2YTQA

Solution structure of the c2h2 type zinc finger (region 775-807) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGAGEKPYGCSECGKAFSSKSYLIIHMRTHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 775-807) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytqA01
2EN1A 1RMDA 2EMGA 2YSPA 2DLKA 2ADRA 1A1IA 1X6EA 2EE8A 2CTDA 2YU8A 4F6NA 2EMCA 3EPLA 2EN7A 2EOSA 2RSIA 2EL4A 1DGCA 2YSOA 2EPXA 1TN9A 2EN8A 4R2QA 2EQ1A 2MKNA 2ENHA 2MKDA 1UN6B 2JP9A 2EMLA 2YTDA 1X6FA 3EPKA 2EMYA 2EN3A 2WBUA 1X6HA 1F2IG 2WBSA 1YUJA 2EM2A 1A1JA 2EN2A 5KL7A 2EPCA 2YTIA 4GZNC 5KL2A 3M99B 1JK2A 1G2DC 2EPZA 3EPJA 2EM0A 2YTPA 2EM9A 1A1HA 2EMIA 4IS1C 2D9HA 2EMWA 2A25A 2EMKA 2YTQA 5KL5A 1A1FA 2ELZA 2EOQA 1NCSA 2EMFA 2EPPA 2EPUA 2ENCA 2J7JA 2EORA 2EOEA 2YRKA 1MEYC 2ELYA 2EJ4A 4WSGA 2EOOA 4R2EA 2YTFA 2LV2A 2DMIA 2JPAA 2YTJA 2RPCA 4F2JC 2LO3A 2HGHA 1A1GA 1ZAAC 2EMZA 3UK3C 2YTNA 1Z1BA 1BB8A 2VRDA 3MHHC 2EL5A 2NABA 4M9VC 1YSAC 2EMHA 2WCC3 2EOYA 2R1FA 4F6MA 1BBOA 2GLIA 4X9JA 4IJDA 2I13A 2EPRA 4R2RA 2YTOA 2EN4A 1YUIA 4R2SA 2EOHA 2MDGA 2E72A 2EM3A 2EOJA 2YRHA 4FK5C 3VHTB 2EM7A 4R2DA 2EM6A 3MHSC 2EPAA 1A1LA 2EMAA 2BB8A 2EN6A 2WBTA 1X3CA 1X5WA 1TF3A 2EMBA 2DGCA 2YTEA 1TF6A 2EM5A 1ZR9A 2EM4A 1G2FC 1B69A 1P47A 2YRMA 2EOMA 2LT7A 1A1KA 2EL6A 2EP3A 2ENAA 5KL4A 1WJPA 2EM8A 2EOZA 2M9AA 2EOXA 1KJKA 2CSHA 2EMXA 2EOFA 2YTGA 1UBDC 4R2CA 5KL6A 4R2PA 1JK1A 2EQ0A 2CT1A 4R2AA 2EQ3A 1LLMC 2DLQA 2YU5A 5KL3A 2LCEA 2EOIA 1AAYA 2PRTA 3EPHA 2LVHA 2GHFA 1ZU1A 2DRPA
chains in the Genus database with same CATH superfamily
1WHNA 4JV5E 4WSPA 2V83A 5A6AA 2HJJA 2CTDA 4F6NA 1WXRA 2EPLX 3EPLA 2EL4A 3HPSA 4R2QA 2UXDE 1YPNA 3ECRA 4JI0E 2MKNA 2VF1A 2UXBE 4DR7E 2ENHA 2V8QB 1UN6B 3OTOE 1T38A 4LU9A 2YTDA 5F3WA 1BBGA 2EN3A 2ODRD 1IBME 2EPOA 2EM2A 2LRSA 4GZNC 3LLHA 4YY3E 4X65E 2MC5A 5IV8B 5DNYA 5A6KA 4DV5E 2EMIA 4X66E 2A25A 5KL5A 3DJWA 5IXMB 2ENCA 5CFFE 2JOBA 1GTKA 4WYQB 5AC4A 2VQFE 1MEYC 3JTZA 1X48A 5LMNE 4JI4E 5A6BD 2JWOA 2IHR1 2YTFA 2JVAA 2M7QA 4L5NC 2YTJA 2RPCA 2F8BA 1SFEA 4LF4E 2YPNA 4JI2E 5A6BA 2EL5A 1YSAC 3KZYA 2G7HA 4KWYA 5IT9C 4IJDA 4WFTA 1IQSA 2B7TA 4B3ME 2UUBE 4RHBB 2EOHA 2EOJA 2EM3A 2YRHA 3VHTB 2EM7A 1YYOA 4F9AB 4RH8A 2EPAA 1IBKE 3RMPA 2KOUA 3HPZA 4JI6E 4OOGC 2VE7C 4M2ZA 2EMBA 2UXCE 2JY9A 4WX9A 1TF6A 4JI1E 2EM4A 4DV4E 5LMUE 1A1KA 4LTYA 1QU6A 1WJPA 2EM8A 2EPKX 1ZBTA 5KL6A 4R2PA 4R2AA 3F6HA 1I94E 2LCEA 2EOIA 1AAYA 2L8TA 1FKAE 5FLXC 2DRPA 4O24A 1SR9A 3VYYA 2EN1A 2V87A 4WXDA 1UHZA 1IBLE 2EE8A 2YU8A 1HR0E 2EMCA 4P7DA 2EOSA 2YSOA 4I8OA 4M0VA 4DV3E 3J7AG 4P78A 2H36X 2JP9A 2EMLA 1IMUA 4WPYA 3EPKA 1EKZA 4TUIA 4BBYA 2GPIA 2N3HA 2EPCA 2YTIA 1PDAA 1JK2A 2EPZA 3EPJA 3HTXA 3T1HE 4DUYE 1T39A 1RQ0A 2EMWA 5AE1A 2ELZA 2LTSA 1YZ9A 2EMFA 2VQEE 2EPUA 3L00A 2L3JA 2J7JA 2EORA 2YT4A 5AE2A 2F4VE 1X47A 2EOEA 2JXPA 2N8XA 2YRKA 1T4NA 4O5GA 2NUGA 2EOOA 4R2EA 4JI3E 2LV2A 2EWLA 2LO3A 4LFAE 1XNQE 1A1GA 3C4TA 3UK3C 1BB8A 2VRDA 2LJUA 4WXCA 2WCC3 4F6MA 1BBOA 3TQMA 5ADZA 3FIGA 2DB2A 1AH5A 4JYAE 1IQOA 1ZBQA 2EN4A 1N33E 5A2QC 2M4IA 5TSEA 4FK5C 2WZOA 3BIDA 4DUZE 3MHSC 3J80C 4J8ZA 1EH7A 2WBTA 2V89A 4Q35B 5IWAE 4DMIA 4BCAA 5AE3A 1TF3A 2YWQA 1G2FC 2LMZA 2LE2A 2HC5A 4DV6E 1P47A 1B69A 2NUFA 1STUA 2EOMA 2LT7A 2EL6A 2L2MA 2ENAA 2EOZA 2EOXA 2EMXA 5LL6R 2EOFA 4F9BB 3BGHA 1UBDC 4R2CA 1JK1A 4DR4E 2EQ0A 3AV0A 5KL3A 4F9CB 2GHFA 2EZ6A 1WHQA 2EMGA 1RC7A 1YYWA 2DLKA 4BC9A 2ADRA 1A1IA 1X6EA 4B3RE 3JAMC 4DR3E 1DGCA 2EN8A 4B3SE 4LF8E 4NXME 3ADGA 2DIXA 5AASA 2L2KB 1X6FA 4K0KE 4NHRA 2K4VA 2L92A 2WBUA 3ADLA 4DV7E 1F2IG 2WBSA 1YUJA 4JI7E 2L3CA 4HTGA 5KL2A 4BC7A 1G2DC 4NZVA 2L6MA 2YTPA 5LLQA 3HQ1A 1A1HA 3IWCA 1PJSA 3H09A 2EMKA 1A1FA 2FV4B 4DR2E 4DR5E 3ADIA 2EOQA 4BHBA 4MLVA 3VK6A 4TUGA 4DV1E 2L33A 4AQYE 3ZOQB 1N3GA 2LBSB 2FTXB 3AUZA 4R03A 4O4KA 1O0WA 3J81C 2EJ4A 4WSGA 1PKPA 4R8OA 2Q8UA 4ZYDA 4DR1E 4NXNE 3IWBA 3BBGA 1T4LB 2M1SA 1ZAAC 3OMLA 4ZYEA 1UILA 2DSYA 2ZM6E 4M9VC 1N32E 1YYKA 2EOYA 2R1FA 3THOB 2GLIA 1PJQA 4X9JA 2I13A 2EPMX 2V86A 4BHCA 3F6GA 3IWDA 2EPRA 4R2RA 4N4RB 2YTOA 2DMYA 1YUIA 2B3TB 4R2SA 2E72A 4OX9E 4R2DA 1HNXE 1DQ3A 4LF9E 1A1LA 1KYQA 2BB8A 2EMAA 1FJGE 2EN6A 1T4OA 1X5WA 3ADJA 2DGCA 2YTEA 2EM5A 1ZR9A 5A6JA 2V85A 4GEQB 2MDRA 1PJTA 2RSMA 1NEIA 1HNWE 1KJKA 3DF6A 2CSHA 3C6MA 2YTGA 1EH8A 2RQLA 2L2NA 4ZYGA 1LLMC 4KZSA 2YU5A 4DKKA 2CPNA 4M30A 2PRTA 4B3TE 3EPHA 1Z1BA 1EH6A 3JU0A 1RMDA 2R76A 1HNZE 2YSPA 4Q28A 3J7Yp 2LUQA 2KONA 4LFBE 4O43A 2EN7A 2RSIA 1TN9A 2EPXA 2EQ1A 2JR1A 2KHXA 3K6QA 2MKDA 1WRJA 4L8NA 2EPNA 2EMYA 1XMOE 4ZYHA 2RS6A 1X6HA 2YZTA 5AC5A 2UUAE 1A1JA 2EN2A 5KL7A 1YFHA 3M99B 1QNTA 1J5EE 2EM0A 2EM9A 2B7VA 2N3GA 2LJHA 4IS1C 2D9HA 2YTQA 1XMQE 2RTXA 4X62E 4DV2E 1NCSA 3EQ1A 2EPPA 2E1MA 5A69A 4GKKE 3QG5C 2K7IA 4DV0E 3VYXA 2HHHE 2MC6A 2ELYA 5T6JA 4MLQA 4BMJA 4HEIA 1MGTA 1GZ6A 2JPAA 2DMIA 4GKJE 3MSWA 2ODRC 4YHHE 4F2JC 3HXLA 2HGHA 2RS7A 1XNRE 4BS9A 2EMZA 2YTNA 1N34E 3MHHC 2NABA 2EMHA 4F54A 4X64E 2I9IA 3KWRA 2V88A 2MDGA 3BF2A 1X49A 1J26A 2EM6A 1DI2A 2B9DA 4DR6E 3C4BA 4X8WA 5BR8E 2E5LE 2NUEA 3T1YE 1X3CA 4LF7E 2UUCE 4JI8E 4JI5E 3C6KA 2LUPB 3KZZA 3LMLA 2LTRA 4LF5E 2YRMA 1GQEA 2UU9E 2EP3A 4LF6E 5KL4A 4LFCE 3THNA 2M9AA 4KHPE 1N36E 2JOXA 2CT1A 2EQ3A 2NA2A 1L4SA 2BBGA 2DLQA 2FGGA 2JYAA 2LVHA 1ZU1A 3P1XA
chains in the Genus database with same CATH topology
2EN1A 1RMDA 2EMGA 2YSPA 2DLKA 2ADRA 1A1IA 1X6EA 2EE8A 2CTDA 2YU8A 4F6NA 2EMCA 3EPLA 2EN7A 2EOSA 2RSIA 2EL4A 1DGCA 2YSOA 2EPXA 1TN9A 2EN8A 4R2QA 2EQ1A 2MKNA 2ENHA 2MKDA 1UN6B 2JP9A 2EMLA 2YTDA 1X6FA 3EPKA 2EMYA 2EN3A 2WBUA 1X6HA 1F2IG 2WBSA 1YUJA 2EM2A 1A1JA 2EN2A 5KL7A 2EPCA 2YTIA 4GZNC 5KL2A 3M99B 1JK2A 1G2DC 2EPZA 3EPJA 2EM0A 2YTPA 2EM9A 1A1HA 2EMIA 4IS1C 2D9HA 2EMWA 2A25A 2EMKA 2YTQA 5KL5A 1A1FA 2ELZA 2EOQA 1NCSA 2EMFA 2EPPA 2EPUA 2ENCA 2J7JA 2EORA 2EOEA 2YRKA 1MEYC 2ELYA 2EJ4A 4WSGA 2EOOA 4R2EA 2YTFA 2LV2A 2DMIA 2JPAA 2YTJA 2RPCA 4F2JC 2LO3A 2HGHA 1A1GA 1ZAAC 2EMZA 3UK3C 2YTNA 1Z1BA 1BB8A 2VRDA 3MHHC 2EL5A 2NABA 4M9VC 1YSAC 2EMHA 2WCC3 2EOYA 2R1FA 4F6MA 1BBOA 2GLIA 4X9JA 4IJDA 2I13A 2EPRA 4R2RA 2YTOA 2EN4A 1YUIA 4R2SA 2EOHA 2MDGA 2E72A 2EM3A 2EOJA 2YRHA 4FK5C 3VHTB 2EM7A 4R2DA 2EM6A 3MHSC 2EPAA 1A1LA 2EMAA 2BB8A 2EN6A 2WBTA 1X3CA 1X5WA 1TF3A 2EMBA 2DGCA 2YTEA 1TF6A 2EM5A 1ZR9A 2EM4A 1G2FC 1B69A 1P47A 2YRMA 2EOMA 2LT7A 1A1KA 2EL6A 2EP3A 2ENAA 5KL4A 1WJPA 2EM8A 2EOZA 2M9AA 2EOXA 1KJKA 2CSHA 2EMXA 2EOFA 2YTGA 1UBDC 4R2CA 5KL6A 4R2PA 1JK1A 2EQ0A 2CT1A 4R2AA 2EQ3A 1LLMC 2DLQA 2YU5A 5KL3A 2LCEA 2EOIA 1AAYA 2PRTA 3EPHA 2LVHA 2GHFA 1ZU1A 2DRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN1 A;  1RMD A;  2EMG A;  2YSP A;  2DLK A;  2ADR A;  1A1I A;  1X6E A;  2EE8 A;  2CTD A;  2YU8 A;  4F6N A;  2EMC A;  3EPL A;  2EN7 A;  2EOS A;  2RSI A;  2EL4 A;  1DGC A;  2YSO A;  2EPX A;  1TN9 A;  2EN8 A;  4R2Q A;  2EQ1 A;  2MKN A;  2ENH A;  2MKD A;  1UN6 B;  2JP9 A;  2EML A;  2YTD A;  1X6F A;  3EPK A;  2EMY A;  2EN3 A;  2WBU A;  1X6H A;  1F2I G;  2WBS A;  1YUJ A;  2EM2 A;  1A1J A;  2EN2 A;  5KL7 A;  2EPC A;  2YTI A;  4GZN C;  5KL2 A;  3M99 B;  1JK2 A;  1G2D C;  2EPZ A;  3EPJ A;  2EM0 A;  2YTP A;  2EM9 A;  1A1H A;  2EMI A;  4IS1 C;  2D9H A;  2EMW A;  2A25 A;  2EMK A;  2YTQ A;  5KL5 A;  1A1F A;  2ELZ A;  2EOQ A;  1NCS A;  2EMF A;  2EPP A;  2EPU A;  2ENC A;  2J7J A;  2EOR A;  2EOE A;  2YRK A;  1MEY C;  2ELY A;  2EJ4 A;  4WSG A;  2EOO A;  4R2E A;  2YTF A;  2LV2 A;  2DMI A;  2JPA A;  2YTJ A;  2RPC A;  4F2J C;  2LO3 A;  2HGH A;  1A1G A;  1ZAA C;  2EMZ A;  3UK3 C;  2YTN A;  1Z1B A;  1BB8 A;  2VRD A;  3MHH C;  2EL5 A;  2NAB A;  4M9V C;  1YSA C;  2EMH A;  2WCC 3;  2EOY A;  2R1F A;  4F6M A;  1BBO A;  2GLI A;  4X9J A;  4IJD A;  2I13 A;  2EPR A;  4R2R A;  2YTO A;  2EN4 A;  1YUI A;  4R2S A;  2EOH A;  2MDG A;  2E72 A;  2EM3 A;  2EOJ A;  2YRH A;  4FK5 C;  3VHT B;  2EM7 A;  4R2D A;  2EM6 A;  3MHS C;  2EPA A;  1A1L A;  2EMA A;  2BB8 A;  2EN6 A;  2WBT A;  1X3C A;  1X5W A;  1TF3 A;  2EMB A;  2DGC A;  2YTE A;  1TF6 A;  2EM5 A;  1ZR9 A;  2EM4 A;  1G2F C;  1B69 A;  1P47 A;  2YRM A;  2EOM A;  2LT7 A;  1A1K A;  2EL6 A;  2EP3 A;  2ENA A;  5KL4 A;  1WJP A;  2EM8 A;  2EOZ A;  2M9A A;  2EOX A;  1KJK A;  2CSH A;  2EMX A;  2EOF A;  2YTG A;  1UBD C;  4R2C A;  5KL6 A;  4R2P A;  1JK1 A;  2EQ0 A;  2CT1 A;  4R2A A;  2EQ3 A;  1LLM C;  2DLQ A;  2YU5 A;  5KL3 A;  2LCE A;  2EOI A;  1AAY A;  2PRT A;  3EPH A;  2LVH A;  2GHF A;  1ZU1 A;  2DRP A; 
#chains in the Genus database with same CATH topology
 1WHN A;  4JV5 E;  4WSP A;  2V83 A;  5A6A A;  2HJJ A;  2CTD A;  4F6N A;  1WXR A;  2EPL X;  3EPL A;  2EL4 A;  3HPS A;  4R2Q A;  2UXD E;  1YPN A;  3ECR A;  4JI0 E;  2MKN A;  2VF1 A;  2UXB E;  4DR7 E;  2ENH A;  2V8Q B;  1UN6 B;  3OTO E;  1T38 A;  4LU9 A;  2YTD A;  5F3W A;  1BBG A;  2EN3 A;  2ODR D;  1IBM E;  2EPO A;  2EM2 A;  2LRS A;  4GZN C;  3LLH A;  4YY3 E;  4X65 E;  2MC5 A;  5IV8 B;  5DNY A;  5A6K A;  4DV5 E;  2EMI A;  4X66 E;  2A25 A;  5KL5 A;  3DJW A;  5IXM B;  2ENC A;  5CFF E;  2JOB A;  1GTK A;  4WYQ B;  5AC4 A;  2VQF E;  1MEY C;  3JTZ A;  1X48 A;  5LMN E;  4JI4 E;  5A6B D;  2JWO A;  2IHR 1;  2YTF A;  2JVA A;  2M7Q A;  4L5N C;  2YTJ A;  2RPC A;  2F8B A;  1SFE A;  4LF4 E;  2YPN A;  4JI2 E;  5A6B A;  2EL5 A;  1YSA C;  3KZY A;  2G7H A;  4KWY A;  5IT9 C;  4IJD A;  4WFT A;  1IQS A;  2B7T A;  4B3M E;  2UUB E;  4RHB B;  2EOH A;  2EOJ A;  2EM3 A;  2YRH A;  3VHT B;  2EM7 A;  1YYO A;  4F9A B;  4RH8 A;  2EPA A;  1IBK E;  3RMP A;  2KOU A;  3HPZ A;  4JI6 E;  4OOG C;  2VE7 C;  4M2Z A;  2EMB A;  2UXC E;  2JY9 A;  4WX9 A;  1TF6 A;  4JI1 E;  2EM4 A;  4DV4 E;  5LMU E;  1A1K A;  4LTY A;  1QU6 A;  1WJP A;  2EM8 A;  2EPK X;  1ZBT A;  5KL6 A;  4R2P A;  4R2A A;  3F6H A;  1I94 E;  2LCE A;  2EOI A;  1AAY A;  2L8T A;  1FKA E;  5FLX C;  2DRP A;  4O24 A;  1SR9 A;  3VYY A;  2EN1 A;  2V87 A;  4WXD A;  1UHZ A;  1IBL E;  2EE8 A;  2YU8 A;  1HR0 E;  2EMC A;  4P7D A;  2EOS A;  2YSO A;  4I8O A;  4M0V A;  4DV3 E;  3J7A G;  4P78 A;  2H36 X;  2JP9 A;  2EML A;  1IMU A;  4WPY A;  3EPK A;  1EKZ A;  4TUI A;  4BBY A;  2GPI A;  2N3H A;  2EPC A;  2YTI A;  1PDA A;  1JK2 A;  2EPZ A;  3EPJ A;  3HTX A;  3T1H E;  4DUY E;  1T39 A;  1RQ0 A;  2EMW A;  5AE1 A;  2ELZ A;  2LTS A;  1YZ9 A;  2EMF A;  2VQE E;  2EPU A;  3L00 A;  2L3J A;  2J7J A;  2EOR A;  2YT4 A;  5AE2 A;  2F4V E;  1X47 A;  2EOE A;  2JXP A;  2N8X A;  2YRK A;  1T4N A;  4O5G A;  2NUG A;  2EOO A;  4R2E A;  4JI3 E;  2LV2 A;  2EWL A;  2LO3 A;  4LFA E;  1XNQ E;  1A1G A;  3C4T A;  3UK3 C;  1BB8 A;  2VRD A;  2LJU A;  4WXC A;  2WCC 3;  4F6M A;  1BBO A;  3TQM A;  5ADZ A;  3FIG A;  2DB2 A;  1AH5 A;  4JYA E;  1IQO A;  1ZBQ A;  2EN4 A;  1N33 E;  5A2Q C;  2M4I A;  5TSE A;  4FK5 C;  2WZO A;  3BID A;  4DUZ E;  3MHS C;  3J80 C;  4J8Z A;  1EH7 A;  2WBT A;  2V89 A;  4Q35 B;  5IWA E;  4DMI A;  4BCA A;  5AE3 A;  1TF3 A;  2YWQ A;  1G2F C;  2LMZ A;  2LE2 A;  2HC5 A;  4DV6 E;  1P47 A;  1B69 A;  2NUF A;  1STU A;  2EOM A;  2LT7 A;  2EL6 A;  2L2M A;  2ENA A;  2EOZ A;  2EOX A;  2EMX A;  5LL6 R;  2EOF A;  4F9B B;  3BGH A;  1UBD C;  4R2C A;  1JK1 A;  4DR4 E;  2EQ0 A;  3AV0 A;  5KL3 A;  4F9C B;  2GHF A;  2EZ6 A;  1WHQ A;  2EMG A;  1RC7 A;  1YYW A;  2DLK A;  4BC9 A;  2ADR A;  1A1I A;  1X6E A;  4B3R E;  3JAM C;  4DR3 E;  1DGC A;  2EN8 A;  4B3S E;  4LF8 E;  4NXM E;  3ADG A;  2DIX A;  5AAS A;  2L2K B;  1X6F A;  4K0K E;  4NHR A;  2K4V A;  2L92 A;  2WBU A;  3ADL A;  4DV7 E;  1F2I G;  2WBS A;  1YUJ A;  4JI7 E;  2L3C A;  4HTG A;  5KL2 A;  4BC7 A;  1G2D C;  4NZV A;  2L6M A;  2YTP A;  5LLQ A;  3HQ1 A;  1A1H A;  3IWC A;  1PJS A;  3H09 A;  2EMK A;  1A1F A;  2FV4 B;  4DR2 E;  4DR5 E;  3ADI A;  2EOQ A;  4BHB A;  4MLV A;  3VK6 A;  4TUG A;  4DV1 E;  2L33 A;  4AQY E;  3ZOQ B;  1N3G A;  2LBS B;  2FTX B;  3AUZ A;  4R03 A;  4O4K A;  1O0W A;  3J81 C;  2EJ4 A;  4WSG A;  1PKP A;  4R8O A;  2Q8U A;  4ZYD A;  4DR1 E;  4NXN E;  3IWB A;  3BBG A;  1T4L B;  2M1S A;  1ZAA C;  3OML A;  4ZYE A;  1UIL A;  2DSY A;  2ZM6 E;  4M9V C;  1N32 E;  1YYK A;  2EOY A;  2R1F A;  3THO B;  2GLI A;  1PJQ A;  4X9J A;  2I13 A;  2EPM X;  2V86 A;  4BHC A;  3F6G A;  3IWD A;  2EPR A;  4R2R A;  4N4R B;  2YTO A;  2DMY A;  1YUI A;  2B3T B;  4R2S A;  2E72 A;  4OX9 E;  4R2D A;  1HNX E;  1DQ3 A;  4LF9 E;  1A1L A;  1KYQ A;  2BB8 A;  2EMA A;  1FJG E;  2EN6 A;  1T4O A;  1X5W A;  3ADJ A;  2DGC A;  2YTE A;  2EM5 A;  1ZR9 A;  5A6J A;  2V85 A;  4GEQ B;  2MDR A;  1PJT A;  2RSM A;  1NEI A;  1HNW E;  1KJK A;  3DF6 A;  2CSH A;  3C6M A;  2YTG A;  1EH8 A;  2RQL A;  2L2N A;  4ZYG A;  1LLM C;  4KZS A;  2YU5 A;  4DKK A;  2CPN A;  4M30 A;  2PRT A;  4B3T E;  3EPH A;  1Z1B A;  1EH6 A;  3JU0 A;  1RMD A;  2R76 A;  1HNZ E;  2YSP A;  4Q28 A;  3J7Y p;  2LUQ A;  2KON A;  4LFB E;  4O43 A;  2EN7 A;  2RSI A;  1TN9 A;  2EPX A;  2EQ1 A;  2JR1 A;  2KHX A;  3K6Q A;  2MKD A;  1WRJ A;  4L8N A;  2EPN A;  2EMY A;  1XMO E;  4ZYH A;  2RS6 A;  1X6H A;  2YZT A;  5AC5 A;  2UUA E;  1A1J A;  2EN2 A;  5KL7 A;  1YFH A;  3M99 B;  1QNT A;  1J5E E;  2EM0 A;  2EM9 A;  2B7V A;  2N3G A;  2LJH A;  4IS1 C;  2D9H A;  2YTQ A;  1XMQ E;  2RTX A;  4X62 E;  4DV2 E;  1NCS A;  3EQ1 A;  2EPP A;  2E1M A;  5A69 A;  4GKK E;  3QG5 C;  2K7I A;  4DV0 E;  3VYX A;  2HHH E;  2MC6 A;  2ELY A;  5T6J A;  4MLQ A;  4BMJ A;  4HEI A;  1MGT A;  1GZ6 A;  2JPA A;  2DMI A;  4GKJ E;  3MSW A;  2ODR C;  4YHH E;  4F2J C;  3HXL A;  2HGH A;  2RS7 A;  1XNR E;  4BS9 A;  2EMZ A;  2YTN A;  1N34 E;  3MHH C;  2NAB A;  2EMH A;  4F54 A;  4X64 E;  2I9I A;  3KWR A;  2V88 A;  2MDG A;  3BF2 A;  1X49 A;  1J26 A;  2EM6 A;  1DI2 A;  2B9D A;  4DR6 E;  3C4B A;  4X8W A;  5BR8 E;  2E5L E;  2NUE A;  3T1Y E;  1X3C A;  4LF7 E;  2UUC E;  4JI8 E;  4JI5 E;  3C6K A;  2LUP B;  3KZZ A;  3LML A;  2LTR A;  4LF5 E;  2YRM A;  1GQE A;  2UU9 E;  2EP3 A;  4LF6 E;  5KL4 A;  4LFC E;  3THN A;  2M9A A;  4KHP E;  1N36 E;  2JOX A;  2CT1 A;  2EQ3 A;  2NA2 A;  1L4S A;  2BBG A;  2DLQ A;  2FGG A;  2JYA A;  2LVH A;  1ZU1 A;  3P1X A; 
#chains in the Genus database with same CATH homology
 2EN1 A;  1RMD A;  2EMG A;  2YSP A;  2DLK A;  2ADR A;  1A1I A;  1X6E A;  2EE8 A;  2CTD A;  2YU8 A;  4F6N A;  2EMC A;  3EPL A;  2EN7 A;  2EOS A;  2RSI A;  2EL4 A;  1DGC A;  2YSO A;  2EPX A;  1TN9 A;  2EN8 A;  4R2Q A;  2EQ1 A;  2MKN A;  2ENH A;  2MKD A;  1UN6 B;  2JP9 A;  2EML A;  2YTD A;  1X6F A;  3EPK A;  2EMY A;  2EN3 A;  2WBU A;  1X6H A;  1F2I G;  2WBS A;  1YUJ A;  2EM2 A;  1A1J A;  2EN2 A;  5KL7 A;  2EPC A;  2YTI A;  4GZN C;  5KL2 A;  3M99 B;  1JK2 A;  1G2D C;  2EPZ A;  3EPJ A;  2EM0 A;  2YTP A;  2EM9 A;  1A1H A;  2EMI A;  4IS1 C;  2D9H A;  2EMW A;  2A25 A;  2EMK A;  2YTQ A;  5KL5 A;  1A1F A;  2ELZ A;  2EOQ A;  1NCS A;  2EMF A;  2EPP A;  2EPU A;  2ENC A;  2J7J A;  2EOR A;  2EOE A;  2YRK A;  1MEY C;  2ELY A;  2EJ4 A;  4WSG A;  2EOO A;  4R2E A;  2YTF A;  2LV2 A;  2DMI A;  2JPA A;  2YTJ A;  2RPC A;  4F2J C;  2LO3 A;  2HGH A;  1A1G A;  1ZAA C;  2EMZ A;  3UK3 C;  2YTN A;  1Z1B A;  1BB8 A;  2VRD A;  3MHH C;  2EL5 A;  2NAB A;  4M9V C;  1YSA C;  2EMH A;  2WCC 3;  2EOY A;  2R1F A;  4F6M A;  1BBO A;  2GLI A;  4X9J A;  4IJD A;  2I13 A;  2EPR A;  4R2R A;  2YTO A;  2EN4 A;  1YUI A;  4R2S A;  2EOH A;  2MDG A;  2E72 A;  2EM3 A;  2EOJ A;  2YRH A;  4FK5 C;  3VHT B;  2EM7 A;  4R2D A;  2EM6 A;  3MHS C;  2EPA A;  1A1L A;  2EMA A;  2BB8 A;  2EN6 A;  2WBT A;  1X3C A;  1X5W A;  1TF3 A;  2EMB A;  2DGC A;  2YTE A;  1TF6 A;  2EM5 A;  1ZR9 A;  2EM4 A;  1G2F C;  1B69 A;  1P47 A;  2YRM A;  2EOM A;  2LT7 A;  1A1K A;  2EL6 A;  2EP3 A;  2ENA A;  5KL4 A;  1WJP A;  2EM8 A;  2EOZ A;  2M9A A;  2EOX A;  1KJK A;  2CSH A;  2EMX A;  2EOF A;  2YTG A;  1UBD C;  4R2C A;  5KL6 A;  4R2P A;  1JK1 A;  2EQ0 A;  2CT1 A;  4R2A A;  2EQ3 A;  1LLM C;  2DLQ A;  2YU5 A;  5KL3 A;  2LCE A;  2EOI A;  1AAY A;  2PRT A;  3EPH A;  2LVH A;  2GHF A;  1ZU1 A;  2DRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...