2ENAA

Solution structure of the c2h2 type zinc finger (region 311-343) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 311-343) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2enaA00
2EM7A 2YTJA 1WJPA 2DMIA 2M9AA 2YRHA 2YTQA 2EOFA 2EE8A 2A25A 2LO3A 4F2JC 2EJ4A 2EOMA 4M9VC 2EOOA 2EOQA 2R1FA 2ADRA 3EPJA 2J7JA 2EMIA 2WBSA 2EOIA 2EM9A 4FK5C 1UN6B 2EM8A 2EMCA 4F6MA 2ENCA 2ELYA 2EQ3A 1ZAAC 2HGHA 4R2RA 1ZU1A 3EPKA 1G2DC 3M99B 2EL5A 1X6FA 2EMLA 2EOHA 2YU8A 1A1IA 2EMWA 2EM3A 3EPLA 2DRPA 2ELZA 2NABA 2CT1A 2BB8A 1NCSA 2EN6A 2EOZA 2WCC3 2EMAA 4R2PA 2LCEA 4R2DA 1X6EA 1Z1BA 4IS1C 2RPCA 2D9HA 2YU5A 2EM6A 2YTPA 5KL4A 2EMXA 2JP9A 4R2SA 3MHSC 2EPXA 2EP3A 2EORA 2YTFA 2YRKA 2YTOA 1JK1A 1YUJA 2MKNA 1AAYA 1F2IG 2EPCA 3EPHA 1TF3A 2EPAA 1TN9A 2WBUA 2DLQA 2WBTA 1KJKA 2YTNA 2EN3A 2EMYA 2ENAA 2EPRA 2EOEA 2MKDA 1B69A 2YTEA 1TF6A 2GHFA 2PRTA 1X5WA 2LT7A 1A1LA 2EM0A 2EMZA 1YSAC 2LV2A 1X6HA 1DGCA 5KL6A 2DGCA 2EM4A 2YTGA 2EN8A 4WSGA 2CTDA 4R2QA 1UBDC 2EPZA 2EMGA 5KL3A 1A1HA 2EL6A 3VHTB 1ZR9A 2EM5A 1YUIA 1P47A 3MHHC 1A1KA 1G2FC 2EN7A 2CSHA 2EN1A 2YTDA 4IJDA 1A1GA 5KL5A 2EPPA 1X3CA 1A1JA 2YRMA 1LLMC 4R2EA 3UK3C 2LVHA 2GLIA 2DLKA 2EM2A 2EOJA 2EMHA 2VRDA 2E72A 1A1FA 2EL4A 2EOYA 2I13A 2EN2A 2MDGA 4R2AA 2EQ0A 5KL2A 2ENHA 1BB8A 2EOSA 2YSOA 1RMDA 4R2CA 2YSPA 5KL7A 1MEYC 2EMFA 4X9JA 2EMBA 2JPAA 2EMKA 2EN4A 4F6NA 1JK2A 2EQ1A 2EOXA 2YTIA 1BBOA 2EPUA 4GZNC 2RSIA
chains in the Genus database with same CATH superfamily
4JI7E 2YTJA 1WJPA 2M9AA 2YPNA 5A6JA 4WYQB 1ZBQA 1N34E 1X48A 2EJ4A 4M9VC 2DB2A 1IBLE 2YT4A 1T4NA 1WHNA 2B9DA 1YFHA 3ECRA 2WBSA 1UN6B 2EPMX 2EMCA 1J5EE 2EQ3A 3DF6A 4F9CB 2K7IA 2L2NA 1ZAAC 4LF8E 5LLQA 3EPKA 1HNZE 3VYXA 4GEQB 2EOHA 4BBYA 2YU8A 2EM3A 3EPLA 3HQ1A 4JV5E 4WFTA 5IV8B 2UUAE 4R2DA 4M2ZA 4IS1C 2HHHE 2V83A 2D9HA 4BHCA 2JYAA 1X49A 2EM6A 4DR1E 2EMXA 1J26A 4X66E 2EPXA 5TSEA 1ZBTA 1SFEA 4YHHE 4GKKE 2EORA 2YTFA 2YRKA 2YTOA 1WXRA 2JXPA 1AAYA 3HPSA 1TF3A 2EPAA 2N3GA 4DR6E 1FJGE 2WBTA 4N4RB 4O4KA 2EPRA 2L8TA 1HNXE 2YTEA 5LL6R 4JI8E 4DV4E 2EPNA 1EH8A 1FKAE 2L33A 2H36X 3KZYA 2EPZA 2E5LE 2EL6A 4NHRA 4WSPA 2Q8UA 2EN1A 2G7HA 2LUQA 5IXMB 1LLMC 2HJJA 4DV2E 2GLIA 2GPIA 2ZM6E 2VRDA 1A1FA 3FIGA 2LE2A 4DR3E 4TUIA 4LF5E 4R03A 2ENHA 5F3WA 3IWBA 5A6AA 4DR2E 5KL7A 4I8OA 2JWOA 4BHBA 2LUPB 2EQ1A 3J80C 4R2EA 5A6BA 2UXDE 3BGHA 2YRHA 2EE8A 2KHXA 4HEIA 2A25A 5A69A 3C6KA 1N33E 4NXNE 2EOOA 2ADRA 2EPLX 3BF2A 4ZYHA 2FTXB 4NZVA 3DJWA 4FK5C 2FGGA 2EM8A 2ELYA 2EZ6A 4R2RA 1T39A 1ZU1A 1T4LB 3M99B 2DIXA 2F8BA 4F54A 4JI4E 2UXCE 4BC9A 4DV5E 2DRPA 4B3RE 4L5NC 2FV4B 2NABA 2BB8A 4J8ZA 2EOZA 2UU9E 1XNQE 2MC5A 2EMAA 1GQEA 4WX9A 3C6MA 3KWRA 5AE1A 2V85A 3HXLA 2YU5A 4O5GA 2EPOA 5KL4A 4R2SA 2L6MA 3IWDA 3MSWA 4M0VA 1RC7A 1YUJA 4B3SE 5AC5A 2EPCA 4JI1E 5DNYA 2WBUA 1AH5A 2KOUA 2DLQA 2EMYA 1IMUA 2JR1A 4R8OA 1B69A 5IWAE 1T38A 2LT7A 2MC6A 2N3HA 2I9IA 2LV2A 1X6HA 5AC4A 2DGCA 2EM4A 3VK6A 3L00A 2IHR1 5AE3A 4R2QA 3C4BA 3THNA 3AV0A 1ZR9A 3TQMA 4BC7A 4JI3E 1A1KA 1O0WA 2EN7A 2CSHA 4ZYEA 1PDAA 4Q35B 5A6BD 1HNWE 1A1GA 1YYKA 1QNTA 4LFCE 1XMOE 2KONA 4DV0E 1PJTA 2LVHA 3QG5C 3T1HE 3THOB 2EM2A 2EOJA 4LFBE 3T1YE 3ZOQB 2I13A 4DV6E 5KL2A 1PJQA 4X8WA 3ADJA 4LF4E 2EOSA 2YSOA 3RMPA 2DMYA 1RMDA 4JYAE 2VQFE 2YSPA 4DR7E 3LMLA 2EMBA 2EN4A 4F6NA 1JK2A 2NUEA 2EOXA 4F9BB 3VYYA 4WPYA 4O24A 2EWLA 2YTQA 5AASA 2EOFA 4NXME 4X65E 4LFAE 2EOMA 2K4VA 2LTRA 4O43A 2LRSA 3EPJA 4P7DA 4LF9E 1YZ9A 2EM9A 2M4IA 2RS7A 4F6MA 2ENCA 4X64E 2HGHA 3EQ1A 1X6FA 2EMLA 4ZYGA 3F6GA 4B3TE 2ELZA 2CT1A 1NCSA 2B3TB 1NEIA 2UUBE 4RH8A 4LF6E 2WCC3 4R2PA 4DR5E 1X6EA 1Z1BA 3C4TA 4LU9A 3ADIA 4DMIA 4HTGA 4ZYDA 4WXCA 1T4OA 2B7TA 2JOXA 4DR4E 2JP9A 5LMUE 2L2MA 3J7Yp 4MLQA 5IT9C 1F2IG 1L4SA 1X47A 2F4VE 1TN9A 1WRJA 4DUZE 2JVAA 2V87A 1PKPA 1KJKA 4KZSA 2ENAA 2EOEA 2MKDA 4TUGA 1KYQA 1STUA 1N3GA 2DSYA 3J7AG 2EM0A 1YSAC 2L2KB 1XNRE 4DV7E 1GZ6A 4B3ME 5BR8E 1IBME 2EMGA 2RTXA 3JAMC 1EH6A 3HPZA 2EM5A 2UXBE 1G2FC 4JI2E 2YTDA 4IJDA 1IQSA 2EPPA 1X3CA 1A1JA 3ADGA 3UK3C 2DLKA 2E1MA 1HR0E 1YYWA 2EMHA 2V89A 2EPKX 1QU6A 4AQYE 4BS9A 1PJSA 2L3JA 4R2AA 2EQ0A 4K0KE 2R76A 2JPAA 1UHZA 4JI6E 1UILA 2YTIA 1BBOA 4DKKA 2RS6A 4GZNC 1P47A 2N8XA 2EM7A 3AUZA 2DMIA 3KZZA 2LO3A 4F2JC 2B7VA 1EKZA 4L8NA 2EOQA 3F6HA 5ADZA 2R1FA 2BBGA 2M7QA 2J7JA 4DV1E 2EMIA 2V88A 2EOIA 5LMNE 4OX9E 4F9AB 4JI0E 5A6KA 1G2DC 2EL5A 2VE7C 2RQLA 4X62E 2WZOA 1YYOA 2ODRD 1IBKE 1EH7A 2V86A 4DUYE 2EMWA 1A1IA 2NA2A 1GTKA 1WHQA 2YWQA 2NUFA 2EN6A 4BMJA 1SR9A 1RQ0A 3JU0A 2UUCE 1N32E 5A2QC 2VQEE 4Q28A 2LCEA 1IQOA 2RPCA 3LLHA 2RSMA 2YTPA 5AE2A 3OTOE 3BIDA 3MHSC 1MGTA 2YZTA 1DQ3A 1YPNA 2EP3A 2MKNA 1JK1A 3HTXA 3IWCA 3EPHA 2LTSA 4KHPE 2JOBA 3ADLA 2CPNA 2JY9A 3K6QA 1I94E 3H09A 1DI2A 2YTNA 2EN3A 4P78A 5T6JA 1TF6A 2GHFA 2PRTA 1X5WA 1A1LA 2EMZA 1DGCA 5KL6A 3P1XA 1XMQE 2LMZA 2YTGA 2EN8A 4WSGA 2NUGA 2L3CA 2CTDA 2HC5A 1UBDC 4JI5E 2LBSB 5KL3A 1A1HA 3VHTB 2V8QB 1YUIA 3MHHC 4M30A 4KWYA 2L92A 2M1SA 5KL5A 4LF7E 2YRMA 2LJHA 2VF1A 5FLXC 1N36E 2E72A 4LTYA 2EL4A 4MLVA 2LJUA 2EOYA 2EN2A 2MDGA 1BB8A 4BCAA 4YY3E 4OOGC 2MDRA 1BBGA 4WXDA 4R2CA 3J81C 4DV3E 2ODRC 3BBGA 1MEYC 3OMLA 2EMFA 4X9JA 4GKJE 4RHBB 2EMKA 5CFFE 2EPUA 3JTZA 2RSIA
chains in the Genus database with same CATH topology
2EM7A 2YTJA 1WJPA 2DMIA 2M9AA 2YRHA 2YTQA 2EOFA 2EE8A 2A25A 2LO3A 4F2JC 2EJ4A 2EOMA 4M9VC 2EOOA 2EOQA 2R1FA 2ADRA 3EPJA 2J7JA 2EMIA 2WBSA 2EOIA 2EM9A 4FK5C 1UN6B 2EM8A 2EMCA 4F6MA 2ENCA 2ELYA 2EQ3A 1ZAAC 2HGHA 4R2RA 1ZU1A 3EPKA 1G2DC 3M99B 2EL5A 1X6FA 2EMLA 2EOHA 2YU8A 1A1IA 2EMWA 2EM3A 3EPLA 2DRPA 2ELZA 2NABA 2CT1A 2BB8A 1NCSA 2EN6A 2EOZA 2WCC3 2EMAA 4R2PA 2LCEA 4R2DA 1X6EA 1Z1BA 4IS1C 2RPCA 2D9HA 2YU5A 2EM6A 2YTPA 5KL4A 2EMXA 2JP9A 4R2SA 3MHSC 2EPXA 2EP3A 2EORA 2YTFA 2YRKA 2YTOA 1JK1A 1YUJA 2MKNA 1AAYA 1F2IG 2EPCA 3EPHA 1TF3A 2EPAA 1TN9A 2WBUA 2DLQA 2WBTA 1KJKA 2YTNA 2EN3A 2EMYA 2ENAA 2EPRA 2EOEA 2MKDA 1B69A 2YTEA 1TF6A 2GHFA 2PRTA 1X5WA 2LT7A 1A1LA 2EM0A 2EMZA 1YSAC 2LV2A 1X6HA 1DGCA 5KL6A 2DGCA 2EM4A 2YTGA 2EN8A 4WSGA 2CTDA 4R2QA 1UBDC 2EPZA 2EMGA 5KL3A 1A1HA 2EL6A 3VHTB 1ZR9A 2EM5A 1YUIA 1P47A 3MHHC 1A1KA 1G2FC 2EN7A 2CSHA 2EN1A 2YTDA 4IJDA 1A1GA 5KL5A 2EPPA 1X3CA 1A1JA 2YRMA 1LLMC 4R2EA 3UK3C 2LVHA 2GLIA 2DLKA 2EM2A 2EOJA 2EMHA 2VRDA 2E72A 1A1FA 2EL4A 2EOYA 2I13A 2EN2A 2MDGA 4R2AA 2EQ0A 5KL2A 2ENHA 1BB8A 2EOSA 2YSOA 1RMDA 4R2CA 2YSPA 5KL7A 1MEYC 2EMFA 4X9JA 2EMBA 2JPAA 2EMKA 2EN4A 4F6NA 1JK2A 2EQ1A 2EOXA 2YTIA 1BBOA 2EPUA 4GZNC 2RSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM7 A;  2YTJ A;  1WJP A;  2DMI A;  2M9A A;  2YRH A;  2YTQ A;  2EOF A;  2EE8 A;  2A25 A;  2LO3 A;  4F2J C;  2EJ4 A;  2EOM A;  4M9V C;  2EOO A;  2EOQ A;  2R1F A;  2ADR A;  3EPJ A;  2J7J A;  2EMI A;  2WBS A;  2EOI A;  2EM9 A;  4FK5 C;  1UN6 B;  2EM8 A;  2EMC A;  4F6M A;  2ENC A;  2ELY A;  2EQ3 A;  1ZAA C;  2HGH A;  4R2R A;  1ZU1 A;  3EPK A;  1G2D C;  3M99 B;  2EL5 A;  1X6F A;  2EML A;  2EOH A;  2YU8 A;  1A1I A;  2EMW A;  2EM3 A;  3EPL A;  2DRP A;  2ELZ A;  2NAB A;  2CT1 A;  2BB8 A;  1NCS A;  2EN6 A;  2EOZ A;  2WCC 3;  2EMA A;  4R2P A;  2LCE A;  4R2D A;  1X6E A;  1Z1B A;  4IS1 C;  2RPC A;  2D9H A;  2YU5 A;  2EM6 A;  2YTP A;  5KL4 A;  2EMX A;  2JP9 A;  4R2S A;  3MHS C;  2EPX A;  2EP3 A;  2EOR A;  2YTF A;  2YRK A;  2YTO A;  1JK1 A;  1YUJ A;  2MKN A;  1AAY A;  1F2I G;  2EPC A;  3EPH A;  1TF3 A;  2EPA A;  1TN9 A;  2WBU A;  2DLQ A;  2WBT A;  1KJK A;  2YTN A;  2EN3 A;  2EMY A;  2ENA A;  2EPR A;  2EOE A;  2MKD A;  1B69 A;  2YTE A;  1TF6 A;  2GHF A;  2PRT A;  1X5W A;  2LT7 A;  1A1L A;  2EM0 A;  2EMZ A;  1YSA C;  2LV2 A;  1X6H A;  1DGC A;  5KL6 A;  2DGC A;  2EM4 A;  2YTG A;  2EN8 A;  4WSG A;  2CTD A;  4R2Q A;  1UBD C;  2EPZ A;  2EMG A;  5KL3 A;  1A1H A;  2EL6 A;  3VHT B;  1ZR9 A;  2EM5 A;  1YUI A;  1P47 A;  3MHH C;  1A1K A;  1G2F C;  2EN7 A;  2CSH A;  2EN1 A;  2YTD A;  4IJD A;  1A1G A;  5KL5 A;  2EPP A;  1X3C A;  1A1J A;  2YRM A;  1LLM C;  4R2E A;  3UK3 C;  2LVH A;  2GLI A;  2DLK A;  2EM2 A;  2EOJ A;  2EMH A;  2VRD A;  2E72 A;  1A1F A;  2EL4 A;  2EOY A;  2I13 A;  2EN2 A;  2MDG A;  4R2A A;  2EQ0 A;  5KL2 A;  2ENH A;  1BB8 A;  2EOS A;  2YSO A;  1RMD A;  4R2C A;  2YSP A;  5KL7 A;  1MEY C;  2EMF A;  4X9J A;  2EMB A;  2JPA A;  2EMK A;  2EN4 A;  4F6N A;  1JK2 A;  2EQ1 A;  2EOX A;  2YTI A;  1BBO A;  2EPU A;  4GZN C;  2RSI A; 
#chains in the Genus database with same CATH topology
 4JI7 E;  2YTJ A;  1WJP A;  2M9A A;  2YPN A;  5A6J A;  4WYQ B;  1ZBQ A;  1N34 E;  1X48 A;  2EJ4 A;  4M9V C;  2DB2 A;  1IBL E;  2YT4 A;  1T4N A;  1WHN A;  2B9D A;  1YFH A;  3ECR A;  2WBS A;  1UN6 B;  2EPM X;  2EMC A;  1J5E E;  2EQ3 A;  3DF6 A;  4F9C B;  2K7I A;  2L2N A;  1ZAA C;  4LF8 E;  5LLQ A;  3EPK A;  1HNZ E;  3VYX A;  4GEQ B;  2EOH A;  4BBY A;  2YU8 A;  2EM3 A;  3EPL A;  3HQ1 A;  4JV5 E;  4WFT A;  5IV8 B;  2UUA E;  4R2D A;  4M2Z A;  4IS1 C;  2HHH E;  2V83 A;  2D9H A;  4BHC A;  2JYA A;  1X49 A;  2EM6 A;  4DR1 E;  2EMX A;  1J26 A;  4X66 E;  2EPX A;  5TSE A;  1ZBT A;  1SFE A;  4YHH E;  4GKK E;  2EOR A;  2YTF A;  2YRK A;  2YTO A;  1WXR A;  2JXP A;  1AAY A;  3HPS A;  1TF3 A;  2EPA A;  2N3G A;  4DR6 E;  1FJG E;  2WBT A;  4N4R B;  4O4K A;  2EPR A;  2L8T A;  1HNX E;  2YTE A;  5LL6 R;  4JI8 E;  4DV4 E;  2EPN A;  1EH8 A;  1FKA E;  2L33 A;  2H36 X;  3KZY A;  2EPZ A;  2E5L E;  2EL6 A;  4NHR A;  4WSP A;  2Q8U A;  2EN1 A;  2G7H A;  2LUQ A;  5IXM B;  1LLM C;  2HJJ A;  4DV2 E;  2GLI A;  2GPI A;  2ZM6 E;  2VRD A;  1A1F A;  3FIG A;  2LE2 A;  4DR3 E;  4TUI A;  4LF5 E;  4R03 A;  2ENH A;  5F3W A;  3IWB A;  5A6A A;  4DR2 E;  5KL7 A;  4I8O A;  2JWO A;  4BHB A;  2LUP B;  2EQ1 A;  3J80 C;  4R2E A;  5A6B A;  2UXD E;  3BGH A;  2YRH A;  2EE8 A;  2KHX A;  4HEI A;  2A25 A;  5A69 A;  3C6K A;  1N33 E;  4NXN E;  2EOO A;  2ADR A;  2EPL X;  3BF2 A;  4ZYH A;  2FTX B;  4NZV A;  3DJW A;  4FK5 C;  2FGG A;  2EM8 A;  2ELY A;  2EZ6 A;  4R2R A;  1T39 A;  1ZU1 A;  1T4L B;  3M99 B;  2DIX A;  2F8B A;  4F54 A;  4JI4 E;  2UXC E;  4BC9 A;  4DV5 E;  2DRP A;  4B3R E;  4L5N C;  2FV4 B;  2NAB A;  2BB8 A;  4J8Z A;  2EOZ A;  2UU9 E;  1XNQ E;  2MC5 A;  2EMA A;  1GQE A;  4WX9 A;  3C6M A;  3KWR A;  5AE1 A;  2V85 A;  3HXL A;  2YU5 A;  4O5G A;  2EPO A;  5KL4 A;  4R2S A;  2L6M A;  3IWD A;  3MSW A;  4M0V A;  1RC7 A;  1YUJ A;  4B3S E;  5AC5 A;  2EPC A;  4JI1 E;  5DNY A;  2WBU A;  1AH5 A;  2KOU A;  2DLQ A;  2EMY A;  1IMU A;  2JR1 A;  4R8O A;  1B69 A;  5IWA E;  1T38 A;  2LT7 A;  2MC6 A;  2N3H A;  2I9I A;  2LV2 A;  1X6H A;  5AC4 A;  2DGC A;  2EM4 A;  3VK6 A;  3L00 A;  2IHR 1;  5AE3 A;  4R2Q A;  3C4B A;  3THN A;  3AV0 A;  1ZR9 A;  3TQM A;  4BC7 A;  4JI3 E;  1A1K A;  1O0W A;  2EN7 A;  2CSH A;  4ZYE A;  1PDA A;  4Q35 B;  5A6B D;  1HNW E;  1A1G A;  1YYK A;  1QNT A;  4LFC E;  1XMO E;  2KON A;  4DV0 E;  1PJT A;  2LVH A;  3QG5 C;  3T1H E;  3THO B;  2EM2 A;  2EOJ A;  4LFB E;  3T1Y E;  3ZOQ B;  2I13 A;  4DV6 E;  5KL2 A;  1PJQ A;  4X8W A;  3ADJ A;  4LF4 E;  2EOS A;  2YSO A;  3RMP A;  2DMY A;  1RMD A;  4JYA E;  2VQF E;  2YSP A;  4DR7 E;  3LML A;  2EMB A;  2EN4 A;  4F6N A;  1JK2 A;  2NUE A;  2EOX A;  4F9B B;  3VYY A;  4WPY A;  4O24 A;  2EWL A;  2YTQ A;  5AAS A;  2EOF A;  4NXM E;  4X65 E;  4LFA E;  2EOM A;  2K4V A;  2LTR A;  4O43 A;  2LRS A;  3EPJ A;  4P7D A;  4LF9 E;  1YZ9 A;  2EM9 A;  2M4I A;  2RS7 A;  4F6M A;  2ENC A;  4X64 E;  2HGH A;  3EQ1 A;  1X6F A;  2EML A;  4ZYG A;  3F6G A;  4B3T E;  2ELZ A;  2CT1 A;  1NCS A;  2B3T B;  1NEI A;  2UUB E;  4RH8 A;  4LF6 E;  2WCC 3;  4R2P A;  4DR5 E;  1X6E A;  1Z1B A;  3C4T A;  4LU9 A;  3ADI A;  4DMI A;  4HTG A;  4ZYD A;  4WXC A;  1T4O A;  2B7T A;  2JOX A;  4DR4 E;  2JP9 A;  5LMU E;  2L2M A;  3J7Y p;  4MLQ A;  5IT9 C;  1F2I G;  1L4S A;  1X47 A;  2F4V E;  1TN9 A;  1WRJ A;  4DUZ E;  2JVA A;  2V87 A;  1PKP A;  1KJK A;  4KZS A;  2ENA A;  2EOE A;  2MKD A;  4TUG A;  1KYQ A;  1STU A;  1N3G A;  2DSY A;  3J7A G;  2EM0 A;  1YSA C;  2L2K B;  1XNR E;  4DV7 E;  1GZ6 A;  4B3M E;  5BR8 E;  1IBM E;  2EMG A;  2RTX A;  3JAM C;  1EH6 A;  3HPZ A;  2EM5 A;  2UXB E;  1G2F C;  4JI2 E;  2YTD A;  4IJD A;  1IQS A;  2EPP A;  1X3C A;  1A1J A;  3ADG A;  3UK3 C;  2DLK A;  2E1M A;  1HR0 E;  1YYW A;  2EMH A;  2V89 A;  2EPK X;  1QU6 A;  4AQY E;  4BS9 A;  1PJS A;  2L3J A;  4R2A A;  2EQ0 A;  4K0K E;  2R76 A;  2JPA A;  1UHZ A;  4JI6 E;  1UIL A;  2YTI A;  1BBO A;  4DKK A;  2RS6 A;  4GZN C;  1P47 A;  2N8X A;  2EM7 A;  3AUZ A;  2DMI A;  3KZZ A;  2LO3 A;  4F2J C;  2B7V A;  1EKZ A;  4L8N A;  2EOQ A;  3F6H A;  5ADZ A;  2R1F A;  2BBG A;  2M7Q A;  2J7J A;  4DV1 E;  2EMI A;  2V88 A;  2EOI A;  5LMN E;  4OX9 E;  4F9A B;  4JI0 E;  5A6K A;  1G2D C;  2EL5 A;  2VE7 C;  2RQL A;  4X62 E;  2WZO A;  1YYO A;  2ODR D;  1IBK E;  1EH7 A;  2V86 A;  4DUY E;  2EMW A;  1A1I A;  2NA2 A;  1GTK A;  1WHQ A;  2YWQ A;  2NUF A;  2EN6 A;  4BMJ A;  1SR9 A;  1RQ0 A;  3JU0 A;  2UUC E;  1N32 E;  5A2Q C;  2VQE E;  4Q28 A;  2LCE A;  1IQO A;  2RPC A;  3LLH A;  2RSM A;  2YTP A;  5AE2 A;  3OTO E;  3BID A;  3MHS C;  1MGT A;  2YZT A;  1DQ3 A;  1YPN A;  2EP3 A;  2MKN A;  1JK1 A;  3HTX A;  3IWC A;  3EPH A;  2LTS A;  4KHP E;  2JOB A;  3ADL A;  2CPN A;  2JY9 A;  3K6Q A;  1I94 E;  3H09 A;  1DI2 A;  2YTN A;  2EN3 A;  4P78 A;  5T6J A;  1TF6 A;  2GHF A;  2PRT A;  1X5W A;  1A1L A;  2EMZ A;  1DGC A;  5KL6 A;  3P1X A;  1XMQ E;  2LMZ A;  2YTG A;  2EN8 A;  4WSG A;  2NUG A;  2L3C A;  2CTD A;  2HC5 A;  1UBD C;  4JI5 E;  2LBS B;  5KL3 A;  1A1H A;  3VHT B;  2V8Q B;  1YUI A;  3MHH C;  4M30 A;  4KWY A;  2L92 A;  2M1S A;  5KL5 A;  4LF7 E;  2YRM A;  2LJH A;  2VF1 A;  5FLX C;  1N36 E;  2E72 A;  4LTY A;  2EL4 A;  4MLV A;  2LJU A;  2EOY A;  2EN2 A;  2MDG A;  1BB8 A;  4BCA A;  4YY3 E;  4OOG C;  2MDR A;  1BBG A;  4WXD A;  4R2C A;  3J81 C;  4DV3 E;  2ODR C;  3BBG A;  1MEY C;  3OML A;  2EMF A;  4X9J A;  4GKJ E;  4RHB B;  2EMK A;  5CFF E;  2EPU A;  3JTZ A;  2RSI A; 
#chains in the Genus database with same CATH homology
 2EM7 A;  2YTJ A;  1WJP A;  2DMI A;  2M9A A;  2YRH A;  2YTQ A;  2EOF A;  2EE8 A;  2A25 A;  2LO3 A;  4F2J C;  2EJ4 A;  2EOM A;  4M9V C;  2EOO A;  2EOQ A;  2R1F A;  2ADR A;  3EPJ A;  2J7J A;  2EMI A;  2WBS A;  2EOI A;  2EM9 A;  4FK5 C;  1UN6 B;  2EM8 A;  2EMC A;  4F6M A;  2ENC A;  2ELY A;  2EQ3 A;  1ZAA C;  2HGH A;  4R2R A;  1ZU1 A;  3EPK A;  1G2D C;  3M99 B;  2EL5 A;  1X6F A;  2EML A;  2EOH A;  2YU8 A;  1A1I A;  2EMW A;  2EM3 A;  3EPL A;  2DRP A;  2ELZ A;  2NAB A;  2CT1 A;  2BB8 A;  1NCS A;  2EN6 A;  2EOZ A;  2WCC 3;  2EMA A;  4R2P A;  2LCE A;  4R2D A;  1X6E A;  1Z1B A;  4IS1 C;  2RPC A;  2D9H A;  2YU5 A;  2EM6 A;  2YTP A;  5KL4 A;  2EMX A;  2JP9 A;  4R2S A;  3MHS C;  2EPX A;  2EP3 A;  2EOR A;  2YTF A;  2YRK A;  2YTO A;  1JK1 A;  1YUJ A;  2MKN A;  1AAY A;  1F2I G;  2EPC A;  3EPH A;  1TF3 A;  2EPA A;  1TN9 A;  2WBU A;  2DLQ A;  2WBT A;  1KJK A;  2YTN A;  2EN3 A;  2EMY A;  2ENA A;  2EPR A;  2EOE A;  2MKD A;  1B69 A;  2YTE A;  1TF6 A;  2GHF A;  2PRT A;  1X5W A;  2LT7 A;  1A1L A;  2EM0 A;  2EMZ A;  1YSA C;  2LV2 A;  1X6H A;  1DGC A;  5KL6 A;  2DGC A;  2EM4 A;  2YTG A;  2EN8 A;  4WSG A;  2CTD A;  4R2Q A;  1UBD C;  2EPZ A;  2EMG A;  5KL3 A;  1A1H A;  2EL6 A;  3VHT B;  1ZR9 A;  2EM5 A;  1YUI A;  1P47 A;  3MHH C;  1A1K A;  1G2F C;  2EN7 A;  2CSH A;  2EN1 A;  2YTD A;  4IJD A;  1A1G A;  5KL5 A;  2EPP A;  1X3C A;  1A1J A;  2YRM A;  1LLM C;  4R2E A;  3UK3 C;  2LVH A;  2GLI A;  2DLK A;  2EM2 A;  2EOJ A;  2EMH A;  2VRD A;  2E72 A;  1A1F A;  2EL4 A;  2EOY A;  2I13 A;  2EN2 A;  2MDG A;  4R2A A;  2EQ0 A;  5KL2 A;  2ENH A;  1BB8 A;  2EOS A;  2YSO A;  1RMD A;  4R2C A;  2YSP A;  5KL7 A;  1MEY C;  2EMF A;  4X9J A;  2EMB A;  2JPA A;  2EMK A;  2EN4 A;  4F6N A;  1JK2 A;  2EQ1 A;  2EOX A;  2YTI A;  1BBO A;  2EPU A;  4GZN C;  2RSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...