2YTQA

Solution structure of the c2h2 type zinc finger (region 775-807) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGAGEKPYGCSECGKAFSSKSYLIIHMRTHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 775-807) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytqA01
1AAYA 4F6MA 2JPAA 4GZNC 2GHFA 2LV2A 2EL6A 1DGCA 2YTNA 1X6EA 2GLIA 2YTEA 2EN6A 5KL3A 1A1FA 4IJDA 2DGCA 2LT7A 1JK2A 2ELYA 2EOOA 2EMFA 2CT1A 2EPZA 1UBDC 4R2DA 5KL2A 1BB8A 1X3CA 2R1FA 2MDGA 2WBUA 2EOEA 2EOMA 2EOHA 2EOSA 2EM2A 1RMDA 2EPCA 1X5WA 1A1HA 1TF6A 1B69A 2YRHA 2EN3A 2EMAA 3MHSC 2DRPA 2EOFA 1YUIA 2ADRA 2EM3A 2EOZA 5KL5A 1X6HA 2EQ0A 2EN4A 2YSOA 2EE8A 2EN2A 1X6FA 1NCSA 4IS1C 2EMWA 2JP9A 2EOQA 4X9JA 2EN7A 4R2QA 2EPXA 4FK5C 2RSIA 1LLMC 1KJKA 2YTDA 1A1KA 2EPUA 2YTJA 2EMLA 4F2JC 2EPAA 2DMIA 1A1GA 2EL4A 1ZAAC 1YSAC 2EM7A 2YRKA 1TN9A 2EOJA 3EPHA 2LVHA 1F2IG 3VHTB 2PRTA 4WSGA 2YU5A 2RPCA 2D9HA 2J7JA 3MHHC 2EORA 1BBOA 2EMBA 4R2SA 4R2PA 2A25A 4F6NA 3EPKA 1G2DC 2LCEA 2EMKA 2I13A 2WBTA 2EPPA 2ENAA 2YTGA 1A1JA 2ELZA 4R2CA 2YTQA 4R2EA 2E72A 2YTIA 5KL4A 2EM6A 2CSHA 2EOYA 1MEYC 2NABA 1TF3A 1ZU1A 2YRMA 2YTPA 2EMIA 2EM9A 2EL5A 2EMHA 3EPLA 5KL6A 3UK3C 5KL7A 2EM0A 2WCC3 2EPRA 2HGHA 1YUJA 2LO3A 2YSPA 2EQ1A 2DLQA 1WJPA 2MKNA 4M9VC 2EM4A 2EQ3A 2EOIA 2VRDA 4R2AA 2BB8A 2EOXA 2ENHA 1Z1BA 2EN1A 1JK1A 1UN6B 2EMZA 1G2FC 2M9AA 4R2RA 2WBSA 2EJ4A 2YTFA 2EM5A 3EPJA 2EM8A 2EN8A 2EMCA 1A1IA 2CTDA 2EMXA 2MKDA 2YU8A 3M99B 2EMGA 2YTOA 2EP3A 1ZR9A 2DLKA 2EMYA 1P47A 2ENCA 1A1LA
chains in the Genus database with same CATH superfamily
1AAYA 4O5GA 1QU6A 2LUQA 2UUBE 1XNQE 4X8WA 2YTNA 4M2ZA 2L3JA 4WXDA 2ODRD 4F54A 4BS9A 1T4NA 4YHHE 1HNZE 2DGCA 2L8TA 1EKZA 1JK2A 4LF9E 3THNA 3J7Yp 3DF6A 2M7QA 3HQ1A 1BB8A 1BBGA 2DIXA 2WBUA 1YYWA 5AE3A 2EOHA 5T6JA 5A6AA 2EOSA 4JI1E 1ZBTA 1GZ6A 2EM2A 5IT9C 1X49A 5IWAE 1O0WA 2DRPA 1IQSA 2JOXA 1YUIA 4MLVA 3P1XA 1UILA 1X6HA 2YSOA 1NCSA 2EMWA 2EPNA 3BF2A 4JI5E 2JXPA 1RC7A 4R2QA 4FK5C 4LF5E 4ZYGA 1LLMC 2V89A 1PJSA 1J26A 1N3GA 2EMLA 4F2JC 2FV4B 1KYQA 1ZAAC 2EM7A 2JYAA 2MC5A 3EPHA 4GEQB 4WSGA 4OOGC 2RPCA 2J7JA 4DV4E 2HHHE 3C6MA 3BBGA 5F3WA 1UHZA 4LFBE 3T1HE 2IHR1 1WRJA 2EMKA 4LF7E 1A1JA 2NUFA 3F6GA 2EPOA 2LJUA 2L2MA 1N36E 1AH5A 3JTZA 1ZU1A 2YRMA 3TQMA 1N34E 1PJQA 5KL6A 3ECRA 4GKKE 2B7TA 1IMUA 5A2QC 3HPSA 2MC6A 3LMLA 1WHNA 2MKNA 4M9VC 2YZTA 3J7AG 4DR6E 4DR7E 2B7VA 2V86A 1SFEA 2EN1A 4LF6E 2V83A 2EMZA 1YPNA 2FTXB 2DMYA 2EJ4A 2YTFA 3EPJA 2EM8A 4JI8E 2EN8A 2EMCA 1I94E 2CTDA 2EMXA 2N8XA 2LE2A 1YFHA 4ZYDA 1P47A 4B3SE 2ENCA 2EWLA 4F6MA 2JPAA 2L33A 3KZYA 2EL6A 2LBSB 4N4RB 2GLIA 4LFCE 2YTEA 4R03A 2EN6A 2Q8UA 1A1FA 3K6QA 4IJDA 4DV3E 2RS6A 2ZM6E 4B3ME 2ELYA 2EOOA 4ZYHA 2CT1A 4LU9A 5AE1A 4I8OA 3FIGA 4R2DA 5KL2A 1L4SA 2EPMX 4AQYE 2ODRC 3AUZA 4P78A 2V85A 1T4LB 1FJGE 1RQ0A 1GQEA 1RMDA 3J80C 1X5WA 2UU9E 2EN3A 3OTOE 4LTYA 2EM3A 2EOZA 2E1MA 2EE8A 4Q35B 2I9IA 1DI2A 2EOQA 2NA2A 4X9JA 2UXDE 4RH8A 2LTSA 4JYAE 2RQLA 2EN7A 4R8OA 1T38A 1XMQE 2EPXA 3IWCA 1IBLE 5IXMB 5BR8E 5AE2A 4WSPA 2L2NA 2EPUA 1A1KA 4DUZE 2YTJA 2NUEA 2M1SA 2V87A 2EPAA 2EZ6A 3C4TA 5CFFE 2GPIA 1TN9A 5TSEA 3F6HA 2EOJA 1T39A 2B9DA 3VHTB 2PRTA 4F9BB 3THOB 2D9HA 3C6KA 3OMLA 2EMBA 2B3TB 4R2PA 1HR0E 2I13A 2ENAA 2ELZA 3HTXA 1YZ9A 2EM6A 2CSHA 1MEYC 2NABA 1TF3A 2KONA 4WYQB 3KZZA 4JI6E 2YTPA 2EMIA 2VF1A 3JAMC 2EL5A 2E5LE 3ADIA 2WCC3 5LMNE 2EPRA 5LMUE 2HGHA 2L6MA 2LO3A 2EPLX 2YSPA 3VK6A 2YWQA 2DLQA 3VYYA 5FLXC 2EQ3A 2V8QB 1FKAE 4JI0E 4NXNE 4R2AA 2BB8A 2ENHA 1Z1BA 1N32E 4DR4E 1PDAA 3QG5C 2M9AA 1QNTA 2EM5A 4KHPE 2NUGA 3ZOQB 2YT4A 2EMGA 5IV8B 2YTOA 4BHBA 2EMYA 2K4VA 1A1LA 2YPNA 2VQFE 2G7HA 4DMIA 2GHFA 3HXLA 1DGCA 2LRSA 4DR5E 1IBKE 2EPKX 4WXCA 4WPYA 1YYOA 2EMFA 2JVAA 3VYXA 4KWYA 4HEIA 1X3CA 2R1FA 2JWOA 2UXBE 4NXME 2EOMA 5ADZA 1A1HA 4F9AB 1B69A 2FGGA 2CPNA 4LF8E 4DV7E 4DV6E 3MHSC 4DV1E 4JI7E 1EH6A 5AC4A 3EQ1A 2JP9A 4F9CB 2UXCE 3IWDA 4J8ZA 4ZYEA 2RSIA 4DKKA 1KJKA 2KHXA 2YTDA 4JI3E 1IQOA 5DNYA 2DMIA 1EH8A 1WHQA 2LJHA 1YSAC 4O24A 2L2KB 4NZVA 4RHBB 2LVHA 5A6BA 1F2IG 4O4KA 4GKJE 2JR1A 2EORA 1BBOA 4MLQA 4L5NC 4KZSA 4F6NA 4YY3E 2DB2A 2EPPA 2WBTA 4BC9A 1HNWE 2YTQA 2E72A 2L3CA 3RMPA 4BC7A 4X62E 2EOYA 1WXRA 2UUCE 1PKPA 3LLHA 2R76A 2EM9A 2M4IA 3UK3C 3EPLA 5KL7A 3H09A 4M0VA 2EQ1A 4LF4E 1GTKA 1WJPA 2F8BA 2EOIA 2VRDA 1T4OA 5A69A 4WX9A 2EOXA 3J81C 1X47A 4B3TE 4TUGA 2N3HA 1DQ3A 2HC5A 2K7IA 2HJJA 2MKDA 1N33E 4TUIA 2EP3A 2DLKA 1EH7A 2BBGA 4L8NA 4M30A 4GZNC 2LV2A 3ADGA 1X6EA 2F4VE 4O43A 4Q28A 5KL3A 2N3GA 1MGTA 4DV2E 2DSYA 3MSWA 2LT7A 4BHCA 4DUYE 1J5EE 2EPZA 1UBDC 2WZOA 1HNXE 2MDGA 4BBYA 5A6BD 2EOEA 1YYKA 3T1YE 2VE7C 3KWRA 1TF6A 2EPCA 1NEIA 4P7DA 2YRHA 2EMAA 2RS7A 2MDRA 2EOFA 2ADRA 5KL5A 2EQ0A 2EN4A 1ZBQA 1X6FA 2EN2A 4DR1E 4IS1C 2RTXA 3ADJA 2JOBA 4WFTA 4X64E 5A6JA 3BIDA 4OX9E 5AASA 2VQEE 1A1GA 2EL4A 4K0KE 4LFAE 5LL6R 2YRKA 1IBME 2LUPB 4JI2E 5LLQA 4DV5E 2YU5A 3IWBA 1STUA 3MHHC 4R2SA 2JY9A 2A25A 3EPKA 1G2DC 2LCEA 2YTGA 4R2CA 4R2EA 3L00A 4B3RE 2YTIA 5KL4A 1XMOE 1X48A 2LMZA 2EMHA 5A6KA 2V88A 5AC5A 2EM0A 2LTRA 3AV0A 3HPZA 4BCAA 1YUJA 2KOUA 3C4BA 1XNRE 4DR3E 2EM4A 1PJTA 2L92A 4NHRA 4JI4E 1SR9A 3JU0A 4DV0E 3BGHA 1JK1A 1UN6B 1G2FC 4X66E 4DR2E 4R2RA 2WBSA 2H36X 4X65E 1A1IA 2YU8A 2RSMA 3M99B 3ADLA 2UUAE 1ZR9A 4HTGA 4JV5E 4BMJA 3DJWA
chains in the Genus database with same CATH topology
1AAYA 4F6MA 2JPAA 4GZNC 2GHFA 2LV2A 2EL6A 1DGCA 2YTNA 1X6EA 2GLIA 2YTEA 2EN6A 5KL3A 1A1FA 4IJDA 2DGCA 2LT7A 1JK2A 2ELYA 2EOOA 2EMFA 2CT1A 2EPZA 1UBDC 4R2DA 5KL2A 1BB8A 1X3CA 2R1FA 2MDGA 2WBUA 2EOEA 2EOMA 2EOHA 2EOSA 2EM2A 1RMDA 2EPCA 1X5WA 1A1HA 1TF6A 1B69A 2YRHA 2EN3A 2EMAA 3MHSC 2DRPA 2EOFA 1YUIA 2ADRA 2EM3A 2EOZA 5KL5A 1X6HA 2EQ0A 2EN4A 2YSOA 2EE8A 2EN2A 1X6FA 1NCSA 4IS1C 2EMWA 2JP9A 2EOQA 4X9JA 2EN7A 4R2QA 2EPXA 4FK5C 2RSIA 1LLMC 1KJKA 2YTDA 1A1KA 2EPUA 2YTJA 2EMLA 4F2JC 2EPAA 2DMIA 1A1GA 2EL4A 1ZAAC 1YSAC 2EM7A 2YRKA 1TN9A 2EOJA 3EPHA 2LVHA 1F2IG 3VHTB 2PRTA 4WSGA 2YU5A 2RPCA 2D9HA 2J7JA 3MHHC 2EORA 1BBOA 2EMBA 4R2SA 4R2PA 2A25A 4F6NA 3EPKA 1G2DC 2LCEA 2EMKA 2I13A 2WBTA 2EPPA 2ENAA 2YTGA 1A1JA 2ELZA 4R2CA 2YTQA 4R2EA 2E72A 2YTIA 5KL4A 2EM6A 2CSHA 2EOYA 1MEYC 2NABA 1TF3A 1ZU1A 2YRMA 2YTPA 2EMIA 2EM9A 2EL5A 2EMHA 3EPLA 5KL6A 3UK3C 5KL7A 2EM0A 2WCC3 2EPRA 2HGHA 1YUJA 2LO3A 2YSPA 2EQ1A 2DLQA 1WJPA 2MKNA 4M9VC 2EM4A 2EQ3A 2EOIA 2VRDA 4R2AA 2BB8A 2EOXA 2ENHA 1Z1BA 2EN1A 1JK1A 1UN6B 2EMZA 1G2FC 2M9AA 4R2RA 2WBSA 2EJ4A 2YTFA 2EM5A 3EPJA 2EM8A 2EN8A 2EMCA 1A1IA 2CTDA 2EMXA 2MKDA 2YU8A 3M99B 2EMGA 2YTOA 2EP3A 1ZR9A 2DLKA 2EMYA 1P47A 2ENCA 1A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAY A;  4F6M A;  2JPA A;  4GZN C;  2GHF A;  2LV2 A;  2EL6 A;  1DGC A;  2YTN A;  1X6E A;  2GLI A;  2YTE A;  2EN6 A;  5KL3 A;  1A1F A;  4IJD A;  2DGC A;  2LT7 A;  1JK2 A;  2ELY A;  2EOO A;  2EMF A;  2CT1 A;  2EPZ A;  1UBD C;  4R2D A;  5KL2 A;  1BB8 A;  1X3C A;  2R1F A;  2MDG A;  2WBU A;  2EOE A;  2EOM A;  2EOH A;  2EOS A;  2EM2 A;  1RMD A;  2EPC A;  1X5W A;  1A1H A;  1TF6 A;  1B69 A;  2YRH A;  2EN3 A;  2EMA A;  3MHS C;  2DRP A;  2EOF A;  1YUI A;  2ADR A;  2EM3 A;  2EOZ A;  5KL5 A;  1X6H A;  2EQ0 A;  2EN4 A;  2YSO A;  2EE8 A;  2EN2 A;  1X6F A;  1NCS A;  4IS1 C;  2EMW A;  2JP9 A;  2EOQ A;  4X9J A;  2EN7 A;  4R2Q A;  2EPX A;  4FK5 C;  2RSI A;  1LLM C;  1KJK A;  2YTD A;  1A1K A;  2EPU A;  2YTJ A;  2EML A;  4F2J C;  2EPA A;  2DMI A;  1A1G A;  2EL4 A;  1ZAA C;  1YSA C;  2EM7 A;  2YRK A;  1TN9 A;  2EOJ A;  3EPH A;  2LVH A;  1F2I G;  3VHT B;  2PRT A;  4WSG A;  2YU5 A;  2RPC A;  2D9H A;  2J7J A;  3MHH C;  2EOR A;  1BBO A;  2EMB A;  4R2S A;  4R2P A;  2A25 A;  4F6N A;  3EPK A;  1G2D C;  2LCE A;  2EMK A;  2I13 A;  2WBT A;  2EPP A;  2ENA A;  2YTG A;  1A1J A;  2ELZ A;  4R2C A;  2YTQ A;  4R2E A;  2E72 A;  2YTI A;  5KL4 A;  2EM6 A;  2CSH A;  2EOY A;  1MEY C;  2NAB A;  1TF3 A;  1ZU1 A;  2YRM A;  2YTP A;  2EMI A;  2EM9 A;  2EL5 A;  2EMH A;  3EPL A;  5KL6 A;  3UK3 C;  5KL7 A;  2EM0 A;  2WCC 3;  2EPR A;  2HGH A;  1YUJ A;  2LO3 A;  2YSP A;  2EQ1 A;  2DLQ A;  1WJP A;  2MKN A;  4M9V C;  2EM4 A;  2EQ3 A;  2EOI A;  2VRD A;  4R2A A;  2BB8 A;  2EOX A;  2ENH A;  1Z1B A;  2EN1 A;  1JK1 A;  1UN6 B;  2EMZ A;  1G2F C;  2M9A A;  4R2R A;  2WBS A;  2EJ4 A;  2YTF A;  2EM5 A;  3EPJ A;  2EM8 A;  2EN8 A;  2EMC A;  1A1I A;  2CTD A;  2EMX A;  2MKD A;  2YU8 A;  3M99 B;  2EMG A;  2YTO A;  2EP3 A;  1ZR9 A;  2DLK A;  2EMY A;  1P47 A;  2ENC A;  1A1L A; 
#chains in the Genus database with same CATH topology
 1AAY A;  4O5G A;  1QU6 A;  2LUQ A;  2UUB E;  1XNQ E;  4X8W A;  2YTN A;  4M2Z A;  2L3J A;  4WXD A;  2ODR D;  4F54 A;  4BS9 A;  1T4N A;  4YHH E;  1HNZ E;  2DGC A;  2L8T A;  1EKZ A;  1JK2 A;  4LF9 E;  3THN A;  3J7Y p;  3DF6 A;  2M7Q A;  3HQ1 A;  1BB8 A;  1BBG A;  2DIX A;  2WBU A;  1YYW A;  5AE3 A;  2EOH A;  5T6J A;  5A6A A;  2EOS A;  4JI1 E;  1ZBT A;  1GZ6 A;  2EM2 A;  5IT9 C;  1X49 A;  5IWA E;  1O0W A;  2DRP A;  1IQS A;  2JOX A;  1YUI A;  4MLV A;  3P1X A;  1UIL A;  1X6H A;  2YSO A;  1NCS A;  2EMW A;  2EPN A;  3BF2 A;  4JI5 E;  2JXP A;  1RC7 A;  4R2Q A;  4FK5 C;  4LF5 E;  4ZYG A;  1LLM C;  2V89 A;  1PJS A;  1J26 A;  1N3G A;  2EML A;  4F2J C;  2FV4 B;  1KYQ A;  1ZAA C;  2EM7 A;  2JYA A;  2MC5 A;  3EPH A;  4GEQ B;  4WSG A;  4OOG C;  2RPC A;  2J7J A;  4DV4 E;  2HHH E;  3C6M A;  3BBG A;  5F3W A;  1UHZ A;  4LFB E;  3T1H E;  2IHR 1;  1WRJ A;  2EMK A;  4LF7 E;  1A1J A;  2NUF A;  3F6G A;  2EPO A;  2LJU A;  2L2M A;  1N36 E;  1AH5 A;  3JTZ A;  1ZU1 A;  2YRM A;  3TQM A;  1N34 E;  1PJQ A;  5KL6 A;  3ECR A;  4GKK E;  2B7T A;  1IMU A;  5A2Q C;  3HPS A;  2MC6 A;  3LML A;  1WHN A;  2MKN A;  4M9V C;  2YZT A;  3J7A G;  4DR6 E;  4DR7 E;  2B7V A;  2V86 A;  1SFE A;  2EN1 A;  4LF6 E;  2V83 A;  2EMZ A;  1YPN A;  2FTX B;  2DMY A;  2EJ4 A;  2YTF A;  3EPJ A;  2EM8 A;  4JI8 E;  2EN8 A;  2EMC A;  1I94 E;  2CTD A;  2EMX A;  2N8X A;  2LE2 A;  1YFH A;  4ZYD A;  1P47 A;  4B3S E;  2ENC A;  2EWL A;  4F6M A;  2JPA A;  2L33 A;  3KZY A;  2EL6 A;  2LBS B;  4N4R B;  2GLI A;  4LFC E;  2YTE A;  4R03 A;  2EN6 A;  2Q8U A;  1A1F A;  3K6Q A;  4IJD A;  4DV3 E;  2RS6 A;  2ZM6 E;  4B3M E;  2ELY A;  2EOO A;  4ZYH A;  2CT1 A;  4LU9 A;  5AE1 A;  4I8O A;  3FIG A;  4R2D A;  5KL2 A;  1L4S A;  2EPM X;  4AQY E;  2ODR C;  3AUZ A;  4P78 A;  2V85 A;  1T4L B;  1FJG E;  1RQ0 A;  1GQE A;  1RMD A;  3J80 C;  1X5W A;  2UU9 E;  2EN3 A;  3OTO E;  4LTY A;  2EM3 A;  2EOZ A;  2E1M A;  2EE8 A;  4Q35 B;  2I9I A;  1DI2 A;  2EOQ A;  2NA2 A;  4X9J A;  2UXD E;  4RH8 A;  2LTS A;  4JYA E;  2RQL A;  2EN7 A;  4R8O A;  1T38 A;  1XMQ E;  2EPX A;  3IWC A;  1IBL E;  5IXM B;  5BR8 E;  5AE2 A;  4WSP A;  2L2N A;  2EPU A;  1A1K A;  4DUZ E;  2YTJ A;  2NUE A;  2M1S A;  2V87 A;  2EPA A;  2EZ6 A;  3C4T A;  5CFF E;  2GPI A;  1TN9 A;  5TSE A;  3F6H A;  2EOJ A;  1T39 A;  2B9D A;  3VHT B;  2PRT A;  4F9B B;  3THO B;  2D9H A;  3C6K A;  3OML A;  2EMB A;  2B3T B;  4R2P A;  1HR0 E;  2I13 A;  2ENA A;  2ELZ A;  3HTX A;  1YZ9 A;  2EM6 A;  2CSH A;  1MEY C;  2NAB A;  1TF3 A;  2KON A;  4WYQ B;  3KZZ A;  4JI6 E;  2YTP A;  2EMI A;  2VF1 A;  3JAM C;  2EL5 A;  2E5L E;  3ADI A;  2WCC 3;  5LMN E;  2EPR A;  5LMU E;  2HGH A;  2L6M A;  2LO3 A;  2EPL X;  2YSP A;  3VK6 A;  2YWQ A;  2DLQ A;  3VYY A;  5FLX C;  2EQ3 A;  2V8Q B;  1FKA E;  4JI0 E;  4NXN E;  4R2A A;  2BB8 A;  2ENH A;  1Z1B A;  1N32 E;  4DR4 E;  1PDA A;  3QG5 C;  2M9A A;  1QNT A;  2EM5 A;  4KHP E;  2NUG A;  3ZOQ B;  2YT4 A;  2EMG A;  5IV8 B;  2YTO A;  4BHB A;  2EMY A;  2K4V A;  1A1L A;  2YPN A;  2VQF E;  2G7H A;  4DMI A;  2GHF A;  3HXL A;  1DGC A;  2LRS A;  4DR5 E;  1IBK E;  2EPK X;  4WXC A;  4WPY A;  1YYO A;  2EMF A;  2JVA A;  3VYX A;  4KWY A;  4HEI A;  1X3C A;  2R1F A;  2JWO A;  2UXB E;  4NXM E;  2EOM A;  5ADZ A;  1A1H A;  4F9A B;  1B69 A;  2FGG A;  2CPN A;  4LF8 E;  4DV7 E;  4DV6 E;  3MHS C;  4DV1 E;  4JI7 E;  1EH6 A;  5AC4 A;  3EQ1 A;  2JP9 A;  4F9C B;  2UXC E;  3IWD A;  4J8Z A;  4ZYE A;  2RSI A;  4DKK A;  1KJK A;  2KHX A;  2YTD A;  4JI3 E;  1IQO A;  5DNY A;  2DMI A;  1EH8 A;  1WHQ A;  2LJH A;  1YSA C;  4O24 A;  2L2K B;  4NZV A;  4RHB B;  2LVH A;  5A6B A;  1F2I G;  4O4K A;  4GKJ E;  2JR1 A;  2EOR A;  1BBO A;  4MLQ A;  4L5N C;  4KZS A;  4F6N A;  4YY3 E;  2DB2 A;  2EPP A;  2WBT A;  4BC9 A;  1HNW E;  2YTQ A;  2E72 A;  2L3C A;  3RMP A;  4BC7 A;  4X62 E;  2EOY A;  1WXR A;  2UUC E;  1PKP A;  3LLH A;  2R76 A;  2EM9 A;  2M4I A;  3UK3 C;  3EPL A;  5KL7 A;  3H09 A;  4M0V A;  2EQ1 A;  4LF4 E;  1GTK A;  1WJP A;  2F8B A;  2EOI A;  2VRD A;  1T4O A;  5A69 A;  4WX9 A;  2EOX A;  3J81 C;  1X47 A;  4B3T E;  4TUG A;  2N3H A;  1DQ3 A;  2HC5 A;  2K7I A;  2HJJ A;  2MKD A;  1N33 E;  4TUI A;  2EP3 A;  2DLK A;  1EH7 A;  2BBG A;  4L8N A;  4M30 A;  4GZN C;  2LV2 A;  3ADG A;  1X6E A;  2F4V E;  4O43 A;  4Q28 A;  5KL3 A;  2N3G A;  1MGT A;  4DV2 E;  2DSY A;  3MSW A;  2LT7 A;  4BHC A;  4DUY E;  1J5E E;  2EPZ A;  1UBD C;  2WZO A;  1HNX E;  2MDG A;  4BBY A;  5A6B D;  2EOE A;  1YYK A;  3T1Y E;  2VE7 C;  3KWR A;  1TF6 A;  2EPC A;  1NEI A;  4P7D A;  2YRH A;  2EMA A;  2RS7 A;  2MDR A;  2EOF A;  2ADR A;  5KL5 A;  2EQ0 A;  2EN4 A;  1ZBQ A;  1X6F A;  2EN2 A;  4DR1 E;  4IS1 C;  2RTX A;  3ADJ A;  2JOB A;  4WFT A;  4X64 E;  5A6J A;  3BID A;  4OX9 E;  5AAS A;  2VQE E;  1A1G A;  2EL4 A;  4K0K E;  4LFA E;  5LL6 R;  2YRK A;  1IBM E;  2LUP B;  4JI2 E;  5LLQ A;  4DV5 E;  2YU5 A;  3IWB A;  1STU A;  3MHH C;  4R2S A;  2JY9 A;  2A25 A;  3EPK A;  1G2D C;  2LCE A;  2YTG A;  4R2C A;  4R2E A;  3L00 A;  4B3R E;  2YTI A;  5KL4 A;  1XMO E;  1X48 A;  2LMZ A;  2EMH A;  5A6K A;  2V88 A;  5AC5 A;  2EM0 A;  2LTR A;  3AV0 A;  3HPZ A;  4BCA A;  1YUJ A;  2KOU A;  3C4B A;  1XNR E;  4DR3 E;  2EM4 A;  1PJT A;  2L92 A;  4NHR A;  4JI4 E;  1SR9 A;  3JU0 A;  4DV0 E;  3BGH A;  1JK1 A;  1UN6 B;  1G2F C;  4X66 E;  4DR2 E;  4R2R A;  2WBS A;  2H36 X;  4X65 E;  1A1I A;  2YU8 A;  2RSM A;  3M99 B;  3ADL A;  2UUA E;  1ZR9 A;  4HTG A;  4JV5 E;  4BMJ A;  3DJW A; 
#chains in the Genus database with same CATH homology
 1AAY A;  4F6M A;  2JPA A;  4GZN C;  2GHF A;  2LV2 A;  2EL6 A;  1DGC A;  2YTN A;  1X6E A;  2GLI A;  2YTE A;  2EN6 A;  5KL3 A;  1A1F A;  4IJD A;  2DGC A;  2LT7 A;  1JK2 A;  2ELY A;  2EOO A;  2EMF A;  2CT1 A;  2EPZ A;  1UBD C;  4R2D A;  5KL2 A;  1BB8 A;  1X3C A;  2R1F A;  2MDG A;  2WBU A;  2EOE A;  2EOM A;  2EOH A;  2EOS A;  2EM2 A;  1RMD A;  2EPC A;  1X5W A;  1A1H A;  1TF6 A;  1B69 A;  2YRH A;  2EN3 A;  2EMA A;  3MHS C;  2DRP A;  2EOF A;  1YUI A;  2ADR A;  2EM3 A;  2EOZ A;  5KL5 A;  1X6H A;  2EQ0 A;  2EN4 A;  2YSO A;  2EE8 A;  2EN2 A;  1X6F A;  1NCS A;  4IS1 C;  2EMW A;  2JP9 A;  2EOQ A;  4X9J A;  2EN7 A;  4R2Q A;  2EPX A;  4FK5 C;  2RSI A;  1LLM C;  1KJK A;  2YTD A;  1A1K A;  2EPU A;  2YTJ A;  2EML A;  4F2J C;  2EPA A;  2DMI A;  1A1G A;  2EL4 A;  1ZAA C;  1YSA C;  2EM7 A;  2YRK A;  1TN9 A;  2EOJ A;  3EPH A;  2LVH A;  1F2I G;  3VHT B;  2PRT A;  4WSG A;  2YU5 A;  2RPC A;  2D9H A;  2J7J A;  3MHH C;  2EOR A;  1BBO A;  2EMB A;  4R2S A;  4R2P A;  2A25 A;  4F6N A;  3EPK A;  1G2D C;  2LCE A;  2EMK A;  2I13 A;  2WBT A;  2EPP A;  2ENA A;  2YTG A;  1A1J A;  2ELZ A;  4R2C A;  2YTQ A;  4R2E A;  2E72 A;  2YTI A;  5KL4 A;  2EM6 A;  2CSH A;  2EOY A;  1MEY C;  2NAB A;  1TF3 A;  1ZU1 A;  2YRM A;  2YTP A;  2EMI A;  2EM9 A;  2EL5 A;  2EMH A;  3EPL A;  5KL6 A;  3UK3 C;  5KL7 A;  2EM0 A;  2WCC 3;  2EPR A;  2HGH A;  1YUJ A;  2LO3 A;  2YSP A;  2EQ1 A;  2DLQ A;  1WJP A;  2MKN A;  4M9V C;  2EM4 A;  2EQ3 A;  2EOI A;  2VRD A;  4R2A A;  2BB8 A;  2EOX A;  2ENH A;  1Z1B A;  2EN1 A;  1JK1 A;  1UN6 B;  2EMZ A;  1G2F C;  2M9A A;  4R2R A;  2WBS A;  2EJ4 A;  2YTF A;  2EM5 A;  3EPJ A;  2EM8 A;  2EN8 A;  2EMC A;  1A1I A;  2CTD A;  2EMX A;  2MKD A;  2YU8 A;  3M99 B;  2EMG A;  2YTO A;  2EP3 A;  1ZR9 A;  2DLK A;  2EMY A;  1P47 A;  2ENC A;  1A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...