2YTQA

Solution structure of the c2h2 type zinc finger (region 775-807) of human zinc finger protein 268
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGAGEKPYGCSECGKAFSSKSYLIIHMRTHSGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 775-807) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytqA01
3EPKA 2EN8A 2EE8A 2EN4A 2EM5A 4R2QA 2EL6A 2HGHA 1A1IA 1AAYA 2EPPA 2EMLA 1WJPA 1YSAC 2EM6A 2EP3A 1G2DC 1JK2A 2I13A 1BBOA 2YTPA 4F6NA 2EM9A 2D9HA 2LCEA 2YTGA 3EPLA 2ADRA 1ZR9A 4FK5C 2R1FA 2YU8A 5KL6A 4R2PA 1NCSA 2LVHA 2YTOA 1TN9A 2EPXA 2EOIA 4F6MA 1KJKA 2MKNA 2JPAA 2CSHA 2JP9A 2ELZA 5KL5A 2YRHA 1UN6B 2A25A 4F2JC 1RMDA 2EJ4A 2EL5A 2EN3A 2RPCA 3M99B 2PRTA 5KL3A 1A1GA 4R2EA 2CT1A 2EMGA 2YTJA 3MHHC 1LLMC 2EM8A 1A1JA 2EOHA 5KL2A 2J7JA 5KL4A 2EOXA 2YRMA 2DMIA 2YTQA 2YTFA 5KL7A 2WCC3 2DGCA 2EPUA 2WBUA 2EMAA 3UK3C 2MDGA 4R2CA 1YUIA 2EM4A 4IS1C 2EMKA 2ENAA 2EOEA 2ELYA 2EOJA 2ENCA 2EORA 2EOQA 2EM7A 1B69A 2GLIA 4M9VC 4R2AA 1A1FA 2M9AA 1X3CA 2EN6A 1A1KA 2EMWA 2EPCA 2EMXA 3EPJA 1TF3A 2EL4A 2E72A 2DLQA 1P47A 2EQ0A 1X5WA 2WBTA 2EN2A 1MEYC 2EM2A 1UBDC 2YRKA 2EPAA 2YTNA 2YSPA 2NABA 2EM3A 4R2SA 1BB8A 2GHFA 2DLKA 4IJDA 1X6FA 1F2IG 2EMCA 2EN7A 1X6HA 2EMFA 2EMBA 2ENHA 2EQ3A 1YUJA 1G2FC 2EOSA 4WSGA 2EOOA 1Z1BA 2EOMA 2EM0A 2RSIA 3MHSC 4R2DA 1A1HA 2EPZA 2YSOA 1DGCA 4GZNC 2EPRA 2YTIA 2EN1A 1A1LA 2EMIA 2EMZA 2EMHA 2WBSA 2EOFA 2LV2A 1JK1A 2CTDA 2VRDA 2EQ1A 1ZAAC 2YTEA 1ZU1A 2MKDA 2YTDA 1TF6A 2BB8A 2DRPA 4X9JA 4R2RA 2YU5A 3EPHA 2LO3A 1X6EA 2LT7A 2EOYA 2EOZA 3VHTB 2EMYA
chains in the Genus database with same CATH superfamily
1YYOA 4KZSA 2EN4A 4R2QA 2Q8UA 1X49A 2HGHA 2L2MA 2I13A 4WFTA 2UUAE 1IBKE 1J26A 2LTRA 2ODRD 3EPLA 3HPZA 2ADRA 3BF2A 3BIDA 4FK5C 2R1FA 2NUGA 3RMPA 4L8NA 1IBME 2YTOA 1HNWE 2EPXA 2EOIA 4F6MA 1WRJA 5AE1A 1WHQA 5KL5A 3J7Yp 2DSYA 2LE2A 5A6KA 3M99B 2EJ4A 2PRTA 5KL3A 1EH8A 2YTJA 4RH8A 4LF9E 4LF5E 2WZOA 2EOXA 3DJWA 1T4LB 5KL7A 2LBSB 5A6BD 2VQEE 1L4SA 2RQLA 1T38A 2EM4A 4IS1C 2F4VE 2EMKA 2JOXA 4L5NC 1PJSA 4WXCA 1PJTA 2CPNA 2ELYA 2EORA 2EOQA 1YYWA 3J81C 2RTXA 3J80C 4R2AA 4ZYEA 1FJGE 5LLQA 2E1MA 2EPCA 4LFAE 3EPJA 1IQOA 2B9DA 2E72A 1P47A 3DF6A 4Q28A 3OMLA 1MEYC 2EM2A 2YRKA 2V88A 2YT4A 2NABA 4NZVA 3HXLA 2YPNA 4P7DA 2JR1A 4GKJE 4DR3E 1F2IG 2EMCA 1MGTA 1T39A 2UUCE 1ZBQA 2HC5A 5A69A 1RQ0A 1Z1BA 2EWLA 5DNYA 1HNXE 2V87A 2HJJA 1HNZE 2EMZA 4LTYA 2WBSA 2EPLX 2EOFA 1JK1A 2VRDA 5A6JA 4M30A 4BS9A 4BHCA 2UUBE 2YTEA 3BBGA 3JAMC 1ZU1A 5LMUE 2DRPA 2L3JA 2JVAA 4X9JA 4R2RA 4M0VA 4DMIA 1X6EA 4X8WA 2L8TA 4GEQB 3C4TA 3AUZA 1NEIA 2L92A 3EPKA 1O0WA 1N3GA 2JYAA 4YY3E 5A2QC 2EM5A 5IT9C 1A1IA 1AAYA 3ADJA 5AASA 4X62E 1WJPA 4X66E 4DV7E 2V89A 2EM6A 1G2DC 1XMOE 2YTGA 4BBYA 2DB2A 3KZYA 1QU6A 2LJHA 2LMZA 2RSMA 1ZR9A 4DV2E 1IMUA 1NCSA 2LVHA 4J8ZA 2HHHE 2JXPA 3F6HA 2JPAA 2CSHA 2ELZA 1IBLE 2YRHA 3TQMA 1J5EE 4KHPE 1EH6A 1RMDA 2EL5A 1DQ3A 2L6MA 3AV0A 2CT1A 2EMGA 3MHHC 2DIXA 1LLMC 1DI2A 4LU9A 2YRMA 2YTQA 2B7VA 2YTFA 5TSEA 2EMAA 2YWQA 2UXBE 1IQSA 1WHNA 2MDGA 4O43A 4R2CA 4DV5E 4WX9A 3IWBA 4DR5E 1ZBTA 3THOB 4HTGA 5LMNE 2EOEA 2ENCA 4AQYE 2V86A 2UU9E 3ADIA 2GLIA 4X65E 5CFFE 4M9VC 1X3CA 5AE2A 4HEIA 1T4OA 1A1KA 2EMWA 2EPOA 1YYKA 2DLQA 2LUQA 1N33E 2BBGA 5IXMB 2EN2A 2EPAA 2JWOA 3QG5C 1BBGA 2EM3A 2DLKA 1GTKA 2VF1A 2NUFA 3HPSA 3EQ1A 4O4KA 1PKPA 1GZ6A 5A6AA 1X6HA 2RS7A 1YUJA 4LF7E 1X47A 4JYAE 4JI7E 4DUZE 2N3GA 2EOOA 1AH5A 3ECRA 1XNQE 4KWYA 4WYQB 2VE7C 1N32E 2EPNA 1YZ9A 2YTIA 4F9CB 2EN1A 1A1LA 2R76A 2CTDA 1YPNA 4JV5E 3C6KA 4B3SE 4DV6E 2LO3A 3EPHA 1EH7A 4DV4E 4F54A 2EN8A 2B7TA 2N8XA 5AC5A 2M1SA 2EL6A 2LRSA 2JY9A 4WSPA 4P78A 1YSAC 1N36E 1KYQA 2EP3A 1JK2A 1BBOA 4DR2E 2KHXA 4LFBE 5T6JA 2LUPB 3IWDA 2ODRC 2YU8A 4R2PA 1KJKA 2GPIA 2K7IA 3BGHA 5A6BA 4X64E 1UN6B 3HQ1A 2UXDE 2A25A 5IV8B 1T4NA 4F2JC 4JI3E 2FTXB 1A1GA 2V83A 2K4VA 3MSWA 4ZYDA 2EM8A 3HTXA 2EOHA 5KL2A 4DUYE 1HR0E 2J7JA 2DMIA 2DGCA 2WCC3 3THNA 4DR1E 4OX9E 2M4IA 2ENAA 2MDRA 3ZOQB 2I9IA 2EOJA 3C6MA 3IWCA 1SR9A 4NHRA 4BMJA 5ADZA 4BC9A 1B69A 4JI0E 2M9AA 4O24A 2H36X 2EMXA 3JU0A 1X5WA 2WBTA 1PJQA 1UBDC 2YTNA 2YSPA 4JI8E 4R2SA 1BB8A 2GHFA 4JI6E 2L3CA 2L2NA 2EMFA 2EMBA 1SFEA 2ENHA 4JI1E 4Q35B 1G2FC 4JI4E 4R03A 2EOSA 2B3TB 2EOMA 4I8OA 2EM0A 2RSIA 5AC4A 2FV4B 4R2DA 3J7AG 2EPZA 1DGCA 4GZNC 2MC6A 4TUIA 2EPMX 1UHZA 1UILA 1ZAAC 2E5LE 3F6GA 2MKDA 2YTDA 4DKKA 2MC5A 1FKAE 3K6QA 2N3HA 1YFHA 3VHTB 2EMYA 5FLXC 2KOUA 3ADGA 2EE8A 2NA2A 5AE3A 2V85A 2EPPA 3KZZA 2EMLA 4YHHE 2YTPA 4F6NA 1XMQE 2EM9A 2D9HA 2LCEA 5IWAE 2DMYA 2JOBA 4RHBB 4OOGC 4WPYA 4B3ME 5KL6A 2EPKX 4F9AB 1TN9A 4DV1E 2MKNA 4JI2E 2JP9A 2G7HA 2F8BA 2M7QA 3LLHA 3VK6A 5BR8E 1I94E 2EN3A 2RPCA 4TUGA 1WXRA 4R2EA 3OTOE 1EKZA 3JTZA 1A1JA 5KL4A 3L00A 4MLVA 2EPUA 2WBUA 3UK3C 4JI5E 4DV3E 1RC7A 3T1YE 4LF8E 1YUIA 3VYXA 2IHR1 5LL6R 2NUEA 4F9BB 3LMLA 2EM7A 1PDAA 3P1XA 4BC7A 4B3RE 4BCAA 2LJUA 2LTSA 4BHBA 2UXCE 1A1FA 2EN6A 2RS6A 4GKKE 4DR6E 4NXNE 2YZTA 2L33A 4DV0E 1TF3A 2EL4A 2EQ0A 4DR7E 3H09A 1QNTA 4MLQA 4R8OA 4N4RB 2EZ6A 1STUA 2FGGA 4O5GA 4IJDA 4ZYHA 1X6FA 2EN7A 4LF6E 2EQ3A 4K0KE 5F3WA 2VQFE 3VYYA 4WSGA 3FIGA 1GQEA 2V8QB 4NXME 3MHSC 1A1HA 2ZM6E 2YSOA 2EPRA 4B3TE 3KWRA 2EMIA 4ZYGA 2EMHA 4LFCE 2LV2A 2EQ1A 3T1HE 3ADLA 3C4BA 1X48A 1XNRE 2L2KB 4LF4E 4WXDA 2KONA 1TF6A 2BB8A 4DR4E 2YU5A 2LT7A 1N34E 2EOYA 2EOZA 4M2ZA
chains in the Genus database with same CATH topology
3EPKA 2EN8A 2EE8A 2EN4A 2EM5A 4R2QA 2EL6A 2HGHA 1A1IA 1AAYA 2EPPA 2EMLA 1WJPA 1YSAC 2EM6A 2EP3A 1G2DC 1JK2A 2I13A 1BBOA 2YTPA 4F6NA 2EM9A 2D9HA 2LCEA 2YTGA 3EPLA 2ADRA 1ZR9A 4FK5C 2R1FA 2YU8A 5KL6A 4R2PA 1NCSA 2LVHA 2YTOA 1TN9A 2EPXA 2EOIA 4F6MA 1KJKA 2MKNA 2JPAA 2CSHA 2JP9A 2ELZA 5KL5A 2YRHA 1UN6B 2A25A 4F2JC 1RMDA 2EJ4A 2EL5A 2EN3A 2RPCA 3M99B 2PRTA 5KL3A 1A1GA 4R2EA 2CT1A 2EMGA 2YTJA 3MHHC 1LLMC 2EM8A 1A1JA 2EOHA 5KL2A 2J7JA 5KL4A 2EOXA 2YRMA 2DMIA 2YTQA 2YTFA 5KL7A 2WCC3 2DGCA 2EPUA 2WBUA 2EMAA 3UK3C 2MDGA 4R2CA 1YUIA 2EM4A 4IS1C 2EMKA 2ENAA 2EOEA 2ELYA 2EOJA 2ENCA 2EORA 2EOQA 2EM7A 1B69A 2GLIA 4M9VC 4R2AA 1A1FA 2M9AA 1X3CA 2EN6A 1A1KA 2EMWA 2EPCA 2EMXA 3EPJA 1TF3A 2EL4A 2E72A 2DLQA 1P47A 2EQ0A 1X5WA 2WBTA 2EN2A 1MEYC 2EM2A 1UBDC 2YRKA 2EPAA 2YTNA 2YSPA 2NABA 2EM3A 4R2SA 1BB8A 2GHFA 2DLKA 4IJDA 1X6FA 1F2IG 2EMCA 2EN7A 1X6HA 2EMFA 2EMBA 2ENHA 2EQ3A 1YUJA 1G2FC 2EOSA 4WSGA 2EOOA 1Z1BA 2EOMA 2EM0A 2RSIA 3MHSC 4R2DA 1A1HA 2EPZA 2YSOA 1DGCA 4GZNC 2EPRA 2YTIA 2EN1A 1A1LA 2EMIA 2EMZA 2EMHA 2WBSA 2EOFA 2LV2A 1JK1A 2CTDA 2VRDA 2EQ1A 1ZAAC 2YTEA 1ZU1A 2MKDA 2YTDA 1TF6A 2BB8A 2DRPA 4X9JA 4R2RA 2YU5A 3EPHA 2LO3A 1X6EA 2LT7A 2EOYA 2EOZA 3VHTB 2EMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPK A;  2EN8 A;  2EE8 A;  2EN4 A;  2EM5 A;  4R2Q A;  2EL6 A;  2HGH A;  1A1I A;  1AAY A;  2EPP A;  2EML A;  1WJP A;  1YSA C;  2EM6 A;  2EP3 A;  1G2D C;  1JK2 A;  2I13 A;  1BBO A;  2YTP A;  4F6N A;  2EM9 A;  2D9H A;  2LCE A;  2YTG A;  3EPL A;  2ADR A;  1ZR9 A;  4FK5 C;  2R1F A;  2YU8 A;  5KL6 A;  4R2P A;  1NCS A;  2LVH A;  2YTO A;  1TN9 A;  2EPX A;  2EOI A;  4F6M A;  1KJK A;  2MKN A;  2JPA A;  2CSH A;  2JP9 A;  2ELZ A;  5KL5 A;  2YRH A;  1UN6 B;  2A25 A;  4F2J C;  1RMD A;  2EJ4 A;  2EL5 A;  2EN3 A;  2RPC A;  3M99 B;  2PRT A;  5KL3 A;  1A1G A;  4R2E A;  2CT1 A;  2EMG A;  2YTJ A;  3MHH C;  1LLM C;  2EM8 A;  1A1J A;  2EOH A;  5KL2 A;  2J7J A;  5KL4 A;  2EOX A;  2YRM A;  2DMI A;  2YTQ A;  2YTF A;  5KL7 A;  2WCC 3;  2DGC A;  2EPU A;  2WBU A;  2EMA A;  3UK3 C;  2MDG A;  4R2C A;  1YUI A;  2EM4 A;  4IS1 C;  2EMK A;  2ENA A;  2EOE A;  2ELY A;  2EOJ A;  2ENC A;  2EOR A;  2EOQ A;  2EM7 A;  1B69 A;  2GLI A;  4M9V C;  4R2A A;  1A1F A;  2M9A A;  1X3C A;  2EN6 A;  1A1K A;  2EMW A;  2EPC A;  2EMX A;  3EPJ A;  1TF3 A;  2EL4 A;  2E72 A;  2DLQ A;  1P47 A;  2EQ0 A;  1X5W A;  2WBT A;  2EN2 A;  1MEY C;  2EM2 A;  1UBD C;  2YRK A;  2EPA A;  2YTN A;  2YSP A;  2NAB A;  2EM3 A;  4R2S A;  1BB8 A;  2GHF A;  2DLK A;  4IJD A;  1X6F A;  1F2I G;  2EMC A;  2EN7 A;  1X6H A;  2EMF A;  2EMB A;  2ENH A;  2EQ3 A;  1YUJ A;  1G2F C;  2EOS A;  4WSG A;  2EOO A;  1Z1B A;  2EOM A;  2EM0 A;  2RSI A;  3MHS C;  4R2D A;  1A1H A;  2EPZ A;  2YSO A;  1DGC A;  4GZN C;  2EPR A;  2YTI A;  2EN1 A;  1A1L A;  2EMI A;  2EMZ A;  2EMH A;  2WBS A;  2EOF A;  2LV2 A;  1JK1 A;  2CTD A;  2VRD A;  2EQ1 A;  1ZAA C;  2YTE A;  1ZU1 A;  2MKD A;  2YTD A;  1TF6 A;  2BB8 A;  2DRP A;  4X9J A;  4R2R A;  2YU5 A;  3EPH A;  2LO3 A;  1X6E A;  2LT7 A;  2EOY A;  2EOZ A;  3VHT B;  2EMY A; 
#chains in the Genus database with same CATH topology
 1YYO A;  4KZS A;  2EN4 A;  4R2Q A;  2Q8U A;  1X49 A;  2HGH A;  2L2M A;  2I13 A;  4WFT A;  2UUA E;  1IBK E;  1J26 A;  2LTR A;  2ODR D;  3EPL A;  3HPZ A;  2ADR A;  3BF2 A;  3BID A;  4FK5 C;  2R1F A;  2NUG A;  3RMP A;  4L8N A;  1IBM E;  2YTO A;  1HNW E;  2EPX A;  2EOI A;  4F6M A;  1WRJ A;  5AE1 A;  1WHQ A;  5KL5 A;  3J7Y p;  2DSY A;  2LE2 A;  5A6K A;  3M99 B;  2EJ4 A;  2PRT A;  5KL3 A;  1EH8 A;  2YTJ A;  4RH8 A;  4LF9 E;  4LF5 E;  2WZO A;  2EOX A;  3DJW A;  1T4L B;  5KL7 A;  2LBS B;  5A6B D;  2VQE E;  1L4S A;  2RQL A;  1T38 A;  2EM4 A;  4IS1 C;  2F4V E;  2EMK A;  2JOX A;  4L5N C;  1PJS A;  4WXC A;  1PJT A;  2CPN A;  2ELY A;  2EOR A;  2EOQ A;  1YYW A;  3J81 C;  2RTX A;  3J80 C;  4R2A A;  4ZYE A;  1FJG E;  5LLQ A;  2E1M A;  2EPC A;  4LFA E;  3EPJ A;  1IQO A;  2B9D A;  2E72 A;  1P47 A;  3DF6 A;  4Q28 A;  3OML A;  1MEY C;  2EM2 A;  2YRK A;  2V88 A;  2YT4 A;  2NAB A;  4NZV A;  3HXL A;  2YPN A;  4P7D A;  2JR1 A;  4GKJ E;  4DR3 E;  1F2I G;  2EMC A;  1MGT A;  1T39 A;  2UUC E;  1ZBQ A;  2HC5 A;  5A69 A;  1RQ0 A;  1Z1B A;  2EWL A;  5DNY A;  1HNX E;  2V87 A;  2HJJ A;  1HNZ E;  2EMZ A;  4LTY A;  2WBS A;  2EPL X;  2EOF A;  1JK1 A;  2VRD A;  5A6J A;  4M30 A;  4BS9 A;  4BHC A;  2UUB E;  2YTE A;  3BBG A;  3JAM C;  1ZU1 A;  5LMU E;  2DRP A;  2L3J A;  2JVA A;  4X9J A;  4R2R A;  4M0V A;  4DMI A;  1X6E A;  4X8W A;  2L8T A;  4GEQ B;  3C4T A;  3AUZ A;  1NEI A;  2L92 A;  3EPK A;  1O0W A;  1N3G A;  2JYA A;  4YY3 E;  5A2Q C;  2EM5 A;  5IT9 C;  1A1I A;  1AAY A;  3ADJ A;  5AAS A;  4X62 E;  1WJP A;  4X66 E;  4DV7 E;  2V89 A;  2EM6 A;  1G2D C;  1XMO E;  2YTG A;  4BBY A;  2DB2 A;  3KZY A;  1QU6 A;  2LJH A;  2LMZ A;  2RSM A;  1ZR9 A;  4DV2 E;  1IMU A;  1NCS A;  2LVH A;  4J8Z A;  2HHH E;  2JXP A;  3F6H A;  2JPA A;  2CSH A;  2ELZ A;  1IBL E;  2YRH A;  3TQM A;  1J5E E;  4KHP E;  1EH6 A;  1RMD A;  2EL5 A;  1DQ3 A;  2L6M A;  3AV0 A;  2CT1 A;  2EMG A;  3MHH C;  2DIX A;  1LLM C;  1DI2 A;  4LU9 A;  2YRM A;  2YTQ A;  2B7V A;  2YTF A;  5TSE A;  2EMA A;  2YWQ A;  2UXB E;  1IQS A;  1WHN A;  2MDG A;  4O43 A;  4R2C A;  4DV5 E;  4WX9 A;  3IWB A;  4DR5 E;  1ZBT A;  3THO B;  4HTG A;  5LMN E;  2EOE A;  2ENC A;  4AQY E;  2V86 A;  2UU9 E;  3ADI A;  2GLI A;  4X65 E;  5CFF E;  4M9V C;  1X3C A;  5AE2 A;  4HEI A;  1T4O A;  1A1K A;  2EMW A;  2EPO A;  1YYK A;  2DLQ A;  2LUQ A;  1N33 E;  2BBG A;  5IXM B;  2EN2 A;  2EPA A;  2JWO A;  3QG5 C;  1BBG A;  2EM3 A;  2DLK A;  1GTK A;  2VF1 A;  2NUF A;  3HPS A;  3EQ1 A;  4O4K A;  1PKP A;  1GZ6 A;  5A6A A;  1X6H A;  2RS7 A;  1YUJ A;  4LF7 E;  1X47 A;  4JYA E;  4JI7 E;  4DUZ E;  2N3G A;  2EOO A;  1AH5 A;  3ECR A;  1XNQ E;  4KWY A;  4WYQ B;  2VE7 C;  1N32 E;  2EPN A;  1YZ9 A;  2YTI A;  4F9C B;  2EN1 A;  1A1L A;  2R76 A;  2CTD A;  1YPN A;  4JV5 E;  3C6K A;  4B3S E;  4DV6 E;  2LO3 A;  3EPH A;  1EH7 A;  4DV4 E;  4F54 A;  2EN8 A;  2B7T A;  2N8X A;  5AC5 A;  2M1S A;  2EL6 A;  2LRS A;  2JY9 A;  4WSP A;  4P78 A;  1YSA C;  1N36 E;  1KYQ A;  2EP3 A;  1JK2 A;  1BBO A;  4DR2 E;  2KHX A;  4LFB E;  5T6J A;  2LUP B;  3IWD A;  2ODR C;  2YU8 A;  4R2P A;  1KJK A;  2GPI A;  2K7I A;  3BGH A;  5A6B A;  4X64 E;  1UN6 B;  3HQ1 A;  2UXD E;  2A25 A;  5IV8 B;  1T4N A;  4F2J C;  4JI3 E;  2FTX B;  1A1G A;  2V83 A;  2K4V A;  3MSW A;  4ZYD A;  2EM8 A;  3HTX A;  2EOH A;  5KL2 A;  4DUY E;  1HR0 E;  2J7J A;  2DMI A;  2DGC A;  2WCC 3;  3THN A;  4DR1 E;  4OX9 E;  2M4I A;  2ENA A;  2MDR A;  3ZOQ B;  2I9I A;  2EOJ A;  3C6M A;  3IWC A;  1SR9 A;  4NHR A;  4BMJ A;  5ADZ A;  4BC9 A;  1B69 A;  4JI0 E;  2M9A A;  4O24 A;  2H36 X;  2EMX A;  3JU0 A;  1X5W A;  2WBT A;  1PJQ A;  1UBD C;  2YTN A;  2YSP A;  4JI8 E;  4R2S A;  1BB8 A;  2GHF A;  4JI6 E;  2L3C A;  2L2N A;  2EMF A;  2EMB A;  1SFE A;  2ENH A;  4JI1 E;  4Q35 B;  1G2F C;  4JI4 E;  4R03 A;  2EOS A;  2B3T B;  2EOM A;  4I8O A;  2EM0 A;  2RSI A;  5AC4 A;  2FV4 B;  4R2D A;  3J7A G;  2EPZ A;  1DGC A;  4GZN C;  2MC6 A;  4TUI A;  2EPM X;  1UHZ A;  1UIL A;  1ZAA C;  2E5L E;  3F6G A;  2MKD A;  2YTD A;  4DKK A;  2MC5 A;  1FKA E;  3K6Q A;  2N3H A;  1YFH A;  3VHT B;  2EMY A;  5FLX C;  2KOU A;  3ADG A;  2EE8 A;  2NA2 A;  5AE3 A;  2V85 A;  2EPP A;  3KZZ A;  2EML A;  4YHH E;  2YTP A;  4F6N A;  1XMQ E;  2EM9 A;  2D9H A;  2LCE A;  5IWA E;  2DMY A;  2JOB A;  4RHB B;  4OOG C;  4WPY A;  4B3M E;  5KL6 A;  2EPK X;  4F9A B;  1TN9 A;  4DV1 E;  2MKN A;  4JI2 E;  2JP9 A;  2G7H A;  2F8B A;  2M7Q A;  3LLH A;  3VK6 A;  5BR8 E;  1I94 E;  2EN3 A;  2RPC A;  4TUG A;  1WXR A;  4R2E A;  3OTO E;  1EKZ A;  3JTZ A;  1A1J A;  5KL4 A;  3L00 A;  4MLV A;  2EPU A;  2WBU A;  3UK3 C;  4JI5 E;  4DV3 E;  1RC7 A;  3T1Y E;  4LF8 E;  1YUI A;  3VYX A;  2IHR 1;  5LL6 R;  2NUE A;  4F9B B;  3LML A;  2EM7 A;  1PDA A;  3P1X A;  4BC7 A;  4B3R E;  4BCA A;  2LJU A;  2LTS A;  4BHB A;  2UXC E;  1A1F A;  2EN6 A;  2RS6 A;  4GKK E;  4DR6 E;  4NXN E;  2YZT A;  2L33 A;  4DV0 E;  1TF3 A;  2EL4 A;  2EQ0 A;  4DR7 E;  3H09 A;  1QNT A;  4MLQ A;  4R8O A;  4N4R B;  2EZ6 A;  1STU A;  2FGG A;  4O5G A;  4IJD A;  4ZYH A;  1X6F A;  2EN7 A;  4LF6 E;  2EQ3 A;  4K0K E;  5F3W A;  2VQF E;  3VYY A;  4WSG A;  3FIG A;  1GQE A;  2V8Q B;  4NXM E;  3MHS C;  1A1H A;  2ZM6 E;  2YSO A;  2EPR A;  4B3T E;  3KWR A;  2EMI A;  4ZYG A;  2EMH A;  4LFC E;  2LV2 A;  2EQ1 A;  3T1H E;  3ADL A;  3C4B A;  1X48 A;  1XNR E;  2L2K B;  4LF4 E;  4WXD A;  2KON A;  1TF6 A;  2BB8 A;  4DR4 E;  2YU5 A;  2LT7 A;  1N34 E;  2EOY A;  2EOZ A;  4M2Z A; 
#chains in the Genus database with same CATH homology
 3EPK A;  2EN8 A;  2EE8 A;  2EN4 A;  2EM5 A;  4R2Q A;  2EL6 A;  2HGH A;  1A1I A;  1AAY A;  2EPP A;  2EML A;  1WJP A;  1YSA C;  2EM6 A;  2EP3 A;  1G2D C;  1JK2 A;  2I13 A;  1BBO A;  2YTP A;  4F6N A;  2EM9 A;  2D9H A;  2LCE A;  2YTG A;  3EPL A;  2ADR A;  1ZR9 A;  4FK5 C;  2R1F A;  2YU8 A;  5KL6 A;  4R2P A;  1NCS A;  2LVH A;  2YTO A;  1TN9 A;  2EPX A;  2EOI A;  4F6M A;  1KJK A;  2MKN A;  2JPA A;  2CSH A;  2JP9 A;  2ELZ A;  5KL5 A;  2YRH A;  1UN6 B;  2A25 A;  4F2J C;  1RMD A;  2EJ4 A;  2EL5 A;  2EN3 A;  2RPC A;  3M99 B;  2PRT A;  5KL3 A;  1A1G A;  4R2E A;  2CT1 A;  2EMG A;  2YTJ A;  3MHH C;  1LLM C;  2EM8 A;  1A1J A;  2EOH A;  5KL2 A;  2J7J A;  5KL4 A;  2EOX A;  2YRM A;  2DMI A;  2YTQ A;  2YTF A;  5KL7 A;  2WCC 3;  2DGC A;  2EPU A;  2WBU A;  2EMA A;  3UK3 C;  2MDG A;  4R2C A;  1YUI A;  2EM4 A;  4IS1 C;  2EMK A;  2ENA A;  2EOE A;  2ELY A;  2EOJ A;  2ENC A;  2EOR A;  2EOQ A;  2EM7 A;  1B69 A;  2GLI A;  4M9V C;  4R2A A;  1A1F A;  2M9A A;  1X3C A;  2EN6 A;  1A1K A;  2EMW A;  2EPC A;  2EMX A;  3EPJ A;  1TF3 A;  2EL4 A;  2E72 A;  2DLQ A;  1P47 A;  2EQ0 A;  1X5W A;  2WBT A;  2EN2 A;  1MEY C;  2EM2 A;  1UBD C;  2YRK A;  2EPA A;  2YTN A;  2YSP A;  2NAB A;  2EM3 A;  4R2S A;  1BB8 A;  2GHF A;  2DLK A;  4IJD A;  1X6F A;  1F2I G;  2EMC A;  2EN7 A;  1X6H A;  2EMF A;  2EMB A;  2ENH A;  2EQ3 A;  1YUJ A;  1G2F C;  2EOS A;  4WSG A;  2EOO A;  1Z1B A;  2EOM A;  2EM0 A;  2RSI A;  3MHS C;  4R2D A;  1A1H A;  2EPZ A;  2YSO A;  1DGC A;  4GZN C;  2EPR A;  2YTI A;  2EN1 A;  1A1L A;  2EMI A;  2EMZ A;  2EMH A;  2WBS A;  2EOF A;  2LV2 A;  1JK1 A;  2CTD A;  2VRD A;  2EQ1 A;  1ZAA C;  2YTE A;  1ZU1 A;  2MKD A;  2YTD A;  1TF6 A;  2BB8 A;  2DRP A;  4X9J A;  4R2R A;  2YU5 A;  3EPH A;  2LO3 A;  1X6E A;  2LT7 A;  2EOY A;  2EOZ A;  3VHT B;  2EMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...