2YTQA

Solution structure of the c2h2 type zinc finger (region 775-807) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGAGEKPYGCSECGKAFSSKSYLIIHMRTHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 775-807) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytqA01
4R2SA 2YSPA 2GLIA 5KL4A 2EPUA 4R2DA 2EOOA 2RSIA 2EM5A 1WJPA 2EM9A 5KL2A 1LLMC 1BB8A 2EOHA 2MDGA 1TF3A 2D9HA 2GHFA 5KL3A 2EMAA 2EOXA 2WCC3 1X3CA 2DGCA 4F6NA 2DMIA 2EN1A 1YUJA 1A1FA 3EPHA 1YUIA 4R2CA 1KJKA 4R2EA 2EMGA 2YSOA 2EN7A 2YTFA 4R2QA 2EM7A 1X6HA 2EL4A 2JP9A 2ELYA 2LT7A 5KL5A 1JK2A 5KL6A 2EL6A 2ENCA 1JK1A 2DLKA 2YTGA 1A1JA 1A1LA 1TF6A 2BB8A 4WSGA 2EQ3A 2EPAA 4IS1C 1ZAAC 1NCSA 2I13A 2EMHA 2EPCA 2WBSA 2EMIA 2PRTA 2ELZA 4X9JA 1F2IG 1UBDC 1G2DC 2EMKA 2EPRA 3VHTB 2EOFA 2EORA 2CTDA 4F2JC 3EPKA 2YU5A 2CSHA 2EMBA 3EPJA 2YU8A 2LVHA 1TN9A 2R1FA 2EM8A 2EM6A 1ZU1A 2EM0A 2EOQA 4GZNC 2MKNA 1DGCA 2YRKA 3UK3C 1A1HA 2ENAA 2YTIA 3MHHC 2J7JA 4R2AA 2EE8A 2YRHA 2EOSA 1P47A 2EMCA 4R2RA 2EPPA 1A1KA 1A1IA 2EJ4A 2EP3A 2EMFA 2EPZA 2VRDA 2M9AA 4R2PA 2ENHA 2ADRA 1X5WA 2EN2A 1UN6B 2EMWA 2YTPA 2EPXA 2EL5A 2NABA 1A1GA 5KL7A 4FK5C 2LCEA 2EMXA 2YRMA 1Z1BA 4IJDA 2E72A 2EN3A 2EN8A 3EPLA 1X6EA 2EOEA 2EQ1A 1B69A 1G2FC 2DRPA 2EOYA 2HGHA 2A25A 4F6MA 2EQ0A 2RPCA 2EOJA 2WBUA 3MHSC 2EOMA 1RMDA 2EM2A 2YTJA 1X6FA 2EMZA 2YTEA 2EOIA 2YTNA 2LO3A 1ZR9A 1MEYC 2YTDA 2YTOA 1YSAC 2CT1A 2WBTA 1BBOA 2EMLA 2EN4A 2LV2A 3M99B 4M9VC 2YTQA 2JPAA 1AAYA 2EOZA 2EM3A 2MKDA 2EMYA 2EM4A 2EN6A 2DLQA
chains in the Genus database with same CATH superfamily
1L4SA 5IWAE 2MDRA 2MDGA 1TF3A 2RS7A 3FIGA 5KL3A 2WCC3 5AC5A 1X3CA 4F6NA 3KZZA 2EN1A 2LTSA 4TUIA 1YUIA 4R2CA 4LF5E 2EMGA 2UU9E 4DR6E 5BR8E 1RC7A 4R2QA 2HHHE 1X6HA 4M2ZA 2V8QB 1UHZA 4DUYE 5A6BD 2EL6A 2ENCA 4WX9A 1N36E 1ZBQA 2DLKA 4DR1E 4BC9A 5A6AA 3T1HE 1A1JA 1TF6A 1N34E 2EQ3A 4IS1C 4JI5E 1XNRE 4J8ZA 3VYXA 2EMIA 4R8OA 4RH8A 2JR1A 4ZYDA 1UBDC 3BIDA 2UXCE 1G2DC 4JI2E 1DQ3A 2EMKA 4DV3E 2LUQA 3EPJA 2YU8A 2LVHA 4X65E 2R1FA 3C6KA 4TUGA 2N8XA 3MSWA 3LMLA 2H36X 2YRKA 1A1HA 3MHHC 4KZSA 4DR3E 4BCAA 1A1IA 5LL6R 2LUPB 4K0KE 4ZYGA 4R2PA 2VRDA 1FJGE 1X5WA 3ECRA 1O0WA 2EN2A 3T1YE 4BHBA 4LTYA 1EH7A 4DKKA 2YRMA 1Z1BA 2FV4B 2L33A 2E72A 3EPLA 1X6EA 2RTXA 2UXBE 1N3GA 3VYYA 1KYQA 4WYQB 3JU0A 1G2FC 3J81C 3JAMC 2EQ0A 2EOJA 3BF2A 3MHSC 2KONA 2JOBA 2NUEA 2VF1A 3ADIA 1GTKA 2EPLX 1PKPA 1T39A 1X6FA 1YYKA 2CPNA 2DSYA 4WPYA 2YTDA 2CT1A 4DMIA 3THOB 1BBGA 3M99B 2YTQA 3AUZA 2JPAA 1AAYA 3ZOQB 4X64E 1QU6A 2HGHA 4KHPE 1NEIA 3K6QA 4R2DA 1PJSA 2EM9A 2V88A 2LMZA 2DMIA 2DB2A 3HTXA 1KJKA 4R2EA 4X66E 2EN7A 2YTFA 4F9AB 1STUA 2EM7A 4WXCA 3C4TA 3KWRA 4BS9A 1PJTA 5F3WA 2LT7A 5KL5A 1JK1A 2YTGA 2IHR1 2EPAA 3C6MA 2B7TA 2EMHA 2EWLA 1HR0E 2WBSA 3HPZA 4X9JA 4BC7A 3RMPA 3BBGA 2EPRA 2M7QA 2EOFA 2KHXA 2CTDA 4O4KA 3OMLA 2L2MA 3IWDA 4MLQA 5IT9C 1SFEA 2EM6A 3L00A 4F54A 3UK3C 4LF9E 4YY3E 5A6BA 3TQMA 2EE8A 2K7IA 2EZ6A 2JOXA 1P47A 2G7HA 5DNYA 2EMCA 4R2RA 5LMNE 1A1GA 5KL7A 2B7VA 1HNWE 4F9CB 2NA2A 2LRSA 2RQLA 1B69A 4F9BB 2NUFA 2DRPA 4LFAE 4O43A 4F6MA 1X48A 1IQSA 4L8NA 2WBUA 1N32E 1EH6A 4LFBE 3EQ1A 2EMZA 2YTEA 2E5LE 4JV5E 2YTNA 1MEYC 1SR9A 2WBTA 4NHRA 3THNA 4DR7E 1QNTA 4DV5E 3ADGA 2EPNA 3HQ1A 2WZOA 1T4NA 4JI1E 3H09A 2EN6A 4Q28A 4HTGA 1MGTA 3AV0A 4R2SA 2YSPA 5KL4A 2EPUA 2RSIA 1WJPA 4JI6E 2JYAA 5KL2A 1LLMC 1RQ0A 5LMUE 5AC4A 2HC5A 2EMAA 4AQYE 1IBME 1XNQE 2E1MA 1YUJA 4NZVA 1A1FA 4JI0E 3P1XA 5AE1A 2L6MA 2YSOA 1YPNA 3JTZA 1GQEA 1YZ9A 3DF6A 2JP9A 1WXRA 5KL6A 4JI7E 1YYWA 4MLVA 2LJHA 4I8OA 2EPMX 3LLHA 4L5NC 3J7Yp 4Q35B 1IBKE 4GKKE 5A2QC 4DV0E 2BBGA 2BB8A 4WSGA 4BBYA 2ODRC 2B3TB 1ZAAC 2UUBE 1NCSA 2I13A 2EPCA 2RS6A 1ZBTA 2PRTA 2KOUA 2L92A 5IV8B 2EORA 4F2JC 3EPKA 3KZYA 2CSHA 3J80C 2MKNA 2EM0A 2EOQA 2Q8UA 3F6GA 1DGCA 1UILA 4JI8E 2J7JA 4R2AA 2YRHA 1X47A 1DI2A 1X49A 1HNXE 2LBSB 2EOSA 5AE3A 2EPPA 1A1KA 2L2KB 2EP3A 4ZYHA 4LF8E 3F6HA 2ENHA 1UN6B 2YTPA 3HXLA 2M4IA 1T38A 2NABA 2YWQA 3C4BA 4FK5C 3IWBA 4RHBB 4IJDA 2EN3A 2B9DA 2EN8A 2EQ1A 1I94E 4JYAE 5AASA 4WSPA 1N33E 2A25A 4ZYEA 4O24A 1GZ6A 4GEQB 4OX9E 2UXDE 2MC6A 1WRJA 3QG5C 2EOIA 2LO3A 1ZR9A 2VE7C 2YTOA 2EPOA 2VQFE 3IWCA 4NXNE 5FLXC 4P78A 2EM3A 1FKAE 2MKDA 2EMYA 4X62E 4N4RB 1J26A 5A69A 2DLQA 1AH5A 2VQEE 2GLIA 2DIXA 3ADLA 2EOOA 4WFTA 4DUZE 4DR2E 2EM5A 4B3ME 1BB8A 2EOHA 2D9HA 4OOGC 2GHFA 2EOXA 4YHHE 5AE2A 2DGCA 4WXDA 5IXMB 2NUGA 5A6JA 4BHCA 3EPHA 4P7DA 2V83A 1EH8A 1PDAA 1J5EE 2EPKX 2EL4A 2ELYA 4GKJE 2FGGA 1JK2A 1IQOA 4LF7E 3BGHA 2YPNA 3J7AG 2JWOA 4X8WA 4JI3E 1A1LA 5T6JA 4BMJA 3VK6A 2HJJA 4LF6E 1T4LB 2UUCE 2ELZA 1F2IG 1PJQA 2LTRA 4M0VA 1WHNA 3VHTB 4DV2E 4DV4E 4LFCE 2YU5A 2I9IA 2EMBA 4LU9A 2UUAE 1TN9A 5TSEA 1ZU1A 2EM8A 4GZNC 5CFFE 2K4VA 2ENAA 4DR5E 2YTIA 2LJUA 2ODRD 4M30A 5A6KA 2JVAA 4HEIA 1EKZA 2L2NA 2JY9A 3OTOE 2V87A 2EJ4A 2EPZA 2EMFA 1IBLE 2M9AA 2ADRA 2EMWA 2EPXA 2EL5A 2GPIA 5LLQA 3DJWA 2V85A 2LCEA 2EMXA 2YT4A 4O5GA 2F8BA 2EOEA 4NXME 1XMOE 2MC5A 4DR4E 4JI4E 2L3JA 2EOYA 2ZM6E 2RSMA 4B3SE 4DV7E 2RPCA 4B3TE 4B3RE 2FTXB 2DMYA 3HPSA 2YZTA 2V89A 2EOMA 1RMDA 2V86A 4DV1E 3ADJA 2M1SA 2EM2A 2N3HA 2YTJA 4R03A 4DV6E 1YYOA 2R76A 1YSAC 2LE2A 1BBOA 2F4VE 2EMLA 2L8TA 2L3CA 2JXPA 2EN4A 2LV2A 4M9VC 2N3GA 2EOZA 5ADZA 1T4OA 1WHQA 1YFHA 1HNZE 2EM4A 1IMUA 1XMQE 4KWYA 4LF4E
chains in the Genus database with same CATH topology
4R2SA 2YSPA 2GLIA 5KL4A 2EPUA 4R2DA 2EOOA 2RSIA 2EM5A 1WJPA 2EM9A 5KL2A 1LLMC 1BB8A 2EOHA 2MDGA 1TF3A 2D9HA 2GHFA 5KL3A 2EMAA 2EOXA 2WCC3 1X3CA 2DGCA 4F6NA 2DMIA 2EN1A 1YUJA 1A1FA 3EPHA 1YUIA 4R2CA 1KJKA 4R2EA 2EMGA 2YSOA 2EN7A 2YTFA 4R2QA 2EM7A 1X6HA 2EL4A 2JP9A 2ELYA 2LT7A 5KL5A 1JK2A 5KL6A 2EL6A 2ENCA 1JK1A 2DLKA 2YTGA 1A1JA 1A1LA 1TF6A 2BB8A 4WSGA 2EQ3A 2EPAA 4IS1C 1ZAAC 1NCSA 2I13A 2EMHA 2EPCA 2WBSA 2EMIA 2PRTA 2ELZA 4X9JA 1F2IG 1UBDC 1G2DC 2EMKA 2EPRA 3VHTB 2EOFA 2EORA 2CTDA 4F2JC 3EPKA 2YU5A 2CSHA 2EMBA 3EPJA 2YU8A 2LVHA 1TN9A 2R1FA 2EM8A 2EM6A 1ZU1A 2EM0A 2EOQA 4GZNC 2MKNA 1DGCA 2YRKA 3UK3C 1A1HA 2ENAA 2YTIA 3MHHC 2J7JA 4R2AA 2EE8A 2YRHA 2EOSA 1P47A 2EMCA 4R2RA 2EPPA 1A1KA 1A1IA 2EJ4A 2EP3A 2EMFA 2EPZA 2VRDA 2M9AA 4R2PA 2ENHA 2ADRA 1X5WA 2EN2A 1UN6B 2EMWA 2YTPA 2EPXA 2EL5A 2NABA 1A1GA 5KL7A 4FK5C 2LCEA 2EMXA 2YRMA 1Z1BA 4IJDA 2E72A 2EN3A 2EN8A 3EPLA 1X6EA 2EOEA 2EQ1A 1B69A 1G2FC 2DRPA 2EOYA 2HGHA 2A25A 4F6MA 2EQ0A 2RPCA 2EOJA 2WBUA 3MHSC 2EOMA 1RMDA 2EM2A 2YTJA 1X6FA 2EMZA 2YTEA 2EOIA 2YTNA 2LO3A 1ZR9A 1MEYC 2YTDA 2YTOA 1YSAC 2CT1A 2WBTA 1BBOA 2EMLA 2EN4A 2LV2A 3M99B 4M9VC 2YTQA 2JPAA 1AAYA 2EOZA 2EM3A 2MKDA 2EMYA 2EM4A 2EN6A 2DLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2S A;  2YSP A;  2GLI A;  5KL4 A;  2EPU A;  4R2D A;  2EOO A;  2RSI A;  2EM5 A;  1WJP A;  2EM9 A;  5KL2 A;  1LLM C;  1BB8 A;  2EOH A;  2MDG A;  1TF3 A;  2D9H A;  2GHF A;  5KL3 A;  2EMA A;  2EOX A;  2WCC 3;  1X3C A;  2DGC A;  4F6N A;  2DMI A;  2EN1 A;  1YUJ A;  1A1F A;  3EPH A;  1YUI A;  4R2C A;  1KJK A;  4R2E A;  2EMG A;  2YSO A;  2EN7 A;  2YTF A;  4R2Q A;  2EM7 A;  1X6H A;  2EL4 A;  2JP9 A;  2ELY A;  2LT7 A;  5KL5 A;  1JK2 A;  5KL6 A;  2EL6 A;  2ENC A;  1JK1 A;  2DLK A;  2YTG A;  1A1J A;  1A1L A;  1TF6 A;  2BB8 A;  4WSG A;  2EQ3 A;  2EPA A;  4IS1 C;  1ZAA C;  1NCS A;  2I13 A;  2EMH A;  2EPC A;  2WBS A;  2EMI A;  2PRT A;  2ELZ A;  4X9J A;  1F2I G;  1UBD C;  1G2D C;  2EMK A;  2EPR A;  3VHT B;  2EOF A;  2EOR A;  2CTD A;  4F2J C;  3EPK A;  2YU5 A;  2CSH A;  2EMB A;  3EPJ A;  2YU8 A;  2LVH A;  1TN9 A;  2R1F A;  2EM8 A;  2EM6 A;  1ZU1 A;  2EM0 A;  2EOQ A;  4GZN C;  2MKN A;  1DGC A;  2YRK A;  3UK3 C;  1A1H A;  2ENA A;  2YTI A;  3MHH C;  2J7J A;  4R2A A;  2EE8 A;  2YRH A;  2EOS A;  1P47 A;  2EMC A;  4R2R A;  2EPP A;  1A1K A;  1A1I A;  2EJ4 A;  2EP3 A;  2EMF A;  2EPZ A;  2VRD A;  2M9A A;  4R2P A;  2ENH A;  2ADR A;  1X5W A;  2EN2 A;  1UN6 B;  2EMW A;  2YTP A;  2EPX A;  2EL5 A;  2NAB A;  1A1G A;  5KL7 A;  4FK5 C;  2LCE A;  2EMX A;  2YRM A;  1Z1B A;  4IJD A;  2E72 A;  2EN3 A;  2EN8 A;  3EPL A;  1X6E A;  2EOE A;  2EQ1 A;  1B69 A;  1G2F C;  2DRP A;  2EOY A;  2HGH A;  2A25 A;  4F6M A;  2EQ0 A;  2RPC A;  2EOJ A;  2WBU A;  3MHS C;  2EOM A;  1RMD A;  2EM2 A;  2YTJ A;  1X6F A;  2EMZ A;  2YTE A;  2EOI A;  2YTN A;  2LO3 A;  1ZR9 A;  1MEY C;  2YTD A;  2YTO A;  1YSA C;  2CT1 A;  2WBT A;  1BBO A;  2EML A;  2EN4 A;  2LV2 A;  3M99 B;  4M9V C;  2YTQ A;  2JPA A;  1AAY A;  2EOZ A;  2EM3 A;  2MKD A;  2EMY A;  2EM4 A;  2EN6 A;  2DLQ A; 
#chains in the Genus database with same CATH topology
 1L4S A;  5IWA E;  2MDR A;  2MDG A;  1TF3 A;  2RS7 A;  3FIG A;  5KL3 A;  2WCC 3;  5AC5 A;  1X3C A;  4F6N A;  3KZZ A;  2EN1 A;  2LTS A;  4TUI A;  1YUI A;  4R2C A;  4LF5 E;  2EMG A;  2UU9 E;  4DR6 E;  5BR8 E;  1RC7 A;  4R2Q A;  2HHH E;  1X6H A;  4M2Z A;  2V8Q B;  1UHZ A;  4DUY E;  5A6B D;  2EL6 A;  2ENC A;  4WX9 A;  1N36 E;  1ZBQ A;  2DLK A;  4DR1 E;  4BC9 A;  5A6A A;  3T1H E;  1A1J A;  1TF6 A;  1N34 E;  2EQ3 A;  4IS1 C;  4JI5 E;  1XNR E;  4J8Z A;  3VYX A;  2EMI A;  4R8O A;  4RH8 A;  2JR1 A;  4ZYD A;  1UBD C;  3BID A;  2UXC E;  1G2D C;  4JI2 E;  1DQ3 A;  2EMK A;  4DV3 E;  2LUQ A;  3EPJ A;  2YU8 A;  2LVH A;  4X65 E;  2R1F A;  3C6K A;  4TUG A;  2N8X A;  3MSW A;  3LML A;  2H36 X;  2YRK A;  1A1H A;  3MHH C;  4KZS A;  4DR3 E;  4BCA A;  1A1I A;  5LL6 R;  2LUP B;  4K0K E;  4ZYG A;  4R2P A;  2VRD A;  1FJG E;  1X5W A;  3ECR A;  1O0W A;  2EN2 A;  3T1Y E;  4BHB A;  4LTY A;  1EH7 A;  4DKK A;  2YRM A;  1Z1B A;  2FV4 B;  2L33 A;  2E72 A;  3EPL A;  1X6E A;  2RTX A;  2UXB E;  1N3G A;  3VYY A;  1KYQ A;  4WYQ B;  3JU0 A;  1G2F C;  3J81 C;  3JAM C;  2EQ0 A;  2EOJ A;  3BF2 A;  3MHS C;  2KON A;  2JOB A;  2NUE A;  2VF1 A;  3ADI A;  1GTK A;  2EPL X;  1PKP A;  1T39 A;  1X6F A;  1YYK A;  2CPN A;  2DSY A;  4WPY A;  2YTD A;  2CT1 A;  4DMI A;  3THO B;  1BBG A;  3M99 B;  2YTQ A;  3AUZ A;  2JPA A;  1AAY A;  3ZOQ B;  4X64 E;  1QU6 A;  2HGH A;  4KHP E;  1NEI A;  3K6Q A;  4R2D A;  1PJS A;  2EM9 A;  2V88 A;  2LMZ A;  2DMI A;  2DB2 A;  3HTX A;  1KJK A;  4R2E A;  4X66 E;  2EN7 A;  2YTF A;  4F9A B;  1STU A;  2EM7 A;  4WXC A;  3C4T A;  3KWR A;  4BS9 A;  1PJT A;  5F3W A;  2LT7 A;  5KL5 A;  1JK1 A;  2YTG A;  2IHR 1;  2EPA A;  3C6M A;  2B7T A;  2EMH A;  2EWL A;  1HR0 E;  2WBS A;  3HPZ A;  4X9J A;  4BC7 A;  3RMP A;  3BBG A;  2EPR A;  2M7Q A;  2EOF A;  2KHX A;  2CTD A;  4O4K A;  3OML A;  2L2M A;  3IWD A;  4MLQ A;  5IT9 C;  1SFE A;  2EM6 A;  3L00 A;  4F54 A;  3UK3 C;  4LF9 E;  4YY3 E;  5A6B A;  3TQM A;  2EE8 A;  2K7I A;  2EZ6 A;  2JOX A;  1P47 A;  2G7H A;  5DNY A;  2EMC A;  4R2R A;  5LMN E;  1A1G A;  5KL7 A;  2B7V A;  1HNW E;  4F9C B;  2NA2 A;  2LRS A;  2RQL A;  1B69 A;  4F9B B;  2NUF A;  2DRP A;  4LFA E;  4O43 A;  4F6M A;  1X48 A;  1IQS A;  4L8N A;  2WBU A;  1N32 E;  1EH6 A;  4LFB E;  3EQ1 A;  2EMZ A;  2YTE A;  2E5L E;  4JV5 E;  2YTN A;  1MEY C;  1SR9 A;  2WBT A;  4NHR A;  3THN A;  4DR7 E;  1QNT A;  4DV5 E;  3ADG A;  2EPN A;  3HQ1 A;  2WZO A;  1T4N A;  4JI1 E;  3H09 A;  2EN6 A;  4Q28 A;  4HTG A;  1MGT A;  3AV0 A;  4R2S A;  2YSP A;  5KL4 A;  2EPU A;  2RSI A;  1WJP A;  4JI6 E;  2JYA A;  5KL2 A;  1LLM C;  1RQ0 A;  5LMU E;  5AC4 A;  2HC5 A;  2EMA A;  4AQY E;  1IBM E;  1XNQ E;  2E1M A;  1YUJ A;  4NZV A;  1A1F A;  4JI0 E;  3P1X A;  5AE1 A;  2L6M A;  2YSO A;  1YPN A;  3JTZ A;  1GQE A;  1YZ9 A;  3DF6 A;  2JP9 A;  1WXR A;  5KL6 A;  4JI7 E;  1YYW A;  4MLV A;  2LJH A;  4I8O A;  2EPM X;  3LLH A;  4L5N C;  3J7Y p;  4Q35 B;  1IBK E;  4GKK E;  5A2Q C;  4DV0 E;  2BBG A;  2BB8 A;  4WSG A;  4BBY A;  2ODR C;  2B3T B;  1ZAA C;  2UUB E;  1NCS A;  2I13 A;  2EPC A;  2RS6 A;  1ZBT A;  2PRT A;  2KOU A;  2L92 A;  5IV8 B;  2EOR A;  4F2J C;  3EPK A;  3KZY A;  2CSH A;  3J80 C;  2MKN A;  2EM0 A;  2EOQ A;  2Q8U A;  3F6G A;  1DGC A;  1UIL A;  4JI8 E;  2J7J A;  4R2A A;  2YRH A;  1X47 A;  1DI2 A;  1X49 A;  1HNX E;  2LBS B;  2EOS A;  5AE3 A;  2EPP A;  1A1K A;  2L2K B;  2EP3 A;  4ZYH A;  4LF8 E;  3F6H A;  2ENH A;  1UN6 B;  2YTP A;  3HXL A;  2M4I A;  1T38 A;  2NAB A;  2YWQ A;  3C4B A;  4FK5 C;  3IWB A;  4RHB B;  4IJD A;  2EN3 A;  2B9D A;  2EN8 A;  2EQ1 A;  1I94 E;  4JYA E;  5AAS A;  4WSP A;  1N33 E;  2A25 A;  4ZYE A;  4O24 A;  1GZ6 A;  4GEQ B;  4OX9 E;  2UXD E;  2MC6 A;  1WRJ A;  3QG5 C;  2EOI A;  2LO3 A;  1ZR9 A;  2VE7 C;  2YTO A;  2EPO A;  2VQF E;  3IWC A;  4NXN E;  5FLX C;  4P78 A;  2EM3 A;  1FKA E;  2MKD A;  2EMY A;  4X62 E;  4N4R B;  1J26 A;  5A69 A;  2DLQ A;  1AH5 A;  2VQE E;  2GLI A;  2DIX A;  3ADL A;  2EOO A;  4WFT A;  4DUZ E;  4DR2 E;  2EM5 A;  4B3M E;  1BB8 A;  2EOH A;  2D9H A;  4OOG C;  2GHF A;  2EOX A;  4YHH E;  5AE2 A;  2DGC A;  4WXD A;  5IXM B;  2NUG A;  5A6J A;  4BHC A;  3EPH A;  4P7D A;  2V83 A;  1EH8 A;  1PDA A;  1J5E E;  2EPK X;  2EL4 A;  2ELY A;  4GKJ E;  2FGG A;  1JK2 A;  1IQO A;  4LF7 E;  3BGH A;  2YPN A;  3J7A G;  2JWO A;  4X8W A;  4JI3 E;  1A1L A;  5T6J A;  4BMJ A;  3VK6 A;  2HJJ A;  4LF6 E;  1T4L B;  2UUC E;  2ELZ A;  1F2I G;  1PJQ A;  2LTR A;  4M0V A;  1WHN A;  3VHT B;  4DV2 E;  4DV4 E;  4LFC E;  2YU5 A;  2I9I A;  2EMB A;  4LU9 A;  2UUA E;  1TN9 A;  5TSE A;  1ZU1 A;  2EM8 A;  4GZN C;  5CFF E;  2K4V A;  2ENA A;  4DR5 E;  2YTI A;  2LJU A;  2ODR D;  4M30 A;  5A6K A;  2JVA A;  4HEI A;  1EKZ A;  2L2N A;  2JY9 A;  3OTO E;  2V87 A;  2EJ4 A;  2EPZ A;  2EMF A;  1IBL E;  2M9A A;  2ADR A;  2EMW A;  2EPX A;  2EL5 A;  2GPI A;  5LLQ A;  3DJW A;  2V85 A;  2LCE A;  2EMX A;  2YT4 A;  4O5G A;  2F8B A;  2EOE A;  4NXM E;  1XMO E;  2MC5 A;  4DR4 E;  4JI4 E;  2L3J A;  2EOY A;  2ZM6 E;  2RSM A;  4B3S E;  4DV7 E;  2RPC A;  4B3T E;  4B3R E;  2FTX B;  2DMY A;  3HPS A;  2YZT A;  2V89 A;  2EOM A;  1RMD A;  2V86 A;  4DV1 E;  3ADJ A;  2M1S A;  2EM2 A;  2N3H A;  2YTJ A;  4R03 A;  4DV6 E;  1YYO A;  2R76 A;  1YSA C;  2LE2 A;  1BBO A;  2F4V E;  2EML A;  2L8T A;  2L3C A;  2JXP A;  2EN4 A;  2LV2 A;  4M9V C;  2N3G A;  2EOZ A;  5ADZ A;  1T4O A;  1WHQ A;  1YFH A;  1HNZ E;  2EM4 A;  1IMU A;  1XMQ E;  4KWY A;  4LF4 E; 
#chains in the Genus database with same CATH homology
 4R2S A;  2YSP A;  2GLI A;  5KL4 A;  2EPU A;  4R2D A;  2EOO A;  2RSI A;  2EM5 A;  1WJP A;  2EM9 A;  5KL2 A;  1LLM C;  1BB8 A;  2EOH A;  2MDG A;  1TF3 A;  2D9H A;  2GHF A;  5KL3 A;  2EMA A;  2EOX A;  2WCC 3;  1X3C A;  2DGC A;  4F6N A;  2DMI A;  2EN1 A;  1YUJ A;  1A1F A;  3EPH A;  1YUI A;  4R2C A;  1KJK A;  4R2E A;  2EMG A;  2YSO A;  2EN7 A;  2YTF A;  4R2Q A;  2EM7 A;  1X6H A;  2EL4 A;  2JP9 A;  2ELY A;  2LT7 A;  5KL5 A;  1JK2 A;  5KL6 A;  2EL6 A;  2ENC A;  1JK1 A;  2DLK A;  2YTG A;  1A1J A;  1A1L A;  1TF6 A;  2BB8 A;  4WSG A;  2EQ3 A;  2EPA A;  4IS1 C;  1ZAA C;  1NCS A;  2I13 A;  2EMH A;  2EPC A;  2WBS A;  2EMI A;  2PRT A;  2ELZ A;  4X9J A;  1F2I G;  1UBD C;  1G2D C;  2EMK A;  2EPR A;  3VHT B;  2EOF A;  2EOR A;  2CTD A;  4F2J C;  3EPK A;  2YU5 A;  2CSH A;  2EMB A;  3EPJ A;  2YU8 A;  2LVH A;  1TN9 A;  2R1F A;  2EM8 A;  2EM6 A;  1ZU1 A;  2EM0 A;  2EOQ A;  4GZN C;  2MKN A;  1DGC A;  2YRK A;  3UK3 C;  1A1H A;  2ENA A;  2YTI A;  3MHH C;  2J7J A;  4R2A A;  2EE8 A;  2YRH A;  2EOS A;  1P47 A;  2EMC A;  4R2R A;  2EPP A;  1A1K A;  1A1I A;  2EJ4 A;  2EP3 A;  2EMF A;  2EPZ A;  2VRD A;  2M9A A;  4R2P A;  2ENH A;  2ADR A;  1X5W A;  2EN2 A;  1UN6 B;  2EMW A;  2YTP A;  2EPX A;  2EL5 A;  2NAB A;  1A1G A;  5KL7 A;  4FK5 C;  2LCE A;  2EMX A;  2YRM A;  1Z1B A;  4IJD A;  2E72 A;  2EN3 A;  2EN8 A;  3EPL A;  1X6E A;  2EOE A;  2EQ1 A;  1B69 A;  1G2F C;  2DRP A;  2EOY A;  2HGH A;  2A25 A;  4F6M A;  2EQ0 A;  2RPC A;  2EOJ A;  2WBU A;  3MHS C;  2EOM A;  1RMD A;  2EM2 A;  2YTJ A;  1X6F A;  2EMZ A;  2YTE A;  2EOI A;  2YTN A;  2LO3 A;  1ZR9 A;  1MEY C;  2YTD A;  2YTO A;  1YSA C;  2CT1 A;  2WBT A;  1BBO A;  2EML A;  2EN4 A;  2LV2 A;  3M99 B;  4M9V C;  2YTQ A;  2JPA A;  1AAY A;  2EOZ A;  2EM3 A;  2MKD A;  2EMY A;  2EM4 A;  2EN6 A;  2DLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...