1A1KA

Radr (zif268 variant) zinc finger-dna complex (gacc site)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*AP*CP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1kA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1kA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1kA03
2CSHA 2PRTA 1JK2A 2EOSA 2YTIA 2YU8A 2YRMA 2DGCA 2EM9A 2EM3A 5KL5A 2EN4A 3M99B 2LCEA 2MKDA 2EN7A 2LVHA 4R2PA 2CTDA 4IJDA 1TF6A 2WBUA 5KL2A 4FK5C 1A1KA 2DLQA 2DMIA 3MHHC 2BB8A 4R2AA 1TN9A 1WJPA 2EPAA 2EOZA 1Z1BA 2EMHA 2EOQA 2EPCA 2WCC3 2DRPA 1A1GA 1G2DC 1KJKA 2YTQA 3MHSC 1UN6B 3VHTB 2J7JA 2EOJA 2NABA 2LT7A 3EPJA 2MDGA 2EOYA 2YSOA 3UK3C 4M9VC 4R2DA 2EM7A 2LO3A 2RSIA 4WSGA 4R2SA 1ZAAC 2EPPA 2EMYA 2EORA 1A1FA 2I13A 1LLMC 3EPHA 2EN8A 2YRKA 2EOFA 1X3CA 2EMWA 2GHFA 2LV2A 5KL4A 2EQ3A 2EOEA 1ZR9A 2EOOA 1BBOA 2JP9A 2EOXA 1A1IA 2EMCA 2EJ4A 1A1JA 2EPZA 2EMLA 4R2EA 2YTEA 2EQ1A 2ENAA 2EM6A 2YTJA 3EPLA 2ENCA 2JPAA 2EPXA 2EMKA 5KL7A 2D9HA 1BB8A 2EL6A 2WBTA 2EN2A 2YTNA 2YTGA 2M9AA 4GZNC 2YRHA 2ELZA 2YTPA 2EMFA 2YTFA 1ZU1A 2EOIA 2EM0A 2EM2A 2YU5A 1B69A 1YUJA 1DGCA 2YTOA 1YUIA 2EMAA 2RPCA 2EL5A 2EOHA 2EMXA 4F6NA 1X6HA 1X5WA 1X6FA 2EMGA 2WBSA 2EP3A 1NCSA 5KL3A 1P47A 1X6EA 1UBDC 1A1LA 3EPKA 2EPUA 2EE8A 2GLIA 2EMZA 2EM8A 2DLKA 2EMBA 2EN3A 2CT1A 4R2QA 2EOMA 2R1FA 1RMDA 1AAYA 2EPRA 2EQ0A 2EN1A 4X9JA 1JK1A 1G2FC 4F2JC 1F2IG 1YSAC 2A25A 2EM4A 5KL6A 2EN6A 2YSPA 4IS1C 2HGHA 1MEYC 2E72A 4R2RA 4R2CA 2ELYA 2ADRA 4F6MA 2VRDA 2MKNA 2EMIA 2EM5A 1A1HA 1TF3A 2EL4A 2ENHA 2YTDA
chains in the Genus database with same CATH superfamily
4NHRA 4X8WA 2YU8A 4BC9A 2EM9A 3M99B 1EH8A 4BS9A 3F6HA 4GEQB 3ADLA 4WSPA 1T38A 4IJDA 2WBUA 4FK5C 2DLQA 2BB8A 2NA2A 3P1XA 5F3WA 4I8OA 1WJPA 1WHQA 5FLXC 2RTXA 2EMHA 2IHR1 5A69A 2N3GA 1A1GA 1GTKA 4LF5E 1KJKA 4KHPE 4JI7E 2J7JA 5AC5A 2NABA 4ZYGA 2LBSB 3EPJA 4YHHE 2YSOA 3K6QA 5AC4A 4L8NA 4NXNE 2NUEA 4R2DA 3OTOE 3VYYA 1HNXE 1ZAAC 4JYAE 2EPPA 2N3HA 2EORA 3ADIA 3THOB 2DMYA 2L2NA 4BMJA 2EMWA 5A6KA 3DJWA 2EOOA 2M7QA 2EOXA 2EMCA 4JI1E 4LU9A 1YZ9A 2EPZA 3IWBA 2YTEA 2EQ1A 4O5GA 2ENAA 5ADZA 2EM6A 2ODRC 2V86A 2ENCA 2G7HA 4BHBA 1IBME 4YY3E 1BB8A 2YTGA 3IWCA 2ELZA 2HC5A 2YTPA 4OOGC 4JI8E 2L6MA 2YTFA 2LJHA 1YUIA 4B3TE 1DGCA 2YTOA 4DR7E 1IBKE 1KYQA 4DUYE 5A6BA 4F6NA 1X5WA 2VQFE 4DR6E 1NCSA 2V83A 2UUBE 1UBDC 2EMZA 2EM8A 3KZYA 2V89A 4R2QA 2R1FA 1RMDA 1NEIA 2JVAA 3OMLA 3VYXA 2EN1A 4F2JC 2B3TB 3C4TA 2B9DA 1XNRE 5LMUE 4X66E 4R2CA 4GKJE 4B3RE 4X64E 1EH6A 1N3GA 1L4SA 4N4RB 1I94E 2EOSA 1PDAA 2YTIA 4R03A 2DGCA 2F4VE 2EM3A 4JI4E 2EN4A 4ZYHA 2LCEA 4O43A 1QNTA 3RMPA 4DV6E 1TF6A 4F9AB 1A1KA 4DR1E 2L33A 4BC7A 1WXRA 1N33E 1WHNA 4HEIA 2DSYA 2JXPA 2KOUA 3BF2A 2WCC3 4O24A 1HNZE 2EOJA 3IWDA 1DQ3A 3EQ1A 2LT7A 2UU9E 1YYOA 3UK3C 4WSGA 5AE3A 4R2SA 2EMYA 1UILA 4WXDA 2VF1A 5IT9C 2L8TA 4WPYA 1PJTA 2I13A 3C4BA 4DV0E 5LLQA 4B3SE 3HXLA 4DR5E 1DI2A 4LFAE 4RH8A 2LV2A 4BBYA 1HR0E 3HPSA 4JI2E 1A1IA 2EJ4A 4LF4E 2HJJA 4DV5E 4R2EA 2M1SA 5LL6R 3EPLA 2JWOA 1RQ0A 1SR9A 2EPXA 4F9BB 2EL6A 2WBTA 2KHXA 2YRHA 2F8BA 2KONA 1ZU1A 2EM0A 4JI5E 5A6JA 2EMAA 1EH7A 2L92A 2RPCA 5A2QC 4B3ME 4P78A 4DR2E 1GQEA 2LUPB 1ZBQA 1EKZA 3THNA 4F54A 4BCAA 2EPNA 4RHBB 5AE2A 2GLIA 2EMBA 2EN3A 1IQSA 2EOMA 2UXCE 2EQ0A 3L00A 2LUQA 1G2FC 4OX9E 4LFBE 1F2IG 5LMNE 4KWYA 2EN6A 4IS1C 1T4NA 1X48A 2L3JA 3AUZA 1SFEA 2ELYA 2VRDA 3J80C 2EMIA 2JY9A 4LF7E 2CSHA 2UUCE 3QG5C 3J81C 5KL5A 1HNWE 2MKDA 1RC7A 2LVHA 2L2MA 2L3CA 3ADGA 2Q8UA 2MDRA 2RS7A 2DMIA 5BR8E 4LF6E 2EPAA 2LJUA 1Z1BA 3ECRA 2EOQA 2EPCA 2E1MA 3TQMA 3VK6A 2DRPA 4NXME 1G2DC 5TSEA 2YTQA 3MHSC 1J5EE 1UN6B 3C6MA 4L5NC 2YZTA 5DNYA 1J26A 2UXDE 2MDGA 2EOYA 4M9VC 2LO3A 2RSIA 2BBGA 4M30A 1A1FA 5IXMB 3J7Yp 2RS6A 1PJQA 4P7DA 2EN8A 2YRKA 2RSMA 2EOFA 5KL4A 3KZZA 2EQ3A 1IQOA 2DB2A 2EOEA 1XNQE 2JP9A 3JU0A 1A1JA 3FIGA 1YYKA 2ODRD 3LMLA 2JOXA 4DV3E 2EMLA 3HPZA 1T4LB 1FJGE 4K0KE 4M2ZA 2NUFA 3T1HE 4BHCA 4KZSA 2M4IA 2EMKA 3BBGA 4J8ZA 5KL7A 2D9HA 2EN2A 2M9AA 4M0VA 1IMUA 1YYWA 2H36X 1B69A 2EOIA 2YU5A 2EM2A 1YUJA 2RQLA 2JYAA 2EOHA 2V88A 2EMXA 4F9CB 4DV7E 1WRJA 1X47A 1X6FA 1O0WA 2LRSA 2WZOA 4Q35B 4TUGA 2WBSA 2EP3A 2NUGA 1X6EA 1A1LA 2VQEE 2EPUA 1PJSA 4AQYE 2JR1A 2EPLX 4JV5E 1AAYA 2EPRA 4X9JA 1FKAE 3MSWA 3F6GA 2HHHE 4JI0E 2YT4A 2A25A 5KL6A 1PKPA 2ADRA 2EPKX 2FV4B 4DUZE 2CPNA 2EM5A 2LTRA 1TF3A 4ZYEA 4LF8E 4JI6E 4LF9E 2PRTA 1MGTA 1JK2A 2YRMA 1IBLE 5A6BD 1ZBTA 2EN7A 4R2PA 2CTDA 4TUIA 1QU6A 4ZYDA 2B7TA 5KL2A 4DKKA 1N36E 3MHHC 4R2AA 1TN9A 2K4VA 4Q28A 2FGGA 2EOZA 3AV0A 2VE7C 1YPNA 3ADJA 3H09A 2L2KB 3VHTB 3ZOQB 4O4KA 3BIDA 5A6AA 1GZ6A 2EZ6A 4LTYA 4DMIA 2EM7A 2UUAE 3LLHA 2EPMX 2EPOA 1LLMC 2MC5A 5IV8B 2N8XA 5AASA 2K7IA 3EPHA 2V8QB 1X3CA 2GHFA 5CFFE 2B7VA 4NZVA 1ZR9A 1N32E 1BBOA 3C6KA 2DIXA 3JTZA 2I9IA 3J7AG 2GPIA 1XMOE 4WX9A 4DV1E 1T4OA 4MLQA 2YTJA 4WFTA 4GKKE 2JPAA 5T6JA 4MLVA 4DR4E 4WXCA 2LE2A 2V85A 5AE1A 2YTNA 2YPNA 2JOBA 4X65E 4GZNC 3HTXA 1YFHA 3HQ1A 2EMFA 2V87A 2EL5A 4LFCE 1T39A 3T1YE 1X6HA 2YWQA 2EMGA 4JI3E 3KWRA 2LTSA 3BGHA 5KL3A 4DV4E 1P47A 2FTXB 3EPKA 2EE8A 2DLKA 2MC6A 2CT1A 4DR3E 5IWAE 1JK1A 2R76A 1YSAC 1BBGA 2EWLA 2EM4A 2LMZA 4HTGA 2YSPA 4R8OA 2HGHA 1MEYC 2E72A 4R2RA 1X49A 4WYQB 2E5LE 4DV2E 4F6MA 1UHZA 2ZM6E 3DF6A 2MKNA 1XMQE 4X62E 1AH5A 1A1HA 2UXBE 3JAMC 2EL4A 1N34E 2ENHA 2YTDA 1STUA
chains in the Genus database with same CATH topology
2CSHA 2PRTA 1JK2A 2EOSA 2YTIA 2YU8A 2YRMA 2DGCA 2EM9A 2EM3A 5KL5A 2EN4A 3M99B 2LCEA 2MKDA 2EN7A 2LVHA 4R2PA 2CTDA 4IJDA 1TF6A 2WBUA 5KL2A 4FK5C 1A1KA 2DLQA 2DMIA 3MHHC 2BB8A 4R2AA 1TN9A 1WJPA 2EPAA 2EOZA 1Z1BA 2EMHA 2EOQA 2EPCA 2WCC3 2DRPA 1A1GA 1G2DC 1KJKA 2YTQA 3MHSC 1UN6B 3VHTB 2J7JA 2EOJA 2NABA 2LT7A 3EPJA 2MDGA 2EOYA 2YSOA 3UK3C 4M9VC 4R2DA 2EM7A 2LO3A 2RSIA 4WSGA 4R2SA 1ZAAC 2EPPA 2EMYA 2EORA 1A1FA 2I13A 1LLMC 3EPHA 2EN8A 2YRKA 2EOFA 1X3CA 2EMWA 2GHFA 2LV2A 5KL4A 2EQ3A 2EOEA 1ZR9A 2EOOA 1BBOA 2JP9A 2EOXA 1A1IA 2EMCA 2EJ4A 1A1JA 2EPZA 2EMLA 4R2EA 2YTEA 2EQ1A 2ENAA 2EM6A 2YTJA 3EPLA 2ENCA 2JPAA 2EPXA 2EMKA 5KL7A 2D9HA 1BB8A 2EL6A 2WBTA 2EN2A 2YTNA 2YTGA 2M9AA 4GZNC 2YRHA 2ELZA 2YTPA 2EMFA 2YTFA 1ZU1A 2EOIA 2EM0A 2EM2A 2YU5A 1B69A 1YUJA 1DGCA 2YTOA 1YUIA 2EMAA 2RPCA 2EL5A 2EOHA 2EMXA 4F6NA 1X6HA 1X5WA 1X6FA 2EMGA 2WBSA 2EP3A 1NCSA 5KL3A 1P47A 1X6EA 1UBDC 1A1LA 3EPKA 2EPUA 2EE8A 2GLIA 2EMZA 2EM8A 2DLKA 2EMBA 2EN3A 2CT1A 4R2QA 2EOMA 2R1FA 1RMDA 1AAYA 2EPRA 2EQ0A 2EN1A 4X9JA 1JK1A 1G2FC 4F2JC 1F2IG 1YSAC 2A25A 2EM4A 5KL6A 2EN6A 2YSPA 4IS1C 2HGHA 1MEYC 2E72A 4R2RA 4R2CA 2ELYA 2ADRA 4F6MA 2VRDA 2MKNA 2EMIA 2EM5A 1A1HA 1TF3A 2EL4A 2ENHA 2YTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSH A;  2PRT A;  1JK2 A;  2EOS A;  2YTI A;  2YU8 A;  2YRM A;  2DGC A;  2EM9 A;  2EM3 A;  5KL5 A;  2EN4 A;  3M99 B;  2LCE A;  2MKD A;  2EN7 A;  2LVH A;  4R2P A;  2CTD A;  4IJD A;  1TF6 A;  2WBU A;  5KL2 A;  4FK5 C;  1A1K A;  2DLQ A;  2DMI A;  3MHH C;  2BB8 A;  4R2A A;  1TN9 A;  1WJP A;  2EPA A;  2EOZ A;  1Z1B A;  2EMH A;  2EOQ A;  2EPC A;  2WCC 3;  2DRP A;  1A1G A;  1G2D C;  1KJK A;  2YTQ A;  3MHS C;  1UN6 B;  3VHT B;  2J7J A;  2EOJ A;  2NAB A;  2LT7 A;  3EPJ A;  2MDG A;  2EOY A;  2YSO A;  3UK3 C;  4M9V C;  4R2D A;  2EM7 A;  2LO3 A;  2RSI A;  4WSG A;  4R2S A;  1ZAA C;  2EPP A;  2EMY A;  2EOR A;  1A1F A;  2I13 A;  1LLM C;  3EPH A;  2EN8 A;  2YRK A;  2EOF A;  1X3C A;  2EMW A;  2GHF A;  2LV2 A;  5KL4 A;  2EQ3 A;  2EOE A;  1ZR9 A;  2EOO A;  1BBO A;  2JP9 A;  2EOX A;  1A1I A;  2EMC A;  2EJ4 A;  1A1J A;  2EPZ A;  2EML A;  4R2E A;  2YTE A;  2EQ1 A;  2ENA A;  2EM6 A;  2YTJ A;  3EPL A;  2ENC A;  2JPA A;  2EPX A;  2EMK A;  5KL7 A;  2D9H A;  1BB8 A;  2EL6 A;  2WBT A;  2EN2 A;  2YTN A;  2YTG A;  2M9A A;  4GZN C;  2YRH A;  2ELZ A;  2YTP A;  2EMF A;  2YTF A;  1ZU1 A;  2EOI A;  2EM0 A;  2EM2 A;  2YU5 A;  1B69 A;  1YUJ A;  1DGC A;  2YTO A;  1YUI A;  2EMA A;  2RPC A;  2EL5 A;  2EOH A;  2EMX A;  4F6N A;  1X6H A;  1X5W A;  1X6F A;  2EMG A;  2WBS A;  2EP3 A;  1NCS A;  5KL3 A;  1P47 A;  1X6E A;  1UBD C;  1A1L A;  3EPK A;  2EPU A;  2EE8 A;  2GLI A;  2EMZ A;  2EM8 A;  2DLK A;  2EMB A;  2EN3 A;  2CT1 A;  4R2Q A;  2EOM A;  2R1F A;  1RMD A;  1AAY A;  2EPR A;  2EQ0 A;  2EN1 A;  4X9J A;  1JK1 A;  1G2F C;  4F2J C;  1F2I G;  1YSA C;  2A25 A;  2EM4 A;  5KL6 A;  2EN6 A;  2YSP A;  4IS1 C;  2HGH A;  1MEY C;  2E72 A;  4R2R A;  4R2C A;  2ELY A;  2ADR A;  4F6M A;  2VRD A;  2MKN A;  2EMI A;  2EM5 A;  1A1H A;  1TF3 A;  2EL4 A;  2ENH A;  2YTD A; 
#chains in the Genus database with same CATH topology
 4NHR A;  4X8W A;  2YU8 A;  4BC9 A;  2EM9 A;  3M99 B;  1EH8 A;  4BS9 A;  3F6H A;  4GEQ B;  3ADL A;  4WSP A;  1T38 A;  4IJD A;  2WBU A;  4FK5 C;  2DLQ A;  2BB8 A;  2NA2 A;  3P1X A;  5F3W A;  4I8O A;  1WJP A;  1WHQ A;  5FLX C;  2RTX A;  2EMH A;  2IHR 1;  5A69 A;  2N3G A;  1A1G A;  1GTK A;  4LF5 E;  1KJK A;  4KHP E;  4JI7 E;  2J7J A;  5AC5 A;  2NAB A;  4ZYG A;  2LBS B;  3EPJ A;  4YHH E;  2YSO A;  3K6Q A;  5AC4 A;  4L8N A;  4NXN E;  2NUE A;  4R2D A;  3OTO E;  3VYY A;  1HNX E;  1ZAA C;  4JYA E;  2EPP A;  2N3H A;  2EOR A;  3ADI A;  3THO B;  2DMY A;  2L2N A;  4BMJ A;  2EMW A;  5A6K A;  3DJW A;  2EOO A;  2M7Q A;  2EOX A;  2EMC A;  4JI1 E;  4LU9 A;  1YZ9 A;  2EPZ A;  3IWB A;  2YTE A;  2EQ1 A;  4O5G A;  2ENA A;  5ADZ A;  2EM6 A;  2ODR C;  2V86 A;  2ENC A;  2G7H A;  4BHB A;  1IBM E;  4YY3 E;  1BB8 A;  2YTG A;  3IWC A;  2ELZ A;  2HC5 A;  2YTP A;  4OOG C;  4JI8 E;  2L6M A;  2YTF A;  2LJH A;  1YUI A;  4B3T E;  1DGC A;  2YTO A;  4DR7 E;  1IBK E;  1KYQ A;  4DUY E;  5A6B A;  4F6N A;  1X5W A;  2VQF E;  4DR6 E;  1NCS A;  2V83 A;  2UUB E;  1UBD C;  2EMZ A;  2EM8 A;  3KZY A;  2V89 A;  4R2Q A;  2R1F A;  1RMD A;  1NEI A;  2JVA A;  3OML A;  3VYX A;  2EN1 A;  4F2J C;  2B3T B;  3C4T A;  2B9D A;  1XNR E;  5LMU E;  4X66 E;  4R2C A;  4GKJ E;  4B3R E;  4X64 E;  1EH6 A;  1N3G A;  1L4S A;  4N4R B;  1I94 E;  2EOS A;  1PDA A;  2YTI A;  4R03 A;  2DGC A;  2F4V E;  2EM3 A;  4JI4 E;  2EN4 A;  4ZYH A;  2LCE A;  4O43 A;  1QNT A;  3RMP A;  4DV6 E;  1TF6 A;  4F9A B;  1A1K A;  4DR1 E;  2L33 A;  4BC7 A;  1WXR A;  1N33 E;  1WHN A;  4HEI A;  2DSY A;  2JXP A;  2KOU A;  3BF2 A;  2WCC 3;  4O24 A;  1HNZ E;  2EOJ A;  3IWD A;  1DQ3 A;  3EQ1 A;  2LT7 A;  2UU9 E;  1YYO A;  3UK3 C;  4WSG A;  5AE3 A;  4R2S A;  2EMY A;  1UIL A;  4WXD A;  2VF1 A;  5IT9 C;  2L8T A;  4WPY A;  1PJT A;  2I13 A;  3C4B A;  4DV0 E;  5LLQ A;  4B3S E;  3HXL A;  4DR5 E;  1DI2 A;  4LFA E;  4RH8 A;  2LV2 A;  4BBY A;  1HR0 E;  3HPS A;  4JI2 E;  1A1I A;  2EJ4 A;  4LF4 E;  2HJJ A;  4DV5 E;  4R2E A;  2M1S A;  5LL6 R;  3EPL A;  2JWO A;  1RQ0 A;  1SR9 A;  2EPX A;  4F9B B;  2EL6 A;  2WBT A;  2KHX A;  2YRH A;  2F8B A;  2KON A;  1ZU1 A;  2EM0 A;  4JI5 E;  5A6J A;  2EMA A;  1EH7 A;  2L92 A;  2RPC A;  5A2Q C;  4B3M E;  4P78 A;  4DR2 E;  1GQE A;  2LUP B;  1ZBQ A;  1EKZ A;  3THN A;  4F54 A;  4BCA A;  2EPN A;  4RHB B;  5AE2 A;  2GLI A;  2EMB A;  2EN3 A;  1IQS A;  2EOM A;  2UXC E;  2EQ0 A;  3L00 A;  2LUQ A;  1G2F C;  4OX9 E;  4LFB E;  1F2I G;  5LMN E;  4KWY A;  2EN6 A;  4IS1 C;  1T4N A;  1X48 A;  2L3J A;  3AUZ A;  1SFE A;  2ELY A;  2VRD A;  3J80 C;  2EMI A;  2JY9 A;  4LF7 E;  2CSH A;  2UUC E;  3QG5 C;  3J81 C;  5KL5 A;  1HNW E;  2MKD A;  1RC7 A;  2LVH A;  2L2M A;  2L3C A;  3ADG A;  2Q8U A;  2MDR A;  2RS7 A;  2DMI A;  5BR8 E;  4LF6 E;  2EPA A;  2LJU A;  1Z1B A;  3ECR A;  2EOQ A;  2EPC A;  2E1M A;  3TQM A;  3VK6 A;  2DRP A;  4NXM E;  1G2D C;  5TSE A;  2YTQ A;  3MHS C;  1J5E E;  1UN6 B;  3C6M A;  4L5N C;  2YZT A;  5DNY A;  1J26 A;  2UXD E;  2MDG A;  2EOY A;  4M9V C;  2LO3 A;  2RSI A;  2BBG A;  4M30 A;  1A1F A;  5IXM B;  3J7Y p;  2RS6 A;  1PJQ A;  4P7D A;  2EN8 A;  2YRK A;  2RSM A;  2EOF A;  5KL4 A;  3KZZ A;  2EQ3 A;  1IQO A;  2DB2 A;  2EOE A;  1XNQ E;  2JP9 A;  3JU0 A;  1A1J A;  3FIG A;  1YYK A;  2ODR D;  3LML A;  2JOX A;  4DV3 E;  2EML A;  3HPZ A;  1T4L B;  1FJG E;  4K0K E;  4M2Z A;  2NUF A;  3T1H E;  4BHC A;  4KZS A;  2M4I A;  2EMK A;  3BBG A;  4J8Z A;  5KL7 A;  2D9H A;  2EN2 A;  2M9A A;  4M0V A;  1IMU A;  1YYW A;  2H36 X;  1B69 A;  2EOI A;  2YU5 A;  2EM2 A;  1YUJ A;  2RQL A;  2JYA A;  2EOH A;  2V88 A;  2EMX A;  4F9C B;  4DV7 E;  1WRJ A;  1X47 A;  1X6F A;  1O0W A;  2LRS A;  2WZO A;  4Q35 B;  4TUG A;  2WBS A;  2EP3 A;  2NUG A;  1X6E A;  1A1L A;  2VQE E;  2EPU A;  1PJS A;  4AQY E;  2JR1 A;  2EPL X;  4JV5 E;  1AAY A;  2EPR A;  4X9J A;  1FKA E;  3MSW A;  3F6G A;  2HHH E;  4JI0 E;  2YT4 A;  2A25 A;  5KL6 A;  1PKP A;  2ADR A;  2EPK X;  2FV4 B;  4DUZ E;  2CPN A;  2EM5 A;  2LTR A;  1TF3 A;  4ZYE A;  4LF8 E;  4JI6 E;  4LF9 E;  2PRT A;  1MGT A;  1JK2 A;  2YRM A;  1IBL E;  5A6B D;  1ZBT A;  2EN7 A;  4R2P A;  2CTD A;  4TUI A;  1QU6 A;  4ZYD A;  2B7T A;  5KL2 A;  4DKK A;  1N36 E;  3MHH C;  4R2A A;  1TN9 A;  2K4V A;  4Q28 A;  2FGG A;  2EOZ A;  3AV0 A;  2VE7 C;  1YPN A;  3ADJ A;  3H09 A;  2L2K B;  3VHT B;  3ZOQ B;  4O4K A;  3BID A;  5A6A A;  1GZ6 A;  2EZ6 A;  4LTY A;  4DMI A;  2EM7 A;  2UUA E;  3LLH A;  2EPM X;  2EPO A;  1LLM C;  2MC5 A;  5IV8 B;  2N8X A;  5AAS A;  2K7I A;  3EPH A;  2V8Q B;  1X3C A;  2GHF A;  5CFF E;  2B7V A;  4NZV A;  1ZR9 A;  1N32 E;  1BBO A;  3C6K A;  2DIX A;  3JTZ A;  2I9I A;  3J7A G;  2GPI A;  1XMO E;  4WX9 A;  4DV1 E;  1T4O A;  4MLQ A;  2YTJ A;  4WFT A;  4GKK E;  2JPA A;  5T6J A;  4MLV A;  4DR4 E;  4WXC A;  2LE2 A;  2V85 A;  5AE1 A;  2YTN A;  2YPN A;  2JOB A;  4X65 E;  4GZN C;  3HTX A;  1YFH A;  3HQ1 A;  2EMF A;  2V87 A;  2EL5 A;  4LFC E;  1T39 A;  3T1Y E;  1X6H A;  2YWQ A;  2EMG A;  4JI3 E;  3KWR A;  2LTS A;  3BGH A;  5KL3 A;  4DV4 E;  1P47 A;  2FTX B;  3EPK A;  2EE8 A;  2DLK A;  2MC6 A;  2CT1 A;  4DR3 E;  5IWA E;  1JK1 A;  2R76 A;  1YSA C;  1BBG A;  2EWL A;  2EM4 A;  2LMZ A;  4HTG A;  2YSP A;  4R8O A;  2HGH A;  1MEY C;  2E72 A;  4R2R A;  1X49 A;  4WYQ B;  2E5L E;  4DV2 E;  4F6M A;  1UHZ A;  2ZM6 E;  3DF6 A;  2MKN A;  1XMQ E;  4X62 E;  1AH5 A;  1A1H A;  2UXB E;  3JAM C;  2EL4 A;  1N34 E;  2ENH A;  2YTD A;  1STU A; 
#chains in the Genus database with same CATH homology
 2CSH A;  2PRT A;  1JK2 A;  2EOS A;  2YTI A;  2YU8 A;  2YRM A;  2DGC A;  2EM9 A;  2EM3 A;  5KL5 A;  2EN4 A;  3M99 B;  2LCE A;  2MKD A;  2EN7 A;  2LVH A;  4R2P A;  2CTD A;  4IJD A;  1TF6 A;  2WBU A;  5KL2 A;  4FK5 C;  1A1K A;  2DLQ A;  2DMI A;  3MHH C;  2BB8 A;  4R2A A;  1TN9 A;  1WJP A;  2EPA A;  2EOZ A;  1Z1B A;  2EMH A;  2EOQ A;  2EPC A;  2WCC 3;  2DRP A;  1A1G A;  1G2D C;  1KJK A;  2YTQ A;  3MHS C;  1UN6 B;  3VHT B;  2J7J A;  2EOJ A;  2NAB A;  2LT7 A;  3EPJ A;  2MDG A;  2EOY A;  2YSO A;  3UK3 C;  4M9V C;  4R2D A;  2EM7 A;  2LO3 A;  2RSI A;  4WSG A;  4R2S A;  1ZAA C;  2EPP A;  2EMY A;  2EOR A;  1A1F A;  2I13 A;  1LLM C;  3EPH A;  2EN8 A;  2YRK A;  2EOF A;  1X3C A;  2EMW A;  2GHF A;  2LV2 A;  5KL4 A;  2EQ3 A;  2EOE A;  1ZR9 A;  2EOO A;  1BBO A;  2JP9 A;  2EOX A;  1A1I A;  2EMC A;  2EJ4 A;  1A1J A;  2EPZ A;  2EML A;  4R2E A;  2YTE A;  2EQ1 A;  2ENA A;  2EM6 A;  2YTJ A;  3EPL A;  2ENC A;  2JPA A;  2EPX A;  2EMK A;  5KL7 A;  2D9H A;  1BB8 A;  2EL6 A;  2WBT A;  2EN2 A;  2YTN A;  2YTG A;  2M9A A;  4GZN C;  2YRH A;  2ELZ A;  2YTP A;  2EMF A;  2YTF A;  1ZU1 A;  2EOI A;  2EM0 A;  2EM2 A;  2YU5 A;  1B69 A;  1YUJ A;  1DGC A;  2YTO A;  1YUI A;  2EMA A;  2RPC A;  2EL5 A;  2EOH A;  2EMX A;  4F6N A;  1X6H A;  1X5W A;  1X6F A;  2EMG A;  2WBS A;  2EP3 A;  1NCS A;  5KL3 A;  1P47 A;  1X6E A;  1UBD C;  1A1L A;  3EPK A;  2EPU A;  2EE8 A;  2GLI A;  2EMZ A;  2EM8 A;  2DLK A;  2EMB A;  2EN3 A;  2CT1 A;  4R2Q A;  2EOM A;  2R1F A;  1RMD A;  1AAY A;  2EPR A;  2EQ0 A;  2EN1 A;  4X9J A;  1JK1 A;  1G2F C;  4F2J C;  1F2I G;  1YSA C;  2A25 A;  2EM4 A;  5KL6 A;  2EN6 A;  2YSP A;  4IS1 C;  2HGH A;  1MEY C;  2E72 A;  4R2R A;  4R2C A;  2ELY A;  2ADR A;  4F6M A;  2VRD A;  2MKN A;  2EMI A;  2EM5 A;  1A1H A;  1TF3 A;  2EL4 A;  2ENH A;  2YTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...