2FTXB 4RHBB 1J26A 3DF6A 4LU9A 2FGGA 4MLQA 1B69A 4GKKE 4R2RA 3LMLA 2DRPA 2EWLA 2EJ4A 1RC7A 1A1GA 5A6BD 1BB8A 4BMJA 3P1XA 2V86A 4JI2E 4JV5E 1BBOA 2DMIA 2B7VA 2A25A 2J7JA 3BBGA 4DKKA 5LMUE 2EN6A 2RS6A 4L8NA 4DR4E 4NHRA 3KZYA 2LBSB 4LFCE 4M30A 3F6GA 3HPSA 1EH7A 3OTOE 5A6BA 2I9IA 4IJDA 1FKAE 3MHSC 1QU6A 4YY3E 2EMHA 2EOSA 2YTIA 3VYXA 2UXBE 4O5GA 5LL6R 2JR1A 3F6HA 2EMAA 2CTDA 4P7DA 2V87A 4R2PA 2EPLX 2EOQA 2N8XA 2EPCA 1XNRE 3J81C 4LF6E 5KL7A 1UHZA 2HC5A 3JTZA 2LUPB 2YTGA 2R1FA 3C4BA 2GLIA 1X3CA 2M9AA 1WRJA 4HTGA 3IWCA 4DR7E 4P78A 3OMLA 2MDGA 2DGCA 4R2EA 4B3TE 2LRSA 1YYKA 5KL5A 2EL4A 4BS9A 2E72A 2EOEA 2YTDA 1X6EA 2EM2A 1DI2A 3BGHA 2UXDE 2JY9A 1YPNA 2Q8UA 4DV5E 1BBGA 1YSAC 1XNQE 2JXPA 5T6JA 4X8WA 3BF2A 4DR5E 5AE3A 4B3RE 3HXLA 1PKPA 2JWOA 3AV0A 1SR9A 4JYAE 3HQ1A 4ZYGA 2EN3A 2N3HA 4DR3E 3QG5C 2F4VE 2EPOA 3K6QA 4O43A 2FV4B 2JP9A 1NCSA 2EN2A 1IBME 2HGHA 2VRDA 2JOBA 4R2CA 4DUZE 5KL3A 2UXCE 5ADZA 5FLXC 2B3TB 2R76A 1J5EE 5AE1A 4ZYEA 2WCC3 1WJPA 1IBLE 1TF6A 4RH8A 4R8OA 4IS1C 4DV3E 2EPRA 1Z1BA 3VK6A 1T4OA 2EE8A 2GHFA 1JK1A 4R2DA 1ZBTA 2RPCA 1PJTA 2DIXA 4NXME 2WBUA 2EMXA 2RQLA 1P47A 1WHQA 3HPZA 1RMDA 2NA2A 2YTNA 1N34E 1FJGE 4DR1E 1HNZE 4N4RB 1YUJA 2DLQA 5KL6A 4JI8E 3EQ1A 4F9AB 2EM5A 1A1HA 4LF7E 2EP3A 4MLVA 3HTXA 1PDAA 1WHNA 3C4TA 2LO3A 2EM0A 2BB8A 3ECRA 3ADJA 4F9CB 4KWYA 2EMGA 2YU5A 2M7QA 4AQYE 4LTYA 1GZ6A 4F2JC 1A1LA 2EM7A 1GQEA 2M1SA 4X65E 2EN1A 1LLMC 2LJHA 3LLHA 4O24A 2L92A 5AASA 5IT9C 1T39A 2RS7A 2VQEE 2L8TA 4WYQB 2LVHA 4M2ZA 2EOMA 5LMNE 4F9BB 2L2NA 2YWQA 3FIGA 4BBYA 1NEIA 3C6MA 5KL4A 4JI3E 2HJJA 5LLQA 2L6MA 2EOIA 1IQSA 1I94E 4Q35B 2YTQA 2EOXA 4DV4E 4I8OA 2EM3A 2PRTA 4YHHE 2L3JA 2YTEA 2LV2A 2YPNA 1ZAAC 2ELZA 5AC4A 2EPAA 2EMIA 4M9VC 2KONA 1T4NA 2EMBA 2I13A 4GZNC 2CSHA 4NZVA 2YU8A 1A1JA 2EPNA 2LTRA 1YYWA 1L4SA 4GEQB 2EPPA 5A69A 1X6HA 4DV7E 1A1KA 4L5NC 2EOHA 1G2FC 4R2AA 4DV2E 1XMQE 4B3SE 3M99B 4WSPA 4FK5C 3MSWA 3J80C 3EPJA 2EOJA 3IWBA 2HHHE 2YRMA 4LF4E 4WX9A 4KHPE 2YRKA 4JI4E 4K0KE 2YSPA 1O0WA 2B9DA 5IXMB 4NXNE 4DUYE 4JI6E 4WFTA 2LUQA 2EQ1A 4LF9E 1N3GA 1DGCA 2YTOA 2M4IA 2L2MA 1KJKA 2EM9A 2EMWA 1X6FA 2ENAA 2UUCE 2ODRD 4BC7A 4TUGA 4JI0E 2V85A 2ODRC 2EOFA 2EPXA 4Q28A 1AH5A 3BIDA 4JI5E 2B7TA 2V89A 1IQOA 2EL5A 2LT7A 2EQ0A 2LE2A 1PJSA 1T4LB 3C6KA 4DMIA 2EORA 1F2IG 2UUAE 2EMYA 2YZTA 2ZM6E 1N36E 4DV1E 2LJUA 1HNWE 2EN8A 3T1HE 2MKDA 2NABA 1G2DC 5AE2A 2KHXA
chains in the Genus database with same CATH topology
2L92A 5AASA 5IT9C 2YT4A 2V8QB 3H09A 2VF1A 2RS7A 2N3GA 2VQEE 5DNYA 2L8TA 2JOXA 2JY9A 1DI2A 2UXDE 2G7HA 2UUBE 5IWAE 4WYQB 2NUEA 2K4VA 4DV5E 4BC9A 2VE7C 4X64E 4J8ZA 1XNQE 2MC5A 2F8BA 4M2ZA 2E1MA 5T6JA 3VYYA 4BCAA 4X8WA 1RQ0A 5LMNE 4F9BB 5AE3A 2L2NA 3FIGA 3JAMC 3HXLA 4DR5E 4LFAE 4B3RE 1PKPA 2JWOA 4BBYA 3ADIA 2L33A 2DMYA 1YZ9A 3AV0A 3ZOQB 1SR9A 4JI3E 4LF5E 4JYAE 2MDRA 4X62E 5CFFE 2H36X 3HQ1A 2L6MA 1I94E 2NUFA 2N3HA 2RSMA 2DSYA 4DR3E 4OX9E 2F4VE 3K6QA 2FV4B 3IWDA 4DV4E 1N32E 3ADGA 1IBME 4I8OA 4LF8E 1X48A 4B3ME 4JI1E 4YHHE 4DV6E 2L3JA 1EKZA 2JOBA 4DUZE 4KZSA 3ADLA 2V88A 1UILA 2DB2A 2UU9E 2WZOA 2FTXB 2UXCE 1J26A 2E5LE 4X66E 2KONA 2KHXA 1WXRA 1T4NA 2CPNA 3DF6A 4LU9A 3RMPA 2FGGA 5ADZA 4GKKE 5FLXC 2JVAA 3LMLA 2B3TB 1YYWA 1J5EE 5AE1A 1ZBQA 2LTRA 2EWLA 4WPYA 4GEQB 2VQFE 2L2KB 1RC7A 4BMJA 3P1XA 4DV7E 2V86A 1IBLE 4L5NC 4JI2E 2LMZA 4JV5E 4DV2E 2B7VA 4DKKA 5LMUE 1XMQE 4B3SE 3J80C 4WSPA 3MSWA 2RS6A 3AUZA 4R8OA 4L8NA 3IWBA 2HHHE 4DV3E 4LF4E 2NUGA 4DR4E 4GKJE 1YYOA 2MC6A 3VK6A 1T4OA 4DR6E 4KHPE 4JI4E 1N33E 4K0KE 2LBSB 4LFCE 4M30A 1ZBTA 3F6GA 1HNXE 1O0WA 2B9DA 3HPSA 3OTOE 2EZ6A 2DIXA 3KWRA 2L3CA 4NXME 4NXNE 1X47A 1FKAE 4F54A 4DUYE 1QU6A 3DJWA 5A2QC 4WFTA 4JI6E 2LUQA 1WHQA 4YY3E 3HPZA 4LFBE 3VYXA 2UXBE 4LF9E 5LL6R 2NA2A 2V83A 2JR1A 2RTXA 1N34E 3F6HA 1FJGE 2LTSA 2M4IA 4DR1E 1HNZE 2L2MA 4P7DA 4DV0E 4OOGC 2UUCE 2ODRD 2V87A 4BC7A 4TUGA 4JI0E 4JI8E 2V85A 4F9AB 4DR2E 2ODRC 1STUA 1X49A 4Q28A 4LF7E 1DQ3A 4JI5E 2B7TA 2V89A 3HTXA 1XNRE 3J81C 1WHNA 3C4TA 5F3WA 1UHZA 2LUPB 3JTZA 4LF6E 3C4BA 1XMOE 3ADJA 2LE2A 3IWCA 4R03A 4F9CB 3T1YE 4DR7E 4P78A 2M7QA 3OMLA 5BR8E 4AQYE 4LTYA 1GZ6A 3J7Yp 1T4LB 4DMIA 2UUAE 1GQEA 2M1SA 4M0VA 4X65E 4B3TE 2LRSA 2YZTA 2ZM6E 1N36E 2IHR1 4TUIA 4DV1E 3J7AG 1YYKA 1HNWE 2KOUA 1HR0E 4BS9A 3T1HE 1IBKE 3JU0A 5AE2A 2LJHA 3LLHA 4JI7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KON A; 
#chains in the Genus database with same CATH topology
 1YFH A;  3H09 A;  2VF1 A;  2N3G A;  3EPH A;  5DNY A;  5IWA E;  1JK2 A;  2K4V A;  2JYA A;  4R2Q A;  2NUE A;  1KYQ A;  4X64 E;  1X5W A;  2E1M A;  1A1F A;  4BCA A;  1GTK A;  2DLK A;  5TSE A;  5A6A A;  2DMY A;  4LF5 E;  4X62 E;  5CFF E;  1MGT A;  2NUF A;  2RSM A;  2EMK A;  2EMC A;  3IWD A;  4O4K A;  2EPM X;  1N32 E;  4LF8 E;  3THO B;  1X48 A;  1MEY C;  4WXC A;  4JI1 E;  2EMZ A;  4DV6 E;  2YSO A;  1EKZ A;  4KZS A;  1TN9 A;  2UU9 E;  2GPI A;  2E5L E;  4WXD A;  4F6N A;  4X66 E;  1WXR A;  2CPN A;  4BHB A;  1ZR9 A;  3RMP A;  1A1I A;  2JVA A;  1ZBQ A;  2K7I A;  4WPY A;  2L2K B;  2WBT A;  5AC5 A;  2LMZ A;  2RSI A;  3AUZ A;  4BHC A;  2NUG A;  4GKJ E;  2EN7 A;  1YYO A;  2EM8 A;  2MC6 A;  2EL6 A;  2EPU A;  4DR6 E;  3THN A;  1N33 E;  1IMU A;  1HNX E;  2EML A;  2ENH A;  2WBS A;  2EZ6 A;  3VHT B;  3KWR A;  2L3C A;  1X47 A;  4F54 A;  3DJW A;  5A2Q C;  4LFB E;  2EPK X;  2CT1 A;  1EH6 A;  1ZU1 A;  2V83 A;  1UN6 B;  2RTX A;  3EPK A;  3MHH C;  1UBD C;  2LTS A;  5IV8 B;  3L00 A;  3TQM A;  1QNT A;  4DV0 E;  4OOG C;  5A6J A;  4DR2 E;  2EQ3 A;  1STU A;  1X49 A;  1DQ3 A;  5F3W A;  1AAY A;  4HEI A;  4R2S A;  1XMO E;  4R03 A;  3T1Y E;  5BR8 E;  3J7Y p;  2D9H A;  4M0V A;  3UK3 C;  4WSG A;  2IHR 1;  4TUI A;  2EPZ A;  3KZZ A;  3J7A G;  1EH8 A;  2KOU A;  1HR0 E;  1IBK E;  3JU0 A;  2EM4 A;  4JI7 E;  1SFE A;  2VQF E;  5A6K A;  2YT4 A;  2JPA A;  2ADR A;  2V8Q B;  2EN4 A;  2JOX A;  2G7H A;  2UUB E;  4ZYH A;  2EM6 A;  2YRH A;  4BC9 A;  2VE7 C;  4X9J A;  4J8Z A;  2MC5 A;  2F8B A;  2EMF A;  3VYY A;  1YUI A;  1RQ0 A;  2YTJ A;  3JAM C;  3EPL A;  1T38 A;  4LFA E;  2YTP A;  3ADI A;  5KL2 A;  2L33 A;  1TF3 A;  1YZ9 A;  4ZYD A;  2LCE A;  3ZOQ B;  2MDR A;  2ENC A;  2EOY A;  1PJQ A;  2H36 X;  4OX9 E;  2DSY A;  2YTF A;  2MKN A;  3ADG A;  2BBG A;  2ELY A;  4B3M E;  2EOO A;  2EOZ A;  3ADL A;  4F6M A;  2V88 A;  1UIL A;  2DB2 A;  2WZO A;  2FTX B;  4RHB B;  1J26 A;  3DF6 A;  4LU9 A;  2FGG A;  4MLQ A;  1B69 A;  4GKK E;  4R2R A;  3LML A;  2DRP A;  2EWL A;  2EJ4 A;  1RC7 A;  1A1G A;  5A6B D;  1BB8 A;  4BMJ A;  3P1X A;  2V86 A;  4JI2 E;  4JV5 E;  1BBO A;  2DMI A;  2B7V A;  2A25 A;  2J7J A;  3BBG A;  4DKK A;  5LMU E;  2EN6 A;  2RS6 A;  4L8N A;  4DR4 E;  4NHR A;  3KZY A;  2LBS B;  4LFC E;  4M30 A;  3F6G A;  3HPS A;  1EH7 A;  3OTO E;  5A6B A;  2I9I A;  4IJD A;  1FKA E;  3MHS C;  1QU6 A;  4YY3 E;  2EMH A;  2EOS A;  2YTI A;  3VYX A;  2UXB E;  4O5G A;  5LL6 R;  2JR1 A;  3F6H A;  2EMA A;  2CTD A;  4P7D A;  2V87 A;  4R2P A;  2EPL X;  2EOQ A;  2N8X A;  2EPC A;  1XNR E;  3J81 C;  4LF6 E;  5KL7 A;  1UHZ A;  2HC5 A;  3JTZ A;  2LUP B;  2YTG A;  2R1F A;  3C4B A;  2GLI A;  1X3C A;  2M9A A;  1WRJ A;  4HTG A;  3IWC A;  4DR7 E;  4P78 A;  3OML A;  2MDG A;  2DGC A;  4R2E A;  4B3T E;  2LRS A;  1YYK A;  5KL5 A;  2EL4 A;  4BS9 A;  2E72 A;  2EOE A;  2YTD A;  1X6E A;  2EM2 A;  1DI2 A;  3BGH A;  2UXD E;  2JY9 A;  1YPN A;  2Q8U A;  4DV5 E;  1BBG A;  1YSA C;  1XNQ E;  2JXP A;  5T6J A;  4X8W A;  3BF2 A;  4DR5 E;  5AE3 A;  4B3R E;  3HXL A;  1PKP A;  2JWO A;  3AV0 A;  1SR9 A;  4JYA E;  3HQ1 A;  4ZYG A;  2EN3 A;  2N3H A;  4DR3 E;  3QG5 C;  2F4V E;  2EPO A;  3K6Q A;  4O43 A;  2FV4 B;  2JP9 A;  1NCS A;  2EN2 A;  1IBM E;  2HGH A;  2VRD A;  2JOB A;  4R2C A;  4DUZ E;  5KL3 A;  2UXC E;  5ADZ A;  5FLX C;  2B3T B;  2R76 A;  1J5E E;  5AE1 A;  4ZYE A;  2WCC 3;  1WJP A;  1IBL E;  1TF6 A;  4RH8 A;  4R8O A;  4IS1 C;  4DV3 E;  2EPR A;  1Z1B A;  3VK6 A;  1T4O A;  2EE8 A;  2GHF A;  1JK1 A;  4R2D A;  1ZBT A;  2RPC A;  1PJT A;  2DIX A;  4NXM E;  2WBU A;  2EMX A;  2RQL A;  1P47 A;  1WHQ A;  3HPZ A;  1RMD A;  2NA2 A;  2YTN A;  1N34 E;  1FJG E;  4DR1 E;  1HNZ E;  4N4R B;  1YUJ A;  2DLQ A;  5KL6 A;  4JI8 E;  3EQ1 A;  4F9A B;  2EM5 A;  1A1H A;  4LF7 E;  2EP3 A;  4MLV A;  3HTX A;  1PDA A;  1WHN A;  3C4T A;  2LO3 A;  2EM0 A;  2BB8 A;  3ECR A;  3ADJ A;  4F9C B;  4KWY A;  2EMG A;  2YU5 A;  2M7Q A;  4AQY E;  4LTY A;  1GZ6 A;  4F2J C;  1A1L A;  2EM7 A;  1GQE A;  2M1S A;  4X65 E;  2EN1 A;  1LLM C;  2LJH A;  3LLH A;  4O24 A;  2L92 A;  5AAS A;  5IT9 C;  1T39 A;  2RS7 A;  2VQE E;  2L8T A;  4WYQ B;  2LVH A;  4M2Z A;  2EOM A;  5LMN E;  4F9B B;  2L2N A;  2YWQ A;  3FIG A;  4BBY A;  1NEI A;  3C6M A;  5KL4 A;  4JI3 E;  2HJJ A;  5LLQ A;  2L6M A;  2EOI A;  1IQS A;  1I94 E;  4Q35 B;  2YTQ A;  2EOX A;  4DV4 E;  4I8O A;  2EM3 A;  2PRT A;  4YHH E;  2L3J A;  2YTE A;  2LV2 A;  2YPN A;  1ZAA C;  2ELZ A;  5AC4 A;  2EPA A;  2EMI A;  4M9V C;  2KON A;  1T4N A;  2EMB A;  2I13 A;  4GZN C;  2CSH A;  4NZV A;  2YU8 A;  1A1J A;  2EPN A;  2LTR A;  1YYW A;  1L4S A;  4GEQ B;  2EPP A;  5A69 A;  1X6H A;  4DV7 E;  1A1K A;  4L5N C;  2EOH A;  1G2F C;  4R2A A;  4DV2 E;  1XMQ E;  4B3S E;  3M99 B;  4WSP A;  4FK5 C;  3MSW A;  3J80 C;  3EPJ A;  2EOJ A;  3IWB A;  2HHH E;  2YRM A;  4LF4 E;  4WX9 A;  4KHP E;  2YRK A;  4JI4 E;  4K0K E;  2YSP A;  1O0W A;  2B9D A;  5IXM B;  4NXN E;  4DUY E;  4JI6 E;  4WFT A;  2LUQ A;  2EQ1 A;  4LF9 E;  1N3G A;  1DGC A;  2YTO A;  2M4I A;  2L2M A;  1KJK A;  2EM9 A;  2EMW A;  1X6F A;  2ENA A;  2UUC E;  2ODR D;  4BC7 A;  4TUG A;  4JI0 E;  2V85 A;  2ODR C;  2EOF A;  2EPX A;  4Q28 A;  1AH5 A;  3BID A;  4JI5 E;  2B7T A;  2V89 A;  1IQO A;  2EL5 A;  2LT7 A;  2EQ0 A;  2LE2 A;  1PJS A;  1T4L B;  3C6K A;  4DMI A;  2EOR A;  1F2I G;  2UUA E;  2EMY A;  2YZT A;  2ZM6 E;  1N36 E;  4DV1 E;  2LJU A;  1HNW E;  2EN8 A;  3T1H E;  2MKD A;  2NAB A;  1G2D C;  5AE2 A;  2KHX A; 
#chains in the Genus database with same CATH homology
 2L92 A;  5AAS A;  5IT9 C;  2YT4 A;  2V8Q B;  3H09 A;  2VF1 A;  2RS7 A;  2N3G A;  2VQE E;  5DNY A;  2L8T A;  2JOX A;  2JY9 A;  1DI2 A;  2UXD E;  2G7H A;  2UUB E;  5IWA E;  4WYQ B;  2NUE A;  2K4V A;  4DV5 E;  4BC9 A;  2VE7 C;  4X64 E;  4J8Z A;  1XNQ E;  2MC5 A;  2F8B A;  4M2Z A;  2E1M A;  5T6J A;  3VYY A;  4BCA A;  4X8W A;  1RQ0 A;  5LMN E;  4F9B B;  5AE3 A;  2L2N A;  3FIG A;  3JAM C;  3HXL A;  4DR5 E;  4LFA E;  4B3R E;  1PKP A;  2JWO A;  4BBY A;  3ADI A;  2L33 A;  2DMY A;  1YZ9 A;  3AV0 A;  3ZOQ B;  1SR9 A;  4JI3 E;  4LF5 E;  4JYA E;  2MDR A;  4X62 E;  5CFF E;  2H36 X;  3HQ1 A;  2L6M A;  1I94 E;  2NUF A;  2N3H A;  2RSM A;  2DSY A;  4DR3 E;  4OX9 E;  2F4V E;  3K6Q A;  2FV4 B;  3IWD A;  4DV4 E;  1N32 E;  3ADG A;  1IBM E;  4I8O A;  4LF8 E;  1X48 A;  4B3M E;  4JI1 E;  4YHH E;  4DV6 E;  2L3J A;  1EKZ A;  2JOB A;  4DUZ E;  4KZS A;  3ADL A;  2V88 A;  1UIL A;  2DB2 A;  2UU9 E;  2WZO A;  2FTX B;  2UXC E;  1J26 A;  2E5L E;  4X66 E;  2KON A;  2KHX A;  1WXR A;  1T4N A;  2CPN A;  3DF6 A;  4LU9 A;  3RMP A;  2FGG A;  5ADZ A;  4GKK E;  5FLX C;  2JVA A;  3LML A;  2B3T B;  1YYW A;  1J5E E;  5AE1 A;  1ZBQ A;  2LTR A;  2EWL A;  4WPY A;  4GEQ B;  2VQF E;  2L2K B;  1RC7 A;  4BMJ A;  3P1X A;  4DV7 E;  2V86 A;  1IBL E;  4L5N C;  4JI2 E;  2LMZ A;  4JV5 E;  4DV2 E;  2B7V A;  4DKK A;  5LMU E;  1XMQ E;  4B3S E;  3J80 C;  4WSP A;  3MSW A;  2RS6 A;  3AUZ A;  4R8O A;  4L8N A;  3IWB A;  2HHH E;  4DV3 E;  4LF4 E;  2NUG A;  4DR4 E;  4GKJ E;  1YYO A;  2MC6 A;  3VK6 A;  1T4O A;  4DR6 E;  4KHP E;  4JI4 E;  1N33 E;  4K0K E;  2LBS B;  4LFC E;  4M30 A;  1ZBT A;  3F6G A;  1HNX E;  1O0W A;  2B9D A;  3HPS A;  3OTO E;  2EZ6 A;  2DIX A;  3KWR A;  2L3C A;  4NXM E;  4NXN E;  1X47 A;  1FKA E;  4F54 A;  4DUY E;  1QU6 A;  3DJW A;  5A2Q C;  4WFT A;  4JI6 E;  2LUQ A;  1WHQ A;  4YY3 E;  3HPZ A;  4LFB E;  3VYX A;  2UXB E;  4LF9 E;  5LL6 R;  2NA2 A;  2V83 A;  2JR1 A;  2RTX A;  1N34 E;  3F6H A;  1FJG E;  2LTS A;  2M4I A;  4DR1 E;  1HNZ E;  2L2M A;  4P7D A;  4DV0 E;  4OOG C;  2UUC E;  2ODR D;  2V87 A;  4BC7 A;  4TUG A;  4JI0 E;  4JI8 E;  2V85 A;  4F9A B;  4DR2 E;  2ODR C;  1STU A;  1X49 A;  4Q28 A;  4LF7 E;  1DQ3 A;  4JI5 E;  2B7T A;  2V89 A;  3HTX A;  1XNR E;  3J81 C;  1WHN A;  3C4T A;  5F3W A;  1UHZ A;  2LUP B;  3JTZ A;  4LF6 E;  3C4B A;  1XMO E;  3ADJ A;  2LE2 A;  3IWC A;  4R03 A;  4F9C B;  3T1Y E;  4DR7 E;  4P78 A;  2M7Q A;  3OML A;  5BR8 E;  4AQY E;  4LTY A;  1GZ6 A;  3J7Y p;  1T4L B;  4DMI A;  2UUA E;  1GQE A;  2M1S A;  4M0V A;  4X65 E;  4B3T E;  2LRS A;  2YZT A;  2ZM6 E;  1N36 E;  2IHR 1;  4TUI A;  4DV1 E;  3J7A G;  1YYK A;  1HNW E;  2KOU A;  1HR0 E;  4BS9 A;  3T1H E;  1IBK E;  3JU0 A;  5AE2 A;  2LJH A;  3LLH A;  4JI7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...