2YTQA

Solution structure of the c2h2 type zinc finger (region 775-807) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
GSSGSSGAGEKPYGCSECGKAFSSKSYLIIHMRTHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 775-807) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytqA01
1Z1BA 2ELYA 1RMDA 2EMCA 2ENHA 1WJPA 2EE8A 2EOJA 4IJDA 1TN9A 2ENCA 2LV2A 2YSOA 2MDGA 2VRDA 3VHTB 2EOOA 2EOFA 1UBDC 1YSAC 2YRMA 1JK2A 2YTDA 1MEYC 2DGCA 2MKDA 2EMYA 2EPPA 2J7JA 2ENAA 5KL5A 2LT7A 2EQ0A 2JP9A 2EM9A 2I13A 5KL3A 2EM3A 1A1KA 4GZNC 2ADRA 2ELZA 3M99B 2EJ4A 1X3CA 2EM7A 2EMXA 2EM5A 2WCC3 2YTGA 2EM0A 2EMLA 3EPKA 2YU8A 1ZU1A 1F2IG 1X6EA 3EPJA 2WBUA 1LLMC 4R2SA 2YTEA 2DMIA 2EOQA 2JPAA 1TF6A 2EMBA 3MHHC 5KL4A 1A1LA 2DLQA 2EL4A 2YU5A 2EM2A 2MKNA 2EN3A 2EMWA 4X9JA 2RPCA 2YRKA 1G2FC 2EPXA 2WBSA 3UK3C 1YUIA 2EM8A 2DLKA 2YTNA 2EPRA 2EMGA 1A1HA 2CTDA 2EL5A 2LO3A 2YRHA 1TF3A 2EP3A 2BB8A 1A1FA 1BB8A 2EMHA 1DGCA 2EN8A 2E72A 2EQ3A 1P47A 1YUJA 2YTJA 4M9VC 4R2AA 1B69A 2A25A 2EM4A 2EOMA 1G2DC 2YTPA 2EMAA 4R2DA 2EL6A 2EOZA 2EORA 4R2PA 2EPCA 2YTQA 1KJKA 1AAYA 2YTFA 2EPZA 1UN6B 1X6FA 2D9HA 2EPAA 5KL7A 4R2EA 2EOYA 2EN4A 1X6HA 2PRTA 1JK1A 2EOEA 1A1IA 2GHFA 4WSGA 4R2CA 2M9AA 2CSHA 2LCEA 5KL2A 1A1GA 5KL6A 2YSPA 2EN7A 2EMFA 4F2JC 2HGHA 1ZR9A 3EPHA 3EPLA 2EPUA 2YTIA 1X5WA 2EMZA 2WBTA 3MHSC 4IS1C 4FK5C 4R2RA 2CT1A 2EOXA 2EOIA 2EMKA 2EQ1A 2R1FA 2EN2A 2RSIA 1A1JA 2GLIA 2NABA 2LVHA 2EM6A 2DRPA 1NCSA 4F6MA 4R2QA 2EOSA 1BBOA 2YTOA 2EN1A 2EN6A 1ZAAC 4F6NA 2EOHA 2EMIA
chains in the Genus database with same CATH superfamily
2JYAA 1Z1BA 1T4NA 2M7QA 2HHHE 2EZ6A 2HJJA 4F9AB 2VRDA 2YWQA 1J5EE 2N3GA 1DI2A 4ZYEA 5IT9C 4DR7E 1PDAA 1YPNA 1XNQE 3J7Yp 1N3GA 3J80C 4DV3E 2ENAA 4DV2E 4LTYA 5AC4A 4K0KE 5KL3A 2EM3A 2LTRA 4R03A 4GZNC 2EM7A 2EMXA 3BBGA 3EPKA 5LMUE 2EPNA 2G7HA 2M1SA 4LU9A 1YYKA 1YFHA 3ADIA 3LLHA 4DR5E 2WBUA 3L00A 4BBYA 5LMNE 3ADGA 4TUGA 4ZYGA 4B3RE 4X64E 2I9IA 2EOQA 1YZ9A 5AE3A 1A1LA 2YU5A 2L3CA 2MKNA 2UUBE 2LUQA 2RS7A 2EMWA 4X9JA 5A6JA 4I8OA 1YUIA 2EM8A 2ODRC 2EPRA 2RQLA 4LF8E 2YRHA 1N32E 4F54A 4HTGA 3KZZA 1X49A 2UUAE 1BB8A 2F8BA 3C4BA 3FIGA 4L5NC 4LF4E 2DB2A 5AE2A 2E72A 2EQ3A 4M9VC 1T39A 4WXDA 4O24A 4F9BB 1PJSA 4R2DA 2LRSA 1MGTA 3ADLA 4JI8E 2RSMA 1AAYA 3DF6A 4NXNE 1X6FA 2EPAA 2EOYA 4JYAE 2R76A 2EN4A 1JK1A 3BIDA 3HXLA 2CSHA 4DV1E 4R8OA 5KL2A 1A1GA 3HPSA 1EH8A 2NUGA 2EMFA 4F2JC 3ADJA 1AH5A 2EMZA 3MHSC 1RQ0A 4IS1C 4P7DA 4LFCE 4DV5E 4AQYE 1EKZA 1NEIA 1A1JA 3AUZA 1N33E 5AC5A 4F6MA 2YTOA 3EQ1A 2EN6A 5A2QC 3RMPA 2V89A 2ELYA 1RMDA 2EMCA 2ENHA 4OOGC 4DR2E 2B7VA 2BBGA 2CPNA 2KOUA 2YRMA 4JI3E 5BR8E 4X62E 1MEYC 4B3TE 2F4VE 4LF5E 2V83A 5KL5A 5LLQA 1XMQE 1KYQA 2ADRA 3H09A 2L6MA 2EM5A 5IWAE 2WCC3 2EMLA 2YU8A 1ZU1A 2B7TA 1F2IG 2L33A 4ZYDA 3J7AG 2RS6A 4JI0E 2JY9A 2LTSA 2B9DA 4F9CB 1LLMC 4M2ZA 4M0VA 4R2SA 4KZSA 2N8XA 5DNYA 3MHHC 4JI2E 5KL4A 1N36E 2EM2A 2V8QB 2EN3A 2EPMX 2N3HA 2DMYA 2RPCA 2NUEA 4DR1E 1QU6A 2EMGA 2CTDA 3IWCA 1RC7A 3HPZA 2EL5A 1TF3A 2LBSB 4JV5E 4OX9E 5F3WA 3T1HE 1HNZE 1GQEA 1DGCA 2EN8A 3ZOQB 4R2AA 2A25A 2EPKX 4GEQB 1G2DC 4LF7E 1X48A 1IQOA 1EH7A 2EOZA 4LFAE 3VYXA 3F6HA 2YTQA 4R2PA 2YTFA 3JU0A 2EPZA 4R2EA 2PRTA 4GKKE 2GHFA 4R2CA 2LCEA 3EPHA 2L8TA 2YTIA 3ECRA 2EPOA 2V87A 1T4LB 1QNTA 4WYQB 2GLIA 5A6BA 4M30A 2V86A 1SR9A 3C6KA 2EM6A 4DR3E 4YY3E 2EOSA 3VK6A 2EOHA 2L92A 4IJDA 2EE8A 2EOJA 3DJWA 4WXCA 4DUYE 3VHTB 2EOOA 2EOFA 2JWOA 5FLXC 2YT4A 1HNWE 2UXDE 1FJGE 2UUCE 1YSAC 4Q28A 4P78A 1JK2A 4WPYA 4JI1E 2YTDA 2FGGA 2DGCA 4LF9E 2EMYA 2EPPA 3OMLA 5AE1A 4DKKA 1HNXE 4KHPE 2J7JA 3TQMA 1I94E 2E5LE 3VYYA 4LF6E 2JP9A 2WZOA 3IWBA 2I13A 2NUFA 1L4SA 4Q35B 2LJUA 5TSEA 2ELZA 2EJ4A 1X3CA 2YTGA 2EM0A 2NA2A 4X65E 4JI5E 4ZYHA 1X6EA 3JAMC 1IBLE 2MC6A 4YHHE 1WXRA 5IXMB 2Q8UA 4N4RB 1HR0E 2YTEA 4DV7E 4B3SE 4MLVA 4RH8A 2KONA 2VE7C 1STUA 1BBGA 2EWLA 4BC7A 1G2FC 2EPXA 2WBSA 2YTNA 2FV4B 1A1HA 2E1MA 4BCAA 2VF1A 4TUIA 2EP3A 4WSPA 1X47A 4JI4E 3AV0A 1T4OA 2HC5A 2FTXB 4L8NA 1P47A 1IQSA 5A69A 2EOMA 2L2KB 2YTPA 3QG5C 4NZVA 5A6BD 2B3TB 2EORA 2EPCA 4NXME 1KJKA 1UHZA 4HEIA 4DR4E 2H36X 2LJHA 3F6GA 2ZM6E 5KL7A 3JTZA 3KZYA 1X6HA 2EOEA 2YPNA 2UU9E 4WSGA 2DIXA 5KL6A 2YSPA 4GKJE 2EN7A 1ZR9A 1XNRE 3EPLA 1X5WA 2WBTA 5ADZA 1T38A 4X66E 2EQ1A 2EMKA 2LE2A 4DUZE 4BHBA 4DV6E 2EN2A 2NABA 2M4IA 2LVHA 3C4TA 3C6MA 2JR1A 1GTKA 4R2QA 1IBKE 1PJQA 1BBOA 3BF2A 4BS9A 4NHRA 1ZAAC 2EPLX 2EMIA 5A6AA 1WJPA 3THNA 1TN9A 2ENCA 2LV2A 2YSOA 4X8WA 2KHXA 4WFTA 3T1YE 2MDGA 3KWRA 3P1XA 1UBDC 5IV8B 1DQ3A 1EH6A 2V85A 1J26A 3BGHA 2MKDA 3IWDA 1PJTA 2JOXA 2L2NA 2K7IA 2LT7A 3HTXA 2EQ0A 2EM9A 5A6KA 4DMIA 1WHNA 1A1KA 3M99B 3OTOE 3J81C 3LMLA 5CFFE 1IBME 1XMOE 1UILA 3EPJA 1GZ6A 2YZTA 1WHQA 3THOB 4DR6E 4DV4E 2MC5A 4JI7E 2DMIA 2JPAA 1TF6A 2EMBA 2DLQA 2EL4A 4DV0E 4J8ZA 2YRKA 2UXBE 4WX9A 2DLKA 4BHCA 2V88A 4RHBB 2JXPA 4KWYA 1O0WA 2LO3A 4O5GA 2BB8A 1ZBQA 1A1FA 2VQEE 5T6JA 2EMHA 2IHR1 1N34E 2JOBA 4BMJA 1YUJA 2YTJA 2DSYA 1B69A 2EM4A 2EMAA 2MDRA 2L3JA 2EL6A 2ODRD 4JI6E 4BC9A 1FKAE 1UN6B 2D9HA 1SFEA 1PKPA 2GPIA 1A1IA 2K4VA 4MLQA 2M9AA 1YYWA 1IMUA 2RTXA 2LUPB 2HGHA 2UXCE 3MSWA 4O43A 2EPUA 2VQFE 4FK5C 5AASA 4R2RA 2CT1A 2EOXA 2EOIA 1ZBTA 4B3ME 2R1FA 5LL6R 2RSIA 4LFBE 3HQ1A 3K6QA 1WRJA 2LMZA 4O4KA 1NCSA 1YYOA 2DRPA 2JVAA 2L2MA 2EN1A 4F6NA 3UK3C
chains in the Genus database with same CATH topology
1Z1BA 2ELYA 1RMDA 2EMCA 2ENHA 1WJPA 2EE8A 2EOJA 4IJDA 1TN9A 2ENCA 2LV2A 2YSOA 2MDGA 2VRDA 3VHTB 2EOOA 2EOFA 1UBDC 1YSAC 2YRMA 1JK2A 2YTDA 1MEYC 2DGCA 2MKDA 2EMYA 2EPPA 2J7JA 2ENAA 5KL5A 2LT7A 2EQ0A 2JP9A 2EM9A 2I13A 5KL3A 2EM3A 1A1KA 4GZNC 2ADRA 2ELZA 3M99B 2EJ4A 1X3CA 2EM7A 2EMXA 2EM5A 2WCC3 2YTGA 2EM0A 2EMLA 3EPKA 2YU8A 1ZU1A 1F2IG 1X6EA 3EPJA 2WBUA 1LLMC 4R2SA 2YTEA 2DMIA 2EOQA 2JPAA 1TF6A 2EMBA 3MHHC 5KL4A 1A1LA 2DLQA 2EL4A 2YU5A 2EM2A 2MKNA 2EN3A 2EMWA 4X9JA 2RPCA 2YRKA 1G2FC 2EPXA 2WBSA 3UK3C 1YUIA 2EM8A 2DLKA 2YTNA 2EPRA 2EMGA 1A1HA 2CTDA 2EL5A 2LO3A 2YRHA 1TF3A 2EP3A 2BB8A 1A1FA 1BB8A 2EMHA 1DGCA 2EN8A 2E72A 2EQ3A 1P47A 1YUJA 2YTJA 4M9VC 4R2AA 1B69A 2A25A 2EM4A 2EOMA 1G2DC 2YTPA 2EMAA 4R2DA 2EL6A 2EOZA 2EORA 4R2PA 2EPCA 2YTQA 1KJKA 1AAYA 2YTFA 2EPZA 1UN6B 1X6FA 2D9HA 2EPAA 5KL7A 4R2EA 2EOYA 2EN4A 1X6HA 2PRTA 1JK1A 2EOEA 1A1IA 2GHFA 4WSGA 4R2CA 2M9AA 2CSHA 2LCEA 5KL2A 1A1GA 5KL6A 2YSPA 2EN7A 2EMFA 4F2JC 2HGHA 1ZR9A 3EPHA 3EPLA 2EPUA 2YTIA 1X5WA 2EMZA 2WBTA 3MHSC 4IS1C 4FK5C 4R2RA 2CT1A 2EOXA 2EOIA 2EMKA 2EQ1A 2R1FA 2EN2A 2RSIA 1A1JA 2GLIA 2NABA 2LVHA 2EM6A 2DRPA 1NCSA 4F6MA 4R2QA 2EOSA 1BBOA 2YTOA 2EN1A 2EN6A 1ZAAC 4F6NA 2EOHA 2EMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1B A;  2ELY A;  1RMD A;  2EMC A;  2ENH A;  1WJP A;  2EE8 A;  2EOJ A;  4IJD A;  1TN9 A;  2ENC A;  2LV2 A;  2YSO A;  2MDG A;  2VRD A;  3VHT B;  2EOO A;  2EOF A;  1UBD C;  1YSA C;  2YRM A;  1JK2 A;  2YTD A;  1MEY C;  2DGC A;  2MKD A;  2EMY A;  2EPP A;  2J7J A;  2ENA A;  5KL5 A;  2LT7 A;  2EQ0 A;  2JP9 A;  2EM9 A;  2I13 A;  5KL3 A;  2EM3 A;  1A1K A;  4GZN C;  2ADR A;  2ELZ A;  3M99 B;  2EJ4 A;  1X3C A;  2EM7 A;  2EMX A;  2EM5 A;  2WCC 3;  2YTG A;  2EM0 A;  2EML A;  3EPK A;  2YU8 A;  1ZU1 A;  1F2I G;  1X6E A;  3EPJ A;  2WBU A;  1LLM C;  4R2S A;  2YTE A;  2DMI A;  2EOQ A;  2JPA A;  1TF6 A;  2EMB A;  3MHH C;  5KL4 A;  1A1L A;  2DLQ A;  2EL4 A;  2YU5 A;  2EM2 A;  2MKN A;  2EN3 A;  2EMW A;  4X9J A;  2RPC A;  2YRK A;  1G2F C;  2EPX A;  2WBS A;  3UK3 C;  1YUI A;  2EM8 A;  2DLK A;  2YTN A;  2EPR A;  2EMG A;  1A1H A;  2CTD A;  2EL5 A;  2LO3 A;  2YRH A;  1TF3 A;  2EP3 A;  2BB8 A;  1A1F A;  1BB8 A;  2EMH A;  1DGC A;  2EN8 A;  2E72 A;  2EQ3 A;  1P47 A;  1YUJ A;  2YTJ A;  4M9V C;  4R2A A;  1B69 A;  2A25 A;  2EM4 A;  2EOM A;  1G2D C;  2YTP A;  2EMA A;  4R2D A;  2EL6 A;  2EOZ A;  2EOR A;  4R2P A;  2EPC A;  2YTQ A;  1KJK A;  1AAY A;  2YTF A;  2EPZ A;  1UN6 B;  1X6F A;  2D9H A;  2EPA A;  5KL7 A;  4R2E A;  2EOY A;  2EN4 A;  1X6H A;  2PRT A;  1JK1 A;  2EOE A;  1A1I A;  2GHF A;  4WSG A;  4R2C A;  2M9A A;  2CSH A;  2LCE A;  5KL2 A;  1A1G A;  5KL6 A;  2YSP A;  2EN7 A;  2EMF A;  4F2J C;  2HGH A;  1ZR9 A;  3EPH A;  3EPL A;  2EPU A;  2YTI A;  1X5W A;  2EMZ A;  2WBT A;  3MHS C;  4IS1 C;  4FK5 C;  4R2R A;  2CT1 A;  2EOX A;  2EOI A;  2EMK A;  2EQ1 A;  2R1F A;  2EN2 A;  2RSI A;  1A1J A;  2GLI A;  2NAB A;  2LVH A;  2EM6 A;  2DRP A;  1NCS A;  4F6M A;  4R2Q A;  2EOS A;  1BBO A;  2YTO A;  2EN1 A;  2EN6 A;  1ZAA C;  4F6N A;  2EOH A;  2EMI A; 
#chains in the Genus database with same CATH topology
 2JYA A;  1Z1B A;  1T4N A;  2M7Q A;  2HHH E;  2EZ6 A;  2HJJ A;  4F9A B;  2VRD A;  2YWQ A;  1J5E E;  2N3G A;  1DI2 A;  4ZYE A;  5IT9 C;  4DR7 E;  1PDA A;  1YPN A;  1XNQ E;  3J7Y p;  1N3G A;  3J80 C;  4DV3 E;  2ENA A;  4DV2 E;  4LTY A;  5AC4 A;  4K0K E;  5KL3 A;  2EM3 A;  2LTR A;  4R03 A;  4GZN C;  2EM7 A;  2EMX A;  3BBG A;  3EPK A;  5LMU E;  2EPN A;  2G7H A;  2M1S A;  4LU9 A;  1YYK A;  1YFH A;  3ADI A;  3LLH A;  4DR5 E;  2WBU A;  3L00 A;  4BBY A;  5LMN E;  3ADG A;  4TUG A;  4ZYG A;  4B3R E;  4X64 E;  2I9I A;  2EOQ A;  1YZ9 A;  5AE3 A;  1A1L A;  2YU5 A;  2L3C A;  2MKN A;  2UUB E;  2LUQ A;  2RS7 A;  2EMW A;  4X9J A;  5A6J A;  4I8O A;  1YUI A;  2EM8 A;  2ODR C;  2EPR A;  2RQL A;  4LF8 E;  2YRH A;  1N32 E;  4F54 A;  4HTG A;  3KZZ A;  1X49 A;  2UUA E;  1BB8 A;  2F8B A;  3C4B A;  3FIG A;  4L5N C;  4LF4 E;  2DB2 A;  5AE2 A;  2E72 A;  2EQ3 A;  4M9V C;  1T39 A;  4WXD A;  4O24 A;  4F9B B;  1PJS A;  4R2D A;  2LRS A;  1MGT A;  3ADL A;  4JI8 E;  2RSM A;  1AAY A;  3DF6 A;  4NXN E;  1X6F A;  2EPA A;  2EOY A;  4JYA E;  2R76 A;  2EN4 A;  1JK1 A;  3BID A;  3HXL A;  2CSH A;  4DV1 E;  4R8O A;  5KL2 A;  1A1G A;  3HPS A;  1EH8 A;  2NUG A;  2EMF A;  4F2J C;  3ADJ A;  1AH5 A;  2EMZ A;  3MHS C;  1RQ0 A;  4IS1 C;  4P7D A;  4LFC E;  4DV5 E;  4AQY E;  1EKZ A;  1NEI A;  1A1J A;  3AUZ A;  1N33 E;  5AC5 A;  4F6M A;  2YTO A;  3EQ1 A;  2EN6 A;  5A2Q C;  3RMP A;  2V89 A;  2ELY A;  1RMD A;  2EMC A;  2ENH A;  4OOG C;  4DR2 E;  2B7V A;  2BBG A;  2CPN A;  2KOU A;  2YRM A;  4JI3 E;  5BR8 E;  4X62 E;  1MEY C;  4B3T E;  2F4V E;  4LF5 E;  2V83 A;  5KL5 A;  5LLQ A;  1XMQ E;  1KYQ A;  2ADR A;  3H09 A;  2L6M A;  2EM5 A;  5IWA E;  2WCC 3;  2EML A;  2YU8 A;  1ZU1 A;  2B7T A;  1F2I G;  2L33 A;  4ZYD A;  3J7A G;  2RS6 A;  4JI0 E;  2JY9 A;  2LTS A;  2B9D A;  4F9C B;  1LLM C;  4M2Z A;  4M0V A;  4R2S A;  4KZS A;  2N8X A;  5DNY A;  3MHH C;  4JI2 E;  5KL4 A;  1N36 E;  2EM2 A;  2V8Q B;  2EN3 A;  2EPM X;  2N3H A;  2DMY A;  2RPC A;  2NUE A;  4DR1 E;  1QU6 A;  2EMG A;  2CTD A;  3IWC A;  1RC7 A;  3HPZ A;  2EL5 A;  1TF3 A;  2LBS B;  4JV5 E;  4OX9 E;  5F3W A;  3T1H E;  1HNZ E;  1GQE A;  1DGC A;  2EN8 A;  3ZOQ B;  4R2A A;  2A25 A;  2EPK X;  4GEQ B;  1G2D C;  4LF7 E;  1X48 A;  1IQO A;  1EH7 A;  2EOZ A;  4LFA E;  3VYX A;  3F6H A;  2YTQ A;  4R2P A;  2YTF A;  3JU0 A;  2EPZ A;  4R2E A;  2PRT A;  4GKK E;  2GHF A;  4R2C A;  2LCE A;  3EPH A;  2L8T A;  2YTI A;  3ECR A;  2EPO A;  2V87 A;  1T4L B;  1QNT A;  4WYQ B;  2GLI A;  5A6B A;  4M30 A;  2V86 A;  1SR9 A;  3C6K A;  2EM6 A;  4DR3 E;  4YY3 E;  2EOS A;  3VK6 A;  2EOH A;  2L92 A;  4IJD A;  2EE8 A;  2EOJ A;  3DJW A;  4WXC A;  4DUY E;  3VHT B;  2EOO A;  2EOF A;  2JWO A;  5FLX C;  2YT4 A;  1HNW E;  2UXD E;  1FJG E;  2UUC E;  1YSA C;  4Q28 A;  4P78 A;  1JK2 A;  4WPY A;  4JI1 E;  2YTD A;  2FGG A;  2DGC A;  4LF9 E;  2EMY A;  2EPP A;  3OML A;  5AE1 A;  4DKK A;  1HNX E;  4KHP E;  2J7J A;  3TQM A;  1I94 E;  2E5L E;  3VYY A;  4LF6 E;  2JP9 A;  2WZO A;  3IWB A;  2I13 A;  2NUF A;  1L4S A;  4Q35 B;  2LJU A;  5TSE A;  2ELZ A;  2EJ4 A;  1X3C A;  2YTG A;  2EM0 A;  2NA2 A;  4X65 E;  4JI5 E;  4ZYH A;  1X6E A;  3JAM C;  1IBL E;  2MC6 A;  4YHH E;  1WXR A;  5IXM B;  2Q8U A;  4N4R B;  1HR0 E;  2YTE A;  4DV7 E;  4B3S E;  4MLV A;  4RH8 A;  2KON A;  2VE7 C;  1STU A;  1BBG A;  2EWL A;  4BC7 A;  1G2F C;  2EPX A;  2WBS A;  2YTN A;  2FV4 B;  1A1H A;  2E1M A;  4BCA A;  2VF1 A;  4TUI A;  2EP3 A;  4WSP A;  1X47 A;  4JI4 E;  3AV0 A;  1T4O A;  2HC5 A;  2FTX B;  4L8N A;  1P47 A;  1IQS A;  5A69 A;  2EOM A;  2L2K B;  2YTP A;  3QG5 C;  4NZV A;  5A6B D;  2B3T B;  2EOR A;  2EPC A;  4NXM E;  1KJK A;  1UHZ A;  4HEI A;  4DR4 E;  2H36 X;  2LJH A;  3F6G A;  2ZM6 E;  5KL7 A;  3JTZ A;  3KZY A;  1X6H A;  2EOE A;  2YPN A;  2UU9 E;  4WSG A;  2DIX A;  5KL6 A;  2YSP A;  4GKJ E;  2EN7 A;  1ZR9 A;  1XNR E;  3EPL A;  1X5W A;  2WBT A;  5ADZ A;  1T38 A;  4X66 E;  2EQ1 A;  2EMK A;  2LE2 A;  4DUZ E;  4BHB A;  4DV6 E;  2EN2 A;  2NAB A;  2M4I A;  2LVH A;  3C4T A;  3C6M A;  2JR1 A;  1GTK A;  4R2Q A;  1IBK E;  1PJQ A;  1BBO A;  3BF2 A;  4BS9 A;  4NHR A;  1ZAA C;  2EPL X;  2EMI A;  5A6A A;  1WJP A;  3THN A;  1TN9 A;  2ENC A;  2LV2 A;  2YSO A;  4X8W A;  2KHX A;  4WFT A;  3T1Y E;  2MDG A;  3KWR A;  3P1X A;  1UBD C;  5IV8 B;  1DQ3 A;  1EH6 A;  2V85 A;  1J26 A;  3BGH A;  2MKD A;  3IWD A;  1PJT A;  2JOX A;  2L2N A;  2K7I A;  2LT7 A;  3HTX A;  2EQ0 A;  2EM9 A;  5A6K A;  4DMI A;  1WHN A;  1A1K A;  3M99 B;  3OTO E;  3J81 C;  3LML A;  5CFF E;  1IBM E;  1XMO E;  1UIL A;  3EPJ A;  1GZ6 A;  2YZT A;  1WHQ A;  3THO B;  4DR6 E;  4DV4 E;  2MC5 A;  4JI7 E;  2DMI A;  2JPA A;  1TF6 A;  2EMB A;  2DLQ A;  2EL4 A;  4DV0 E;  4J8Z A;  2YRK A;  2UXB E;  4WX9 A;  2DLK A;  4BHC A;  2V88 A;  4RHB B;  2JXP A;  4KWY A;  1O0W A;  2LO3 A;  4O5G A;  2BB8 A;  1ZBQ A;  1A1F A;  2VQE E;  5T6J A;  2EMH A;  2IHR 1;  1N34 E;  2JOB A;  4BMJ A;  1YUJ A;  2YTJ A;  2DSY A;  1B69 A;  2EM4 A;  2EMA A;  2MDR A;  2L3J A;  2EL6 A;  2ODR D;  4JI6 E;  4BC9 A;  1FKA E;  1UN6 B;  2D9H A;  1SFE A;  1PKP A;  2GPI A;  1A1I A;  2K4V A;  4MLQ A;  2M9A A;  1YYW A;  1IMU A;  2RTX A;  2LUP B;  2HGH A;  2UXC E;  3MSW A;  4O43 A;  2EPU A;  2VQF E;  4FK5 C;  5AAS A;  4R2R A;  2CT1 A;  2EOX A;  2EOI A;  1ZBT A;  4B3M E;  2R1F A;  5LL6 R;  2RSI A;  4LFB E;  3HQ1 A;  3K6Q A;  1WRJ A;  2LMZ A;  4O4K A;  1NCS A;  1YYO A;  2DRP A;  2JVA A;  2L2M A;  2EN1 A;  4F6N A;  3UK3 C; 
#chains in the Genus database with same CATH homology
 1Z1B A;  2ELY A;  1RMD A;  2EMC A;  2ENH A;  1WJP A;  2EE8 A;  2EOJ A;  4IJD A;  1TN9 A;  2ENC A;  2LV2 A;  2YSO A;  2MDG A;  2VRD A;  3VHT B;  2EOO A;  2EOF A;  1UBD C;  1YSA C;  2YRM A;  1JK2 A;  2YTD A;  1MEY C;  2DGC A;  2MKD A;  2EMY A;  2EPP A;  2J7J A;  2ENA A;  5KL5 A;  2LT7 A;  2EQ0 A;  2JP9 A;  2EM9 A;  2I13 A;  5KL3 A;  2EM3 A;  1A1K A;  4GZN C;  2ADR A;  2ELZ A;  3M99 B;  2EJ4 A;  1X3C A;  2EM7 A;  2EMX A;  2EM5 A;  2WCC 3;  2YTG A;  2EM0 A;  2EML A;  3EPK A;  2YU8 A;  1ZU1 A;  1F2I G;  1X6E A;  3EPJ A;  2WBU A;  1LLM C;  4R2S A;  2YTE A;  2DMI A;  2EOQ A;  2JPA A;  1TF6 A;  2EMB A;  3MHH C;  5KL4 A;  1A1L A;  2DLQ A;  2EL4 A;  2YU5 A;  2EM2 A;  2MKN A;  2EN3 A;  2EMW A;  4X9J A;  2RPC A;  2YRK A;  1G2F C;  2EPX A;  2WBS A;  3UK3 C;  1YUI A;  2EM8 A;  2DLK A;  2YTN A;  2EPR A;  2EMG A;  1A1H A;  2CTD A;  2EL5 A;  2LO3 A;  2YRH A;  1TF3 A;  2EP3 A;  2BB8 A;  1A1F A;  1BB8 A;  2EMH A;  1DGC A;  2EN8 A;  2E72 A;  2EQ3 A;  1P47 A;  1YUJ A;  2YTJ A;  4M9V C;  4R2A A;  1B69 A;  2A25 A;  2EM4 A;  2EOM A;  1G2D C;  2YTP A;  2EMA A;  4R2D A;  2EL6 A;  2EOZ A;  2EOR A;  4R2P A;  2EPC A;  2YTQ A;  1KJK A;  1AAY A;  2YTF A;  2EPZ A;  1UN6 B;  1X6F A;  2D9H A;  2EPA A;  5KL7 A;  4R2E A;  2EOY A;  2EN4 A;  1X6H A;  2PRT A;  1JK1 A;  2EOE A;  1A1I A;  2GHF A;  4WSG A;  4R2C A;  2M9A A;  2CSH A;  2LCE A;  5KL2 A;  1A1G A;  5KL6 A;  2YSP A;  2EN7 A;  2EMF A;  4F2J C;  2HGH A;  1ZR9 A;  3EPH A;  3EPL A;  2EPU A;  2YTI A;  1X5W A;  2EMZ A;  2WBT A;  3MHS C;  4IS1 C;  4FK5 C;  4R2R A;  2CT1 A;  2EOX A;  2EOI A;  2EMK A;  2EQ1 A;  2R1F A;  2EN2 A;  2RSI A;  1A1J A;  2GLI A;  2NAB A;  2LVH A;  2EM6 A;  2DRP A;  1NCS A;  4F6M A;  4R2Q A;  2EOS A;  1BBO A;  2YTO A;  2EN1 A;  2EN6 A;  1ZAA C;  4F6N A;  2EOH A;  2EMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...