1A1KA

Radr (zif268 variant) zinc finger-dna complex (gacc site)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*AP*CP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1kA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1kA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1kA03
1WJPA 2EPRA 5KL7A 1G2FC 4R2CA 4R2AA 4R2EA 2EPCA 4F2JC 1JK1A 2YTEA 2YTFA 2EQ0A 2YRMA 2EOSA 2WCC3 2HGHA 4R2RA 4F6NA 2EOJA 1MEYC 2EN1A 5KL3A 1LLMC 1A1FA 1TN9A 3EPLA 2ENCA 2A25A 2ELYA 4R2DA 2EM3A 2EMWA 2EOIA 1KJKA 1X6FA 1DGCA 1X6HA 2YU8A 1NCSA 2I13A 2EPPA 2DRPA 1A1HA 1BBOA 2EOEA 2EM2A 2EMXA 2CSHA 2YRKA 1Z1BA 2ENHA 5KL2A 2YTDA 2YTPA 4FK5C 2YTIA 2DLKA 2EJ4A 1A1KA 5KL5A 2EMFA 2EOHA 2GHFA 2EM0A 2EM7A 2YTJA 2E72A 2EORA 2ADRA 2EQ3A 1YUIA 1UN6B 2EPAA 2MKNA 2YU5A 2EPUA 3MHHC 1TF3A 2EM8A 2EOZA 2LCEA 2EMAA 3EPKA 2EL5A 2R1FA 2EMIA 2EMKA 1YSAC 2EOQA 2YTGA 2RSIA 2YTOA 2EN6A 3EPHA 1X6EA 2YTQA 4WSGA 2YTNA 2J7JA 1B69A 1G2DC 2EE8A 2LO3A 2GLIA 2EOFA 1A1GA 2EL4A 1F2IG 3UK3C 2EN7A 2YRHA 3VHTB 1A1IA 2EMZA 2LVHA 2ELZA 4R2SA 1P47A 1A1JA 2EN2A 3MHSC 2EMYA 1BB8A 2EOMA 2NABA 4IS1C 4GZNC 2YSPA 2JP9A 2ENAA 2EOYA 2RPCA 1ZAAC 2EM6A 1ZR9A 2EMLA 2EN4A 2EN8A 1TF6A 3EPJA 1RMDA 1YUJA 2EMCA 2DMIA 2CT1A 2EPXA 2LV2A 2PRTA 2LT7A 2EP3A 5KL6A 4IJDA 2WBUA 1X3CA 2WBTA 4R2QA 1AAYA 4F6MA 2EMHA 2VRDA 2EM9A 2MKDA 2EQ1A 2EM4A 1X5WA 2EN3A 1UBDC 2EMGA 2M9AA 4M9VC 2EPZA 2EOOA 2EMBA 2WBSA 2YSOA 1A1LA 2JPAA 2EM5A 2DLQA 4X9JA 2MDGA 3M99B 5KL4A 4R2PA 2D9HA 2EL6A 2EOXA 2DGCA 2BB8A 2CTDA 1JK2A 1ZU1A
chains in the Genus database with same CATH superfamily
5KL7A 2EPRA 3ECRA 4LFBE 2EPCA 3K6QA 1GZ6A 2YTEA 4O4KA 2V88A 4ZYGA 2JXPA 5AE1A 3KZYA 5AE3A 1LLMC 1TN9A 4LF5E 4KHPE 2KHXA 4JI0E 4MLVA 4R2DA 2EM3A 2CPNA 2WZOA 1X6FA 2B7VA 1DGCA 2UUCE 3JTZA 1IBME 5IXMB 2I13A 2ODRC 5A6KA 2DRPA 1IQSA 1XNRE 2RQLA 2B7TA 2YRKA 1Z1BA 2ENHA 2UXBE 2YTDA 4FK5C 1N32E 2EMFA 5T6JA 1EH7A 2EORA 2ADRA 4ZYDA 1FJGE 3F6HA 2L2MA 1X48A 1UN6B 3LMLA 5A69A 2UU9E 2DMYA 2UUBE 4BBYA 1WHNA 4M0VA 1TF3A 2JWOA 4RHBB 4KZSA 2NUGA 4DUZE 1T4NA 2EMIA 4L5NC 2YTGA 1T39A 4P78A 2RSIA 1X6EA 1IQOA 3C6KA 2LTRA 3BIDA 1G2DC 4JI3E 4JV5E 2EE8A 2JR1A 2LE2A 2EMZA 2ELZA 4LFCE 1P47A 1FKAE 2M7QA 2FV4B 2N8XA 2L8TA 4ZYEA 2JP9A 2ENAA 2RPCA 2JOBA 4LTYA 4WXCA 1ZR9A 1PDAA 2L3JA 3ADIA 1YUJA 1RMDA 3J7Yp 2YWQA 1X3CA 1AAYA 3J7AG 1L4SA 2EMHA 3P1XA 2MKDA 2ZM6E 1HNXE 2M9AA 4M9VC 3BBGA 5ADZA 2UUAE 1IMUA 2YPNA 2LJUA 4LF9E 4NHRA 2WBSA 2G7HA 4MLQA 3BF2A 2L2NA 2LJHA 4B3RE 4NZVA 4X9JA 3FIGA 1QNTA 2EL6A 2EOXA 1WJPA 1G2FC 4DR4E 4DV7E 3THNA 4R2AA 2BBGA 4WXDA 3AV0A 5IV8B 1JK1A 2YTFA 4X65E 4JI6E 3DF6A 2WCC3 4DKKA 2UXDE 2NUEA 1T4LB 2EN1A 3HXLA 1A1FA 2LMZA 3EPLA 4DR1E 2ELYA 3C4BA 2YZTA 2UXCE 5LLQA 4F54A 1PJSA 5BR8E 2FTXB 1NCSA 1DQ3A 3H09A 4LF7E 1IBLE 4BC7A 5LMNE 1BBOA 2EM2A 3KZZA 1XMQE 5A6JA 4HTGA 4NXNE 2YTPA 1YFHA 2YTIA 2EM0A 4DR7E 2R76A 2E72A 2EQ3A 4F9CB 1YUIA 2EPMX 4WSPA 2EPAA 3ADJA 1YYOA 2YU5A 2EZ6A 3J80C 3ADLA 2EOZA 4DV0E 4LFAE 5AC5A 5A6BA 3C6MA 2E5LE 2EMKA 4DV1E 1YSAC 2EOQA 1B69A 4X8WA 4LF6E 2VF1A 3F6GA 2GLIA 2DSYA 2HC5A 1A1GA 2YRHA 1O0WA 3HPZA 2LVHA 4X66E 4R2SA 4Q28A 4OOGC 3MHSC 1BB8A 1J5EE 2EOMA 4GZNC 1DI2A 2ODRD 2LTSA 1ZAAC 4I8OA 2EN8A 2EN4A 3EPJA 2EMCA 3ADGA 1AH5A 2LV2A 1X47A 2PRTA 2I9IA 4P7DA 5KL6A 4DR5E 3KWRA 2B9DA 4F6MA 4BS9A 2VRDA 3HTXA 1X5WA 1UBDC 2EPZA 2EPLX 2NUFA 4X62E 4F9BB 3VYXA 3IWBA 1N34E 1N33E 2MDGA 3T1YE 2YT4A 2LBSB 2HHHE 3TQMA 2BB8A 2EWLA 4DR2E 1WXRA 4OX9E 4F2JC 4DV4E 2B3TB 2EQ0A 2V8QB 4R2RA 4F6NA 1YPNA 5KL3A 2HJJA 2N3HA 3JU0A 2L6MA 1EKZA 2H36X 4DV5E 2EMWA 3OTOE 2YU8A 2LUPB 5A6AA 2JVAA 2M1SA 5CFFE 2EPPA 1SFEA 4DMIA 4DR6E 2EOEA 3ZOQB 2L3CA 2EMXA 2CSHA 5KL2A 1UILA 3C4TA 2EJ4A 5KL5A 2GHFA 2EM7A 1T38A 2YTJA 4B3TE 1NEIA 1XNQE 3RMPA 4K0KE 1T4OA 2EPUA 3MHHC 4BC9A 2EM8A 4JI4E 3LLHA 2RTXA 2EMAA 4M30A 4YHHE 3EPKA 1GTKA 4B3ME 2DIXA 4JI2E 2L92A 4O5GA 2YTOA 3EPHA 2YTQA 1ZBQA 1YZ9A 2YTNA 2J7JA 2GPIA 4DR3E 1F2IG 3UK3C 2EN7A 3VHTB 2JY9A 2DB2A 2LUQA 1A1JA 4DV6E 2VE7C 2EN2A 5LL6R 2EMYA 2NABA 4IS1C 2YSPA 2N3GA 2EOYA 1PJQA 5AC4A 1J26A 2EM6A 2EMLA 5AE2A 3JAMC 2CT1A 2EPXA 1EH8A 4WX9A 2LT7A 2EP3A 4IJDA 4M2ZA 4LF4E 1N3GA 1RC7A 5FLXC 2EM9A 4DV3E 4JI7E 1SR9A 3L00A 2EOOA 1N36E 2EMBA 3MSWA 4HEIA 3HPSA 2EM5A 3HQ1A 2DLQA 3M99B 4L8NA 5KL4A 4R2PA 1HNZE 4WPYA 5LMUE 2DGCA 4R8OA 1ZU1A 3VK6A 2IHR1 4R2CA 1BBGA 1RQ0A 4R03A 4R2EA 5F3WA 2HGHA 2YRMA 2EOSA 3OMLA 2EOJA 3IWDA 1MEYC 3VYYA 1KYQA 4GKJE 2ENCA 2A25A 1PJTA 4JI8E 4BHCA 2EOIA 1KJKA 5AASA 1X6HA 4GEQB 4NXME 2JYAA 4ZYHA 1YYWA 2NA2A 2VQEE 1A1HA 2RS7A 2K7IA 1X49A 1WHQA 1YYKA 4LF8E 4YY3E 5DNYA 2M4IA 2DLKA 1A1KA 3DJWA 2EOHA 2V83A 4GKKE 5IWAE 1WRJA 1UHZA 3J81C 4BMJA 2RSMA 4WYQB 1ZBTA 4O24A 2MKNA 2MC5A 2KOUA 2F4VE 1STUA 2K4VA 2LCEA 5A2QC 2EPNA 2EL5A 2R1FA 3AUZA 4BHBA 3BGHA 4DV2E 4AQYE 2EN6A 2EPOA 2V85A 4WSGA 1XMOE 2L2KB 1MGTA 5A6BD 4Q35B 2LO3A 2EOFA 2EL4A 3IWCA 4JYAE 1A1IA 4DUYE 4TUGA 1IBKE 3T1HE 2Q8UA 1HR0E 4JI1E 2V86A 1QU6A 2JOXA 4X64E 4JI5E 3EQ1A 3QG5C 1TF6A 2FGGA 2DMIA 4LU9A 1I94E 2E1MA 2L33A 1PKPA 2MDRA 2WBUA 2VQFE 1HNWE 2WBTA 4F9AB 4R2QA 5IT9C 2EPKX 2MC6A 2V89A 4RH8A 4WFTA 4J8ZA 3THOB 2EQ1A 2EM4A 2EN3A 2EMGA 4TUIA 4KWYA 2V87A 4N4RB 2RS6A 1GQEA 4BCAA 2YSOA 1A1LA 1EH6A 2JPAA 4O43A 2KONA 4B3SE 2D9HA 2F8BA 2LRSA 2CTDA 1JK2A 5TSEA
chains in the Genus database with same CATH topology
1WJPA 2EPRA 5KL7A 1G2FC 4R2CA 4R2AA 4R2EA 2EPCA 4F2JC 1JK1A 2YTEA 2YTFA 2EQ0A 2YRMA 2EOSA 2WCC3 2HGHA 4R2RA 4F6NA 2EOJA 1MEYC 2EN1A 5KL3A 1LLMC 1A1FA 1TN9A 3EPLA 2ENCA 2A25A 2ELYA 4R2DA 2EM3A 2EMWA 2EOIA 1KJKA 1X6FA 1DGCA 1X6HA 2YU8A 1NCSA 2I13A 2EPPA 2DRPA 1A1HA 1BBOA 2EOEA 2EM2A 2EMXA 2CSHA 2YRKA 1Z1BA 2ENHA 5KL2A 2YTDA 2YTPA 4FK5C 2YTIA 2DLKA 2EJ4A 1A1KA 5KL5A 2EMFA 2EOHA 2GHFA 2EM0A 2EM7A 2YTJA 2E72A 2EORA 2ADRA 2EQ3A 1YUIA 1UN6B 2EPAA 2MKNA 2YU5A 2EPUA 3MHHC 1TF3A 2EM8A 2EOZA 2LCEA 2EMAA 3EPKA 2EL5A 2R1FA 2EMIA 2EMKA 1YSAC 2EOQA 2YTGA 2RSIA 2YTOA 2EN6A 3EPHA 1X6EA 2YTQA 4WSGA 2YTNA 2J7JA 1B69A 1G2DC 2EE8A 2LO3A 2GLIA 2EOFA 1A1GA 2EL4A 1F2IG 3UK3C 2EN7A 2YRHA 3VHTB 1A1IA 2EMZA 2LVHA 2ELZA 4R2SA 1P47A 1A1JA 2EN2A 3MHSC 2EMYA 1BB8A 2EOMA 2NABA 4IS1C 4GZNC 2YSPA 2JP9A 2ENAA 2EOYA 2RPCA 1ZAAC 2EM6A 1ZR9A 2EMLA 2EN4A 2EN8A 1TF6A 3EPJA 1RMDA 1YUJA 2EMCA 2DMIA 2CT1A 2EPXA 2LV2A 2PRTA 2LT7A 2EP3A 5KL6A 4IJDA 2WBUA 1X3CA 2WBTA 4R2QA 1AAYA 4F6MA 2EMHA 2VRDA 2EM9A 2MKDA 2EQ1A 2EM4A 1X5WA 2EN3A 1UBDC 2EMGA 2M9AA 4M9VC 2EPZA 2EOOA 2EMBA 2WBSA 2YSOA 1A1LA 2JPAA 2EM5A 2DLQA 4X9JA 2MDGA 3M99B 5KL4A 4R2PA 2D9HA 2EL6A 2EOXA 2DGCA 2BB8A 2CTDA 1JK2A 1ZU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJP A;  2EPR A;  5KL7 A;  1G2F C;  4R2C A;  4R2A A;  4R2E A;  2EPC A;  4F2J C;  1JK1 A;  2YTE A;  2YTF A;  2EQ0 A;  2YRM A;  2EOS A;  2WCC 3;  2HGH A;  4R2R A;  4F6N A;  2EOJ A;  1MEY C;  2EN1 A;  5KL3 A;  1LLM C;  1A1F A;  1TN9 A;  3EPL A;  2ENC A;  2A25 A;  2ELY A;  4R2D A;  2EM3 A;  2EMW A;  2EOI A;  1KJK A;  1X6F A;  1DGC A;  1X6H A;  2YU8 A;  1NCS A;  2I13 A;  2EPP A;  2DRP A;  1A1H A;  1BBO A;  2EOE A;  2EM2 A;  2EMX A;  2CSH A;  2YRK A;  1Z1B A;  2ENH A;  5KL2 A;  2YTD A;  2YTP A;  4FK5 C;  2YTI A;  2DLK A;  2EJ4 A;  1A1K A;  5KL5 A;  2EMF A;  2EOH A;  2GHF A;  2EM0 A;  2EM7 A;  2YTJ A;  2E72 A;  2EOR A;  2ADR A;  2EQ3 A;  1YUI A;  1UN6 B;  2EPA A;  2MKN A;  2YU5 A;  2EPU A;  3MHH C;  1TF3 A;  2EM8 A;  2EOZ A;  2LCE A;  2EMA A;  3EPK A;  2EL5 A;  2R1F A;  2EMI A;  2EMK A;  1YSA C;  2EOQ A;  2YTG A;  2RSI A;  2YTO A;  2EN6 A;  3EPH A;  1X6E A;  2YTQ A;  4WSG A;  2YTN A;  2J7J A;  1B69 A;  1G2D C;  2EE8 A;  2LO3 A;  2GLI A;  2EOF A;  1A1G A;  2EL4 A;  1F2I G;  3UK3 C;  2EN7 A;  2YRH A;  3VHT B;  1A1I A;  2EMZ A;  2LVH A;  2ELZ A;  4R2S A;  1P47 A;  1A1J A;  2EN2 A;  3MHS C;  2EMY A;  1BB8 A;  2EOM A;  2NAB A;  4IS1 C;  4GZN C;  2YSP A;  2JP9 A;  2ENA A;  2EOY A;  2RPC A;  1ZAA C;  2EM6 A;  1ZR9 A;  2EML A;  2EN4 A;  2EN8 A;  1TF6 A;  3EPJ A;  1RMD A;  1YUJ A;  2EMC A;  2DMI A;  2CT1 A;  2EPX A;  2LV2 A;  2PRT A;  2LT7 A;  2EP3 A;  5KL6 A;  4IJD A;  2WBU A;  1X3C A;  2WBT A;  4R2Q A;  1AAY A;  4F6M A;  2EMH A;  2VRD A;  2EM9 A;  2MKD A;  2EQ1 A;  2EM4 A;  1X5W A;  2EN3 A;  1UBD C;  2EMG A;  2M9A A;  4M9V C;  2EPZ A;  2EOO A;  2EMB A;  2WBS A;  2YSO A;  1A1L A;  2JPA A;  2EM5 A;  2DLQ A;  4X9J A;  2MDG A;  3M99 B;  5KL4 A;  4R2P A;  2D9H A;  2EL6 A;  2EOX A;  2DGC A;  2BB8 A;  2CTD A;  1JK2 A;  1ZU1 A; 
#chains in the Genus database with same CATH topology
 5KL7 A;  2EPR A;  3ECR A;  4LFB E;  2EPC A;  3K6Q A;  1GZ6 A;  2YTE A;  4O4K A;  2V88 A;  4ZYG A;  2JXP A;  5AE1 A;  3KZY A;  5AE3 A;  1LLM C;  1TN9 A;  4LF5 E;  4KHP E;  2KHX A;  4JI0 E;  4MLV A;  4R2D A;  2EM3 A;  2CPN A;  2WZO A;  1X6F A;  2B7V A;  1DGC A;  2UUC E;  3JTZ A;  1IBM E;  5IXM B;  2I13 A;  2ODR C;  5A6K A;  2DRP A;  1IQS A;  1XNR E;  2RQL A;  2B7T A;  2YRK A;  1Z1B A;  2ENH A;  2UXB E;  2YTD A;  4FK5 C;  1N32 E;  2EMF A;  5T6J A;  1EH7 A;  2EOR A;  2ADR A;  4ZYD A;  1FJG E;  3F6H A;  2L2M A;  1X48 A;  1UN6 B;  3LML A;  5A69 A;  2UU9 E;  2DMY A;  2UUB E;  4BBY A;  1WHN A;  4M0V A;  1TF3 A;  2JWO A;  4RHB B;  4KZS A;  2NUG A;  4DUZ E;  1T4N A;  2EMI A;  4L5N C;  2YTG A;  1T39 A;  4P78 A;  2RSI A;  1X6E A;  1IQO A;  3C6K A;  2LTR A;  3BID A;  1G2D C;  4JI3 E;  4JV5 E;  2EE8 A;  2JR1 A;  2LE2 A;  2EMZ A;  2ELZ A;  4LFC E;  1P47 A;  1FKA E;  2M7Q A;  2FV4 B;  2N8X A;  2L8T A;  4ZYE A;  2JP9 A;  2ENA A;  2RPC A;  2JOB A;  4LTY A;  4WXC A;  1ZR9 A;  1PDA A;  2L3J A;  3ADI A;  1YUJ A;  1RMD A;  3J7Y p;  2YWQ A;  1X3C A;  1AAY A;  3J7A G;  1L4S A;  2EMH A;  3P1X A;  2MKD A;  2ZM6 E;  1HNX E;  2M9A A;  4M9V C;  3BBG A;  5ADZ A;  2UUA E;  1IMU A;  2YPN A;  2LJU A;  4LF9 E;  4NHR A;  2WBS A;  2G7H A;  4MLQ A;  3BF2 A;  2L2N A;  2LJH A;  4B3R E;  4NZV A;  4X9J A;  3FIG A;  1QNT A;  2EL6 A;  2EOX A;  1WJP A;  1G2F C;  4DR4 E;  4DV7 E;  3THN A;  4R2A A;  2BBG A;  4WXD A;  3AV0 A;  5IV8 B;  1JK1 A;  2YTF A;  4X65 E;  4JI6 E;  3DF6 A;  2WCC 3;  4DKK A;  2UXD E;  2NUE A;  1T4L B;  2EN1 A;  3HXL A;  1A1F A;  2LMZ A;  3EPL A;  4DR1 E;  2ELY A;  3C4B A;  2YZT A;  2UXC E;  5LLQ A;  4F54 A;  1PJS A;  5BR8 E;  2FTX B;  1NCS A;  1DQ3 A;  3H09 A;  4LF7 E;  1IBL E;  4BC7 A;  5LMN E;  1BBO A;  2EM2 A;  3KZZ A;  1XMQ E;  5A6J A;  4HTG A;  4NXN E;  2YTP A;  1YFH A;  2YTI A;  2EM0 A;  4DR7 E;  2R76 A;  2E72 A;  2EQ3 A;  4F9C B;  1YUI A;  2EPM X;  4WSP A;  2EPA A;  3ADJ A;  1YYO A;  2YU5 A;  2EZ6 A;  3J80 C;  3ADL A;  2EOZ A;  4DV0 E;  4LFA E;  5AC5 A;  5A6B A;  3C6M A;  2E5L E;  2EMK A;  4DV1 E;  1YSA C;  2EOQ A;  1B69 A;  4X8W A;  4LF6 E;  2VF1 A;  3F6G A;  2GLI A;  2DSY A;  2HC5 A;  1A1G A;  2YRH A;  1O0W A;  3HPZ A;  2LVH A;  4X66 E;  4R2S A;  4Q28 A;  4OOG C;  3MHS C;  1BB8 A;  1J5E E;  2EOM A;  4GZN C;  1DI2 A;  2ODR D;  2LTS A;  1ZAA C;  4I8O A;  2EN8 A;  2EN4 A;  3EPJ A;  2EMC A;  3ADG A;  1AH5 A;  2LV2 A;  1X47 A;  2PRT A;  2I9I A;  4P7D A;  5KL6 A;  4DR5 E;  3KWR A;  2B9D A;  4F6M A;  4BS9 A;  2VRD A;  3HTX A;  1X5W A;  1UBD C;  2EPZ A;  2EPL X;  2NUF A;  4X62 E;  4F9B B;  3VYX A;  3IWB A;  1N34 E;  1N33 E;  2MDG A;  3T1Y E;  2YT4 A;  2LBS B;  2HHH E;  3TQM A;  2BB8 A;  2EWL A;  4DR2 E;  1WXR A;  4OX9 E;  4F2J C;  4DV4 E;  2B3T B;  2EQ0 A;  2V8Q B;  4R2R A;  4F6N A;  1YPN A;  5KL3 A;  2HJJ A;  2N3H A;  3JU0 A;  2L6M A;  1EKZ A;  2H36 X;  4DV5 E;  2EMW A;  3OTO E;  2YU8 A;  2LUP B;  5A6A A;  2JVA A;  2M1S A;  5CFF E;  2EPP A;  1SFE A;  4DMI A;  4DR6 E;  2EOE A;  3ZOQ B;  2L3C A;  2EMX A;  2CSH A;  5KL2 A;  1UIL A;  3C4T A;  2EJ4 A;  5KL5 A;  2GHF A;  2EM7 A;  1T38 A;  2YTJ A;  4B3T E;  1NEI A;  1XNQ E;  3RMP A;  4K0K E;  1T4O A;  2EPU A;  3MHH C;  4BC9 A;  2EM8 A;  4JI4 E;  3LLH A;  2RTX A;  2EMA A;  4M30 A;  4YHH E;  3EPK A;  1GTK A;  4B3M E;  2DIX A;  4JI2 E;  2L92 A;  4O5G A;  2YTO A;  3EPH A;  2YTQ A;  1ZBQ A;  1YZ9 A;  2YTN A;  2J7J A;  2GPI A;  4DR3 E;  1F2I G;  3UK3 C;  2EN7 A;  3VHT B;  2JY9 A;  2DB2 A;  2LUQ A;  1A1J A;  4DV6 E;  2VE7 C;  2EN2 A;  5LL6 R;  2EMY A;  2NAB A;  4IS1 C;  2YSP A;  2N3G A;  2EOY A;  1PJQ A;  5AC4 A;  1J26 A;  2EM6 A;  2EML A;  5AE2 A;  3JAM C;  2CT1 A;  2EPX A;  1EH8 A;  4WX9 A;  2LT7 A;  2EP3 A;  4IJD A;  4M2Z A;  4LF4 E;  1N3G A;  1RC7 A;  5FLX C;  2EM9 A;  4DV3 E;  4JI7 E;  1SR9 A;  3L00 A;  2EOO A;  1N36 E;  2EMB A;  3MSW A;  4HEI A;  3HPS A;  2EM5 A;  3HQ1 A;  2DLQ A;  3M99 B;  4L8N A;  5KL4 A;  4R2P A;  1HNZ E;  4WPY A;  5LMU E;  2DGC A;  4R8O A;  1ZU1 A;  3VK6 A;  2IHR 1;  4R2C A;  1BBG A;  1RQ0 A;  4R03 A;  4R2E A;  5F3W A;  2HGH A;  2YRM A;  2EOS A;  3OML A;  2EOJ A;  3IWD A;  1MEY C;  3VYY A;  1KYQ A;  4GKJ E;  2ENC A;  2A25 A;  1PJT A;  4JI8 E;  4BHC A;  2EOI A;  1KJK A;  5AAS A;  1X6H A;  4GEQ B;  4NXM E;  2JYA A;  4ZYH A;  1YYW A;  2NA2 A;  2VQE E;  1A1H A;  2RS7 A;  2K7I A;  1X49 A;  1WHQ A;  1YYK A;  4LF8 E;  4YY3 E;  5DNY A;  2M4I A;  2DLK A;  1A1K A;  3DJW A;  2EOH A;  2V83 A;  4GKK E;  5IWA E;  1WRJ A;  1UHZ A;  3J81 C;  4BMJ A;  2RSM A;  4WYQ B;  1ZBT A;  4O24 A;  2MKN A;  2MC5 A;  2KOU A;  2F4V E;  1STU A;  2K4V A;  2LCE A;  5A2Q C;  2EPN A;  2EL5 A;  2R1F A;  3AUZ A;  4BHB A;  3BGH A;  4DV2 E;  4AQY E;  2EN6 A;  2EPO A;  2V85 A;  4WSG A;  1XMO E;  2L2K B;  1MGT A;  5A6B D;  4Q35 B;  2LO3 A;  2EOF A;  2EL4 A;  3IWC A;  4JYA E;  1A1I A;  4DUY E;  4TUG A;  1IBK E;  3T1H E;  2Q8U A;  1HR0 E;  4JI1 E;  2V86 A;  1QU6 A;  2JOX A;  4X64 E;  4JI5 E;  3EQ1 A;  3QG5 C;  1TF6 A;  2FGG A;  2DMI A;  4LU9 A;  1I94 E;  2E1M A;  2L33 A;  1PKP A;  2MDR A;  2WBU A;  2VQF E;  1HNW E;  2WBT A;  4F9A B;  4R2Q A;  5IT9 C;  2EPK X;  2MC6 A;  2V89 A;  4RH8 A;  4WFT A;  4J8Z A;  3THO B;  2EQ1 A;  2EM4 A;  2EN3 A;  2EMG A;  4TUI A;  4KWY A;  2V87 A;  4N4R B;  2RS6 A;  1GQE A;  4BCA A;  2YSO A;  1A1L A;  1EH6 A;  2JPA A;  4O43 A;  2KON A;  4B3S E;  2D9H A;  2F8B A;  2LRS A;  2CTD A;  1JK2 A;  5TSE A; 
#chains in the Genus database with same CATH homology
 1WJP A;  2EPR A;  5KL7 A;  1G2F C;  4R2C A;  4R2A A;  4R2E A;  2EPC A;  4F2J C;  1JK1 A;  2YTE A;  2YTF A;  2EQ0 A;  2YRM A;  2EOS A;  2WCC 3;  2HGH A;  4R2R A;  4F6N A;  2EOJ A;  1MEY C;  2EN1 A;  5KL3 A;  1LLM C;  1A1F A;  1TN9 A;  3EPL A;  2ENC A;  2A25 A;  2ELY A;  4R2D A;  2EM3 A;  2EMW A;  2EOI A;  1KJK A;  1X6F A;  1DGC A;  1X6H A;  2YU8 A;  1NCS A;  2I13 A;  2EPP A;  2DRP A;  1A1H A;  1BBO A;  2EOE A;  2EM2 A;  2EMX A;  2CSH A;  2YRK A;  1Z1B A;  2ENH A;  5KL2 A;  2YTD A;  2YTP A;  4FK5 C;  2YTI A;  2DLK A;  2EJ4 A;  1A1K A;  5KL5 A;  2EMF A;  2EOH A;  2GHF A;  2EM0 A;  2EM7 A;  2YTJ A;  2E72 A;  2EOR A;  2ADR A;  2EQ3 A;  1YUI A;  1UN6 B;  2EPA A;  2MKN A;  2YU5 A;  2EPU A;  3MHH C;  1TF3 A;  2EM8 A;  2EOZ A;  2LCE A;  2EMA A;  3EPK A;  2EL5 A;  2R1F A;  2EMI A;  2EMK A;  1YSA C;  2EOQ A;  2YTG A;  2RSI A;  2YTO A;  2EN6 A;  3EPH A;  1X6E A;  2YTQ A;  4WSG A;  2YTN A;  2J7J A;  1B69 A;  1G2D C;  2EE8 A;  2LO3 A;  2GLI A;  2EOF A;  1A1G A;  2EL4 A;  1F2I G;  3UK3 C;  2EN7 A;  2YRH A;  3VHT B;  1A1I A;  2EMZ A;  2LVH A;  2ELZ A;  4R2S A;  1P47 A;  1A1J A;  2EN2 A;  3MHS C;  2EMY A;  1BB8 A;  2EOM A;  2NAB A;  4IS1 C;  4GZN C;  2YSP A;  2JP9 A;  2ENA A;  2EOY A;  2RPC A;  1ZAA C;  2EM6 A;  1ZR9 A;  2EML A;  2EN4 A;  2EN8 A;  1TF6 A;  3EPJ A;  1RMD A;  1YUJ A;  2EMC A;  2DMI A;  2CT1 A;  2EPX A;  2LV2 A;  2PRT A;  2LT7 A;  2EP3 A;  5KL6 A;  4IJD A;  2WBU A;  1X3C A;  2WBT A;  4R2Q A;  1AAY A;  4F6M A;  2EMH A;  2VRD A;  2EM9 A;  2MKD A;  2EQ1 A;  2EM4 A;  1X5W A;  2EN3 A;  1UBD C;  2EMG A;  2M9A A;  4M9V C;  2EPZ A;  2EOO A;  2EMB A;  2WBS A;  2YSO A;  1A1L A;  2JPA A;  2EM5 A;  2DLQ A;  4X9J A;  2MDG A;  3M99 B;  5KL4 A;  4R2P A;  2D9H A;  2EL6 A;  2EOX A;  2DGC A;  2BB8 A;  2CTD A;  1JK2 A;  1ZU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...