1A1KA

Radr (zif268 variant) zinc finger-dna complex (gacc site)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*AP*CP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1kA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1kA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1kA03
2LVHA 2YTIA 2EQ3A 2GLIA 2RPCA 1AAYA 2EOFA 3EPJA 2EOIA 1JK1A 2YRMA 4X9JA 2EOSA 1X6HA 1MEYC 2EOYA 2YTNA 4WSGA 4R2QA 4F6MA 3UK3C 3EPHA 1TF3A 2YTPA 5KL6A 2EPPA 5KL4A 2YTDA 1A1KA 2CSHA 2EMGA 2DRPA 2EN6A 2ELZA 2EOHA 2EN3A 4IJDA 1G2FC 2EM6A 2EN8A 2DMIA 1A1GA 2I13A 2R1FA 1Z1BA 1NCSA 2EPRA 2RSIA 2EMHA 2LV2A 1YUIA 2BB8A 2YTJA 2EMWA 2EPUA 2CTDA 4R2SA 1JK2A 2EMIA 1BB8A 4R2CA 2EMZA 5KL3A 2YRHA 2WCC3 3EPKA 2EQ0A 4FK5C 1UN6B 2EPZA 2YTFA 2EMKA 5KL5A 4R2DA 4F2JC 2DLKA 2YSOA 2NABA 2EOJA 2YRKA 2GHFA 1P47A 2EM5A 2EJ4A 5KL2A 2EPXA 5KL7A 1A1IA 3MHSC 1RMDA 2EPAA 1X3CA 1TN9A 1A1LA 1A1HA 2YTQA 1X5WA 2EMYA 2VRDA 4F6NA 2YTGA 1TF6A 1YUJA 2DGCA 4M9VC 2WBTA 3M99B 1X6FA 2ENCA 1F2IG 1YSAC 1LLMC 2EMLA 2EM3A 4R2PA 4IS1C 3VHTB 2YTEA 2EMCA 2EOOA 2EM2A 2EL4A 1WJPA 2EMAA 2JP9A 2YU8A 2EN7A 2HGHA 2EOQA 2EM9A 2CT1A 2EMBA 2EN1A 2M9AA 2EN4A 2EL6A 4R2RA 2A25A 2EM8A 2J7JA 2EL5A 3MHHC 2EMFA 2ELYA 2EORA 2DLQA 1ZU1A 2MKNA 2ENAA 1G2DC 1ZAAC 2PRTA 2EOEA 2EM4A 2WBUA 2EPCA 2EE8A 2MKDA 1A1JA 2ENHA 2EOZA 2EP3A 2WBSA 2YSPA 3EPLA 2EMXA 2JPAA 1KJKA 2D9HA 2EM7A 1UBDC 2EOMA 2EQ1A 4R2EA 1BBOA 2LO3A 2EOXA 2YTOA 1B69A 2MDGA 1A1FA 2EM0A 1ZR9A 1X6EA 2E72A 2ADRA 2LT7A 2YU5A 4R2AA 4GZNC 2LCEA 1DGCA 2EN2A
chains in the Genus database with same CATH superfamily
5AE2A 4WPYA 3ADJA 3EPJA 1JK1A 4LFBE 5AC5A 2HC5A 2EOSA 1X6HA 1PJQA 1N3GA 4R2QA 3UK3C 2YPNA 4RHBB 3ADLA 2NA2A 3P1XA 5KL6A 3J7Yp 1QNTA 2DRPA 2HJJA 2N8XA 1N33E 1DQ3A 4Q28A 3JTZA 5A69A 2EMWA 1BB8A 2VQFE 1O0WA 4JV5E 5KL3A 4I8OA 2WCC3 4WXDA 4LF7E 1BBGA 3C4TA 2EPZA 2NUFA 2RS7A 2EMKA 1NEIA 5BR8E 4F2JC 2DLKA 2EPKX 2YRKA 5KL2A 2EPXA 3MHSC 1RMDA 4DV4E 2UXDE 2ODRD 1X3CA 4JI3E 4DR6E 3AV0A 1XMOE 1TF6A 1YUJA 1ZBQA 1YZ9A 3DF6A 4LU9A 5AE3A 4P7DA 2EM3A 5A6BA 4R2PA 3VHTB 3BBGA 2EM2A 5AASA 3OMLA 2HGHA 2EOQA 3VK6A 4O5GA 2EN1A 2M9AA 2NUGA 1X47A 2EL6A 2A25A 2EM8A 1T38A 4LF4E 5IXMB 2RQLA 1STUA 3L00A 3C6KA 4JYAE 3MHHC 1WRJA 2JY9A 2VF1A 2MKNA 2CPNA 2ENAA 4R8OA 1ZAAC 4X66E 2PRTA 4NXME 5LMUE 4JI6E 2DIXA 4OX9E 4NZVA 2M4IA 2EE8A 2MKDA 1A1JA 4N4RB 3EQ1A 2YSPA 2EZ6A 2JPAA 2GPIA 3F6HA 2EOMA 1YPNA 1N32E 2G7HA 4LTYA 4BC7A 3HQ1A 4BBYA 3J81C 1A1FA 2E72A 4ZYGA 2LT7A 1SR9A 2IHR1 1FJGE 2LVHA 2EPNA 5A6BD 2LBSB 4DR2E 2GLIA 1AAYA 4Q35B 2DSYA 3HTXA 4B3TE 1J26A 3VYXA 2EOYA 1QU6A 2JOXA 2YTNA 4WSGA 3EPHA 1YYWA 5FLXC 4F9BB 3IWBA 2JXPA 1HNXE 1SFEA 2ELZA 2VE7C 1KYQA 1IMUA 2V87A 5IT9C 1G2FC 2EM6A 1IQOA 2LTSA 2EN8A 2DMIA 2Q8UA 2R1FA 1NCSA 2EMHA 1YUIA 2BB8A 2CTDA 2JVAA 1WXRA 4BS9A 4FK5C 5LMNE 3VYYA 4MLVA 3JU0A 3IWCA 5IV8B 4K0KE 2KHXA 4DR3E 2GHFA 4DR7E 2BBGA 5A6AA 1AH5A 1TN9A 1PKPA 1A1HA 1T39A 4ZYHA 4B3ME 2YTQA 2EMYA 2LUPB 2VRDA 2YTGA 2LJHA 2L3JA 1XNRE 2KOUA 5AE1A 1X6FA 2VQEE 1YSAC 4JI8E 2EMLA 4GKKE 1WJPA 2EMAA 4GKJE 2L2KB 2B3TB 2EN4A 4BHBA 1DI2A 4WFTA 4B3RE 3KZYA 2LMZA 5F3WA 4DV6E 4OOGC 5T6JA 2EORA 4JI4E 3KZZA 1G2DC 2EOEA 2WBUA 2EPCA 2ENHA 3BF2A 1T4LB 4GEQB 3EPLA 4AQYE 2R76A 2D9HA 2M1SA 2EPMX 4LFAE 2EQ1A 1PJSA 2LO3A 4X65E 1EKZA 1BBOA 2E1MA 4HTGA 1EH8A 2MDGA 1XMQE 2EWLA 1ZR9A 2V83A 4F9CB 1RC7A 2V88A 1RQ0A 2YU5A 4GZNC 2LCEA 1PJTA 4DV7E 2YTIA 2RPCA 2LUQA 1YYKA 4JI0E 1GZ6A 2EOFA 4X9JA 3HPSA 1MEYC 4F6MA 4M30A 1MGTA 1TF3A 2EPPA 5KL4A 2N3GA 1WHNA 2CSHA 2EN6A 2EOHA 4DUZE 4IJDA 2EN3A 4JI7E 2V8QB 3IWDA 4NHRA 2I13A 4BCAA 1Z1BA 4WYQB 2EPRA 2JR1A 2UUCE 2LV2A 2EPUA 3J80C 4M0VA 2B7VA 2K7IA 2YRHA 3C6MA 1FKAE 4BMJA 4LF6E 2JOBA 2EQ0A 1UN6B 3QG5C 2EPOA 5KL5A 4R2DA 2YSOA 2NABA 2EOJA 4YHHE 1A1IA 2EJ4A 5KL7A 3K6QA 5A2QC 2V86A 3DJWA 2EPAA 1GTKA 2UXCE 4JI1E 5ADZA 4F9AB 4O4KA 1X5WA 2YZTA 4F6NA 3H09A 2YT4A 5CFFE 2DGCA 4M9VC 1X49A 4DR1E 3BIDA 1N36E 2LE2A 3FIGA 3ADGA 5IWAE 1IBKE 2EMCA 4O43A 2EL4A 4L5NC 2YU8A 1YYOA 1WHQA 2K4VA 3THNA 2EM9A 2EMBA 3THOB 4R2RA 2H36X 5TSEA 5A6KA 3BGHA 4LF5E 2I9IA 2L8TA 4R03A 3C4BA 2DLQA 4O24A 4KZSA 3LLHA 3JAMC 1HR0E 4KWYA 2EM4A 3HPZA 1J5EE 2EOZA 2EP3A 2E5LE 2WBSA 2EMXA 1KJKA 5AC4A 2EM7A 4JI5E 2WZOA 4R2EA 3ECRA 2EOXA 2F8BA 2L2NA 4X8WA 3HXLA 4M2ZA 2EM0A 1X48A 1X6EA 3MSWA 2ADRA 2MDRA 4X64E 4R2AA 2M7QA 2JWOA 2NUEA 2LTRA 2EN2A 2ODRC 4DV1E 2EQ3A 2LRSA 2EOIA 2YRMA 4WXCA 4BC9A 4B3SE 2L33A 2RS6A 4RH8A 3OTOE 4P78A 4LFCE 3F6GA 1IBLE 2YTPA 3LMLA 2YTDA 1A1KA 2UUAE 2EMGA 2JYAA 2UU9E 1T4OA 2EPLX 3RMPA 2FTXB 4DV0E 2MC5A 4DR4E 2KONA 1A1GA 5A6JA 4LF8E 2RSIA 1I94E 2YTJA 4R2SA 1JK2A 2EMIA 2L2MA 2RTXA 4R2CA 1ZBTA 2EMZA 2L3CA 3EPKA 2B9DA 2YTFA 1UILA 4TUGA 2B7TA 3TQMA 1P47A 2EM5A 1HNWE 4F54A 1A1LA 3T1YE 1EH6A 1N34E 4DR5E 4ZYEA 2UUBE 2F4VE 4HEIA 2MC6A 2WBTA 3M99B 4WSPA 2YWQA 2ENCA 1F2IG 4DV2E 1LLMC 4IS1C 2YTEA 2HHHE 2EOOA 2DB2A 2LJUA 1IQSA 4DKKA 2JP9A 1EH7A 2EN7A 5LL6R 4JI2E 4LF9E 2CT1A 4BHCA 1PDAA 1IBME 1UHZA 3T1HE 1HNZE 4J8ZA 2V85A 4YY3E 2DMYA 5LLQA 2J7JA 4TUIA 3AUZA 4DV3E 2EL5A 3J7AG 2EMFA 2ELYA 1YFHA 2FV4B 2UXBE 2ZM6E 1ZU1A 1XNQE 1GQEA 4NXNE 4X62E 4DV5E 5DNYA 2L92A 2RSMA 4DUYE 1L4SA 4L8NA 1T4NA 1UBDC 2YTOA 1B69A 2V89A 2L6MA 3ZOQB 2N3HA 4ZYDA 4MLQA 4DMIA 4WX9A 3ADIA 3KWRA 2FGGA 4KHPE 1DGCA
chains in the Genus database with same CATH topology
2LVHA 2YTIA 2EQ3A 2GLIA 2RPCA 1AAYA 2EOFA 3EPJA 2EOIA 1JK1A 2YRMA 4X9JA 2EOSA 1X6HA 1MEYC 2EOYA 2YTNA 4WSGA 4R2QA 4F6MA 3UK3C 3EPHA 1TF3A 2YTPA 5KL6A 2EPPA 5KL4A 2YTDA 1A1KA 2CSHA 2EMGA 2DRPA 2EN6A 2ELZA 2EOHA 2EN3A 4IJDA 1G2FC 2EM6A 2EN8A 2DMIA 1A1GA 2I13A 2R1FA 1Z1BA 1NCSA 2EPRA 2RSIA 2EMHA 2LV2A 1YUIA 2BB8A 2YTJA 2EMWA 2EPUA 2CTDA 4R2SA 1JK2A 2EMIA 1BB8A 4R2CA 2EMZA 5KL3A 2YRHA 2WCC3 3EPKA 2EQ0A 4FK5C 1UN6B 2EPZA 2YTFA 2EMKA 5KL5A 4R2DA 4F2JC 2DLKA 2YSOA 2NABA 2EOJA 2YRKA 2GHFA 1P47A 2EM5A 2EJ4A 5KL2A 2EPXA 5KL7A 1A1IA 3MHSC 1RMDA 2EPAA 1X3CA 1TN9A 1A1LA 1A1HA 2YTQA 1X5WA 2EMYA 2VRDA 4F6NA 2YTGA 1TF6A 1YUJA 2DGCA 4M9VC 2WBTA 3M99B 1X6FA 2ENCA 1F2IG 1YSAC 1LLMC 2EMLA 2EM3A 4R2PA 4IS1C 3VHTB 2YTEA 2EMCA 2EOOA 2EM2A 2EL4A 1WJPA 2EMAA 2JP9A 2YU8A 2EN7A 2HGHA 2EOQA 2EM9A 2CT1A 2EMBA 2EN1A 2M9AA 2EN4A 2EL6A 4R2RA 2A25A 2EM8A 2J7JA 2EL5A 3MHHC 2EMFA 2ELYA 2EORA 2DLQA 1ZU1A 2MKNA 2ENAA 1G2DC 1ZAAC 2PRTA 2EOEA 2EM4A 2WBUA 2EPCA 2EE8A 2MKDA 1A1JA 2ENHA 2EOZA 2EP3A 2WBSA 2YSPA 3EPLA 2EMXA 2JPAA 1KJKA 2D9HA 2EM7A 1UBDC 2EOMA 2EQ1A 4R2EA 1BBOA 2LO3A 2EOXA 2YTOA 1B69A 2MDGA 1A1FA 2EM0A 1ZR9A 1X6EA 2E72A 2ADRA 2LT7A 2YU5A 4R2AA 4GZNC 2LCEA 1DGCA 2EN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVH A;  2YTI A;  2EQ3 A;  2GLI A;  2RPC A;  1AAY A;  2EOF A;  3EPJ A;  2EOI A;  1JK1 A;  2YRM A;  4X9J A;  2EOS A;  1X6H A;  1MEY C;  2EOY A;  2YTN A;  4WSG A;  4R2Q A;  4F6M A;  3UK3 C;  3EPH A;  1TF3 A;  2YTP A;  5KL6 A;  2EPP A;  5KL4 A;  2YTD A;  1A1K A;  2CSH A;  2EMG A;  2DRP A;  2EN6 A;  2ELZ A;  2EOH A;  2EN3 A;  4IJD A;  1G2F C;  2EM6 A;  2EN8 A;  2DMI A;  1A1G A;  2I13 A;  2R1F A;  1Z1B A;  1NCS A;  2EPR A;  2RSI A;  2EMH A;  2LV2 A;  1YUI A;  2BB8 A;  2YTJ A;  2EMW A;  2EPU A;  2CTD A;  4R2S A;  1JK2 A;  2EMI A;  1BB8 A;  4R2C A;  2EMZ A;  5KL3 A;  2YRH A;  2WCC 3;  3EPK A;  2EQ0 A;  4FK5 C;  1UN6 B;  2EPZ A;  2YTF A;  2EMK A;  5KL5 A;  4R2D A;  4F2J C;  2DLK A;  2YSO A;  2NAB A;  2EOJ A;  2YRK A;  2GHF A;  1P47 A;  2EM5 A;  2EJ4 A;  5KL2 A;  2EPX A;  5KL7 A;  1A1I A;  3MHS C;  1RMD A;  2EPA A;  1X3C A;  1TN9 A;  1A1L A;  1A1H A;  2YTQ A;  1X5W A;  2EMY A;  2VRD A;  4F6N A;  2YTG A;  1TF6 A;  1YUJ A;  2DGC A;  4M9V C;  2WBT A;  3M99 B;  1X6F A;  2ENC A;  1F2I G;  1YSA C;  1LLM C;  2EML A;  2EM3 A;  4R2P A;  4IS1 C;  3VHT B;  2YTE A;  2EMC A;  2EOO A;  2EM2 A;  2EL4 A;  1WJP A;  2EMA A;  2JP9 A;  2YU8 A;  2EN7 A;  2HGH A;  2EOQ A;  2EM9 A;  2CT1 A;  2EMB A;  2EN1 A;  2M9A A;  2EN4 A;  2EL6 A;  4R2R A;  2A25 A;  2EM8 A;  2J7J A;  2EL5 A;  3MHH C;  2EMF A;  2ELY A;  2EOR A;  2DLQ A;  1ZU1 A;  2MKN A;  2ENA A;  1G2D C;  1ZAA C;  2PRT A;  2EOE A;  2EM4 A;  2WBU A;  2EPC A;  2EE8 A;  2MKD A;  1A1J A;  2ENH A;  2EOZ A;  2EP3 A;  2WBS A;  2YSP A;  3EPL A;  2EMX A;  2JPA A;  1KJK A;  2D9H A;  2EM7 A;  1UBD C;  2EOM A;  2EQ1 A;  4R2E A;  1BBO A;  2LO3 A;  2EOX A;  2YTO A;  1B69 A;  2MDG A;  1A1F A;  2EM0 A;  1ZR9 A;  1X6E A;  2E72 A;  2ADR A;  2LT7 A;  2YU5 A;  4R2A A;  4GZN C;  2LCE A;  1DGC A;  2EN2 A; 
#chains in the Genus database with same CATH topology
 5AE2 A;  4WPY A;  3ADJ A;  3EPJ A;  1JK1 A;  4LFB E;  5AC5 A;  2HC5 A;  2EOS A;  1X6H A;  1PJQ A;  1N3G A;  4R2Q A;  3UK3 C;  2YPN A;  4RHB B;  3ADL A;  2NA2 A;  3P1X A;  5KL6 A;  3J7Y p;  1QNT A;  2DRP A;  2HJJ A;  2N8X A;  1N33 E;  1DQ3 A;  4Q28 A;  3JTZ A;  5A69 A;  2EMW A;  1BB8 A;  2VQF E;  1O0W A;  4JV5 E;  5KL3 A;  4I8O A;  2WCC 3;  4WXD A;  4LF7 E;  1BBG A;  3C4T A;  2EPZ A;  2NUF A;  2RS7 A;  2EMK A;  1NEI A;  5BR8 E;  4F2J C;  2DLK A;  2EPK X;  2YRK A;  5KL2 A;  2EPX A;  3MHS C;  1RMD A;  4DV4 E;  2UXD E;  2ODR D;  1X3C A;  4JI3 E;  4DR6 E;  3AV0 A;  1XMO E;  1TF6 A;  1YUJ A;  1ZBQ A;  1YZ9 A;  3DF6 A;  4LU9 A;  5AE3 A;  4P7D A;  2EM3 A;  5A6B A;  4R2P A;  3VHT B;  3BBG A;  2EM2 A;  5AAS A;  3OML A;  2HGH A;  2EOQ A;  3VK6 A;  4O5G A;  2EN1 A;  2M9A A;  2NUG A;  1X47 A;  2EL6 A;  2A25 A;  2EM8 A;  1T38 A;  4LF4 E;  5IXM B;  2RQL A;  1STU A;  3L00 A;  3C6K A;  4JYA E;  3MHH C;  1WRJ A;  2JY9 A;  2VF1 A;  2MKN A;  2CPN A;  2ENA A;  4R8O A;  1ZAA C;  4X66 E;  2PRT A;  4NXM E;  5LMU E;  4JI6 E;  2DIX A;  4OX9 E;  4NZV A;  2M4I A;  2EE8 A;  2MKD A;  1A1J A;  4N4R B;  3EQ1 A;  2YSP A;  2EZ6 A;  2JPA A;  2GPI A;  3F6H A;  2EOM A;  1YPN A;  1N32 E;  2G7H A;  4LTY A;  4BC7 A;  3HQ1 A;  4BBY A;  3J81 C;  1A1F A;  2E72 A;  4ZYG A;  2LT7 A;  1SR9 A;  2IHR 1;  1FJG E;  2LVH A;  2EPN A;  5A6B D;  2LBS B;  4DR2 E;  2GLI A;  1AAY A;  4Q35 B;  2DSY A;  3HTX A;  4B3T E;  1J26 A;  3VYX A;  2EOY A;  1QU6 A;  2JOX A;  2YTN A;  4WSG A;  3EPH A;  1YYW A;  5FLX C;  4F9B B;  3IWB A;  2JXP A;  1HNX E;  1SFE A;  2ELZ A;  2VE7 C;  1KYQ A;  1IMU A;  2V87 A;  5IT9 C;  1G2F C;  2EM6 A;  1IQO A;  2LTS A;  2EN8 A;  2DMI A;  2Q8U A;  2R1F A;  1NCS A;  2EMH A;  1YUI A;  2BB8 A;  2CTD A;  2JVA A;  1WXR A;  4BS9 A;  4FK5 C;  5LMN E;  3VYY A;  4MLV A;  3JU0 A;  3IWC A;  5IV8 B;  4K0K E;  2KHX A;  4DR3 E;  2GHF A;  4DR7 E;  2BBG A;  5A6A A;  1AH5 A;  1TN9 A;  1PKP A;  1A1H A;  1T39 A;  4ZYH A;  4B3M E;  2YTQ A;  2EMY A;  2LUP B;  2VRD A;  2YTG A;  2LJH A;  2L3J A;  1XNR E;  2KOU A;  5AE1 A;  1X6F A;  2VQE E;  1YSA C;  4JI8 E;  2EML A;  4GKK E;  1WJP A;  2EMA A;  4GKJ E;  2L2K B;  2B3T B;  2EN4 A;  4BHB A;  1DI2 A;  4WFT A;  4B3R E;  3KZY A;  2LMZ A;  5F3W A;  4DV6 E;  4OOG C;  5T6J A;  2EOR A;  4JI4 E;  3KZZ A;  1G2D C;  2EOE A;  2WBU A;  2EPC A;  2ENH A;  3BF2 A;  1T4L B;  4GEQ B;  3EPL A;  4AQY E;  2R76 A;  2D9H A;  2M1S A;  2EPM X;  4LFA E;  2EQ1 A;  1PJS A;  2LO3 A;  4X65 E;  1EKZ A;  1BBO A;  2E1M A;  4HTG A;  1EH8 A;  2MDG A;  1XMQ E;  2EWL A;  1ZR9 A;  2V83 A;  4F9C B;  1RC7 A;  2V88 A;  1RQ0 A;  2YU5 A;  4GZN C;  2LCE A;  1PJT A;  4DV7 E;  2YTI A;  2RPC A;  2LUQ A;  1YYK A;  4JI0 E;  1GZ6 A;  2EOF A;  4X9J A;  3HPS A;  1MEY C;  4F6M A;  4M30 A;  1MGT A;  1TF3 A;  2EPP A;  5KL4 A;  2N3G A;  1WHN A;  2CSH A;  2EN6 A;  2EOH A;  4DUZ E;  4IJD A;  2EN3 A;  4JI7 E;  2V8Q B;  3IWD A;  4NHR A;  2I13 A;  4BCA A;  1Z1B A;  4WYQ B;  2EPR A;  2JR1 A;  2UUC E;  2LV2 A;  2EPU A;  3J80 C;  4M0V A;  2B7V A;  2K7I A;  2YRH A;  3C6M A;  1FKA E;  4BMJ A;  4LF6 E;  2JOB A;  2EQ0 A;  1UN6 B;  3QG5 C;  2EPO A;  5KL5 A;  4R2D A;  2YSO A;  2NAB A;  2EOJ A;  4YHH E;  1A1I A;  2EJ4 A;  5KL7 A;  3K6Q A;  5A2Q C;  2V86 A;  3DJW A;  2EPA A;  1GTK A;  2UXC E;  4JI1 E;  5ADZ A;  4F9A B;  4O4K A;  1X5W A;  2YZT A;  4F6N A;  3H09 A;  2YT4 A;  5CFF E;  2DGC A;  4M9V C;  1X49 A;  4DR1 E;  3BID A;  1N36 E;  2LE2 A;  3FIG A;  3ADG A;  5IWA E;  1IBK E;  2EMC A;  4O43 A;  2EL4 A;  4L5N C;  2YU8 A;  1YYO A;  1WHQ A;  2K4V A;  3THN A;  2EM9 A;  2EMB A;  3THO B;  4R2R A;  2H36 X;  5TSE A;  5A6K A;  3BGH A;  4LF5 E;  2I9I A;  2L8T A;  4R03 A;  3C4B A;  2DLQ A;  4O24 A;  4KZS A;  3LLH A;  3JAM C;  1HR0 E;  4KWY A;  2EM4 A;  3HPZ A;  1J5E E;  2EOZ A;  2EP3 A;  2E5L E;  2WBS A;  2EMX A;  1KJK A;  5AC4 A;  2EM7 A;  4JI5 E;  2WZO A;  4R2E A;  3ECR A;  2EOX A;  2F8B A;  2L2N A;  4X8W A;  3HXL A;  4M2Z A;  2EM0 A;  1X48 A;  1X6E A;  3MSW A;  2ADR A;  2MDR A;  4X64 E;  4R2A A;  2M7Q A;  2JWO A;  2NUE A;  2LTR A;  2EN2 A;  2ODR C;  4DV1 E;  2EQ3 A;  2LRS A;  2EOI A;  2YRM A;  4WXC A;  4BC9 A;  4B3S E;  2L33 A;  2RS6 A;  4RH8 A;  3OTO E;  4P78 A;  4LFC E;  3F6G A;  1IBL E;  2YTP A;  3LML A;  2YTD A;  1A1K A;  2UUA E;  2EMG A;  2JYA A;  2UU9 E;  1T4O A;  2EPL X;  3RMP A;  2FTX B;  4DV0 E;  2MC5 A;  4DR4 E;  2KON A;  1A1G A;  5A6J A;  4LF8 E;  2RSI A;  1I94 E;  2YTJ A;  4R2S A;  1JK2 A;  2EMI A;  2L2M A;  2RTX A;  4R2C A;  1ZBT A;  2EMZ A;  2L3C A;  3EPK A;  2B9D A;  2YTF A;  1UIL A;  4TUG A;  2B7T A;  3TQM A;  1P47 A;  2EM5 A;  1HNW E;  4F54 A;  1A1L A;  3T1Y E;  1EH6 A;  1N34 E;  4DR5 E;  4ZYE A;  2UUB E;  2F4V E;  4HEI A;  2MC6 A;  2WBT A;  3M99 B;  4WSP A;  2YWQ A;  2ENC A;  1F2I G;  4DV2 E;  1LLM C;  4IS1 C;  2YTE A;  2HHH E;  2EOO A;  2DB2 A;  2LJU A;  1IQS A;  4DKK A;  2JP9 A;  1EH7 A;  2EN7 A;  5LL6 R;  4JI2 E;  4LF9 E;  2CT1 A;  4BHC A;  1PDA A;  1IBM E;  1UHZ A;  3T1H E;  1HNZ E;  4J8Z A;  2V85 A;  4YY3 E;  2DMY A;  5LLQ A;  2J7J A;  4TUI A;  3AUZ A;  4DV3 E;  2EL5 A;  3J7A G;  2EMF A;  2ELY A;  1YFH A;  2FV4 B;  2UXB E;  2ZM6 E;  1ZU1 A;  1XNQ E;  1GQE A;  4NXN E;  4X62 E;  4DV5 E;  5DNY A;  2L92 A;  2RSM A;  4DUY E;  1L4S A;  4L8N A;  1T4N A;  1UBD C;  2YTO A;  1B69 A;  2V89 A;  2L6M A;  3ZOQ B;  2N3H A;  4ZYD A;  4MLQ A;  4DMI A;  4WX9 A;  3ADI A;  3KWR A;  2FGG A;  4KHP E;  1DGC A; 
#chains in the Genus database with same CATH homology
 2LVH A;  2YTI A;  2EQ3 A;  2GLI A;  2RPC A;  1AAY A;  2EOF A;  3EPJ A;  2EOI A;  1JK1 A;  2YRM A;  4X9J A;  2EOS A;  1X6H A;  1MEY C;  2EOY A;  2YTN A;  4WSG A;  4R2Q A;  4F6M A;  3UK3 C;  3EPH A;  1TF3 A;  2YTP A;  5KL6 A;  2EPP A;  5KL4 A;  2YTD A;  1A1K A;  2CSH A;  2EMG A;  2DRP A;  2EN6 A;  2ELZ A;  2EOH A;  2EN3 A;  4IJD A;  1G2F C;  2EM6 A;  2EN8 A;  2DMI A;  1A1G A;  2I13 A;  2R1F A;  1Z1B A;  1NCS A;  2EPR A;  2RSI A;  2EMH A;  2LV2 A;  1YUI A;  2BB8 A;  2YTJ A;  2EMW A;  2EPU A;  2CTD A;  4R2S A;  1JK2 A;  2EMI A;  1BB8 A;  4R2C A;  2EMZ A;  5KL3 A;  2YRH A;  2WCC 3;  3EPK A;  2EQ0 A;  4FK5 C;  1UN6 B;  2EPZ A;  2YTF A;  2EMK A;  5KL5 A;  4R2D A;  4F2J C;  2DLK A;  2YSO A;  2NAB A;  2EOJ A;  2YRK A;  2GHF A;  1P47 A;  2EM5 A;  2EJ4 A;  5KL2 A;  2EPX A;  5KL7 A;  1A1I A;  3MHS C;  1RMD A;  2EPA A;  1X3C A;  1TN9 A;  1A1L A;  1A1H A;  2YTQ A;  1X5W A;  2EMY A;  2VRD A;  4F6N A;  2YTG A;  1TF6 A;  1YUJ A;  2DGC A;  4M9V C;  2WBT A;  3M99 B;  1X6F A;  2ENC A;  1F2I G;  1YSA C;  1LLM C;  2EML A;  2EM3 A;  4R2P A;  4IS1 C;  3VHT B;  2YTE A;  2EMC A;  2EOO A;  2EM2 A;  2EL4 A;  1WJP A;  2EMA A;  2JP9 A;  2YU8 A;  2EN7 A;  2HGH A;  2EOQ A;  2EM9 A;  2CT1 A;  2EMB A;  2EN1 A;  2M9A A;  2EN4 A;  2EL6 A;  4R2R A;  2A25 A;  2EM8 A;  2J7J A;  2EL5 A;  3MHH C;  2EMF A;  2ELY A;  2EOR A;  2DLQ A;  1ZU1 A;  2MKN A;  2ENA A;  1G2D C;  1ZAA C;  2PRT A;  2EOE A;  2EM4 A;  2WBU A;  2EPC A;  2EE8 A;  2MKD A;  1A1J A;  2ENH A;  2EOZ A;  2EP3 A;  2WBS A;  2YSP A;  3EPL A;  2EMX A;  2JPA A;  1KJK A;  2D9H A;  2EM7 A;  1UBD C;  2EOM A;  2EQ1 A;  4R2E A;  1BBO A;  2LO3 A;  2EOX A;  2YTO A;  1B69 A;  2MDG A;  1A1F A;  2EM0 A;  1ZR9 A;  1X6E A;  2E72 A;  2ADR A;  2LT7 A;  2YU5 A;  4R2A A;  4GZN C;  2LCE A;  1DGC A;  2EN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...