2ENAA

Solution structure of the c2h2 type zinc finger (region 311-343) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 311-343) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2enaA00
4IJDA 2EOMA 2EPAA 2EMIA 4R2AA 3EPLA 2LCEA 1ZR9A 1YUIA 2YRKA 1B69A 2EN2A 1MEYC 2EL5A 2EMWA 1YUJA 1NCSA 2YRMA 1BBOA 4R2SA 1JK2A 2YSOA 2EQ1A 2EM6A 1UN6B 2WBSA 2EMXA 2MDGA 1A1KA 2EPXA 2EOXA 1Z1BA 2YU5A 2EN4A 1P47A 2EM0A 2EOQA 2EN7A 4R2QA 1G2DC 2BB8A 2YSPA 2EP3A 4F6MA 2YU8A 5KL2A 5KL3A 4R2RA 2EM4A 2PRTA 2ENCA 2DLKA 1X6EA 2GHFA 2A25A 2YTQA 2EM9A 2EMAA 2EMGA 2VRDA 4X9JA 2YTGA 1TF3A 1UBDC 1A1HA 1A1LA 5KL7A 1ZU1A 2WBTA 3EPHA 2EM5A 2YTPA 2JP9A 1X3CA 2EMKA 2ADRA 2RPCA 2EMCA 2LT7A 3UK3C 2LVHA 2CTDA 5KL6A 1A1FA 1A1IA 3MHSC 4R2CA 2EOSA 2EOFA 5KL5A 2EOYA 2D9HA 2EJ4A 2YTIA 2WCC3 2EMHA 2EPZA 2LO3A 2EOJA 2ELZA 2R1FA 2EPUA 2GLIA 2EMFA 2EPPA 2EQ0A 1X6FA 2EN8A 2CSHA 4IS1C 2DLQA 3VHTB 2EOEA 1A1JA 1A1GA 1X6HA 3EPKA 2YTFA 2YRHA 4R2EA 2EOHA 2ENAA 1WJPA 2EMLA 2MKDA 2EM3A 1TF6A 2YTEA 4FK5C 3MHHC 2EN3A 2LV2A 2EMYA 2EMBA 2I13A 5KL4A 2EOOA 3EPJA 1BB8A 4F6NA 1DGCA 2CT1A 2ELYA 2WBUA 2MKNA 1RMDA 2EL6A 2EN1A 4GZNC 2EL4A 1X5WA 2DGCA 1TN9A 2EPCA 2EE8A 2NABA 1YSAC 2ENHA 2HGHA 4R2DA 2EQ3A 1JK1A 2YTDA 3M99B 2EORA 2RSIA 1AAYA 2EM8A 2EM7A 2EM2A 2DMIA 2J7JA 1G2FC 2EN6A 1KJKA 1F2IG 4R2PA 2DRPA 2EOIA 4WSGA 1LLMC 4M9VC 2EPRA 2EOZA 2YTNA 2M9AA 2YTJA 2E72A 2EMZA 4F2JC 2JPAA 1ZAAC 2YTOA
chains in the Genus database with same CATH superfamily
2EOMA 3BGHA 1IMUA 2EMIA 2LCEA 1UHZA 4L5NC 2YRKA 1YUJA 1NCSA 5A6BD 1JK2A 2YSOA 4DMIA 1UN6B 5A6AA 5FLXC 2HC5A 2BB8A 2YSPA 1WRJA 5KL2A 4R2RA 1EH6A 2PRTA 3HPSA 2LMZA 2EM9A 2EMAA 2EMGA 3FIGA 1UBDC 5KL7A 3THOB 2UXDE 2EM5A 2N8XA 2VE7C 2GPIA 2Q8UA 2EMCA 2LJHA 4JI2E 4LF6E 4LF7E 3ECRA 2V83A 4X8WA 2EJ4A 2YTIA 5IT9C 5A69A 2JYAA 2LO3A 1IBKE 2UXBE 1IQSA 2EOJA 3HPZA 3VK6A 4WXCA 1RC7A 4NXME 3P1XA 1NEIA 2EMFA 4B3SE 2EQ0A 1XMOE 4WPYA 3OMLA 4BHCA 4IS1C 2YZTA 3ADLA 2YWQA 1ZBQA 4MLVA 4X62E 3J81C 1X6HA 2JVAA 1A1GA 2YRHA 4R2EA 1PJSA 2EOHA 2UUAE 5AE1A 4JI6E 3ADGA 2EN3A 4KWYA 1RQ0A 2EMYA 4ZYEA 4P78A 4J8ZA 1IBLE 4WXDA 1AH5A 4BS9A 3H09A 4GZNC 1YYOA 4DR6E 4DV5E 1YYWA 4BC9A 2DGCA 2NABA 2EE8A 1X49A 2JXPA 4M2ZA 4R2DA 3IWDA 3ZOQB 2FGGA 2JWOA 2EM8A 2EM7A 3C4TA 2EN6A 1X47A 2V85A 2DRPA 2EOIA 4M9VC 3F6GA 4F54A 2L3JA 4LF8E 4JI4E 4WYQB 2EPAA 4DV6E 2K4VA 4LU9A 4B3ME 1B69A 3VYYA 1SFEA 5AC4A 1PJTA 4DR5E 4DR7E 2EQ1A 4JI0E 2WBSA 4DV1E 4KHPE 2UUBE 2EPXA 2EOXA 2EOQA 3J7Yp 1T4LB 1T4OA 2YU8A 1T38A 2EPNA 1X6EA 2CPNA 4O43A 3HQ1A 5A6JA 4X64E 1EKZA 2E5LE 4LF4E 1N3GA 3RMPA 3IWCA 2VRDA 1T39A 2IHR1 1A1LA 2YTPA 1PJQA 3C4BA 2E1MA 2RPCA 3BIDA 2M7QA 4F9AB 2NUFA 1FJGE 2L33A 2LVHA 2ZM6E 2UU9E 2EPKX 3MHSC 5KL5A 2LRSA 4YHHE 4OX9E 4B3RE 4LFAE 4DR3E 2EPUA 2BBGA 4ZYDA 2GLIA 3HTXA 2EPOA 1PKPA 2V8QB 3JTZA 4I8OA 2CSHA 3ADIA 3JAMC 3T1HE 5A2QC 2RQLA 2EOEA 2NUEA 2DSYA 2YPNA 4M30A 4DV2E 2ODRC 4LF5E 1N33E 2MKDA 2RTXA 2LUPB 1TF6A 4HEIA 2LV2A 2I13A 2EMBA 3QG5C 2EOOA 1BB8A 4F6NA 3DF6A 2L2MA 2CT1A 2EPMX 2V86A 4Q35B 2WBUA 5F3WA 1RMDA 2MC5A 4JI3E 2EN1A 4L8NA 2B9DA 2EPCA 3JU0A 2HGHA 2FV4B 3M99B 4RHBB 4WFTA 2L2NA 1HNXE 2EM2A 5BR8E 2LJUA 1G2FC 2K7IA 1F2IG 3VYXA 1WHNA 2EOZA 2M9AA 2YTJA 4GKJE 4DV4E 2E72A 1ZAAC 2LTSA 5A6BA 4YY3E 2LTRA 2KOUA 3TQMA 2EPLX 4WX9A 4LF9E 2RS6A 5CFFE 4R2AA 3EPLA 5A6KA 3MSWA 1MEYC 2EMWA 1BBOA 2EWLA 3ADJA 2EM6A 2EMXA 2H36X 3J7AG 2MDGA 3L00A 1A1KA 1HNWE 2EN4A 2EM0A 4R2QA 2VQFE 4JI5E 1I94E 2EP3A 4F6MA 1HR0E 5KL3A 1XNQE 2DLKA 1MGTA 2GHFA 2HHHE 2A25A 4X9JA 4M0VA 1TF3A 1A1HA 5LMNE 5TSEA 1ZU1A 5AC5A 2WBTA 3EPHA 1KYQA 1X3CA 4ZYGA 2ADRA 4X65E 2LT7A 1YFHA 3UK3C 2CTDA 2N3GA 1X48A 1A1FA 2EOFA 2V87A 2LUQA 3AV0A 2EMHA 2VQEE 2L2KB 2I9IA 2R1FA 1WXRA 4BCAA 5LMUE 1BBGA 2RSMA 2DIXA 2RS7A 4R03A 3OTOE 1J26A 4DR1E 2L3CA 1FKAE 2UUCE 4O5GA 2KONA 2DLQA 3VHTB 4DUZE 3EQ1A 2DMYA 5AE2A 2ENAA 1WJPA 2NA2A 1WHQA 1UILA 5IXMB 3MHHC 4N4RB 4AQYE 2VF1A 5KL4A 4JYAE 1L4SA 2F8BA 2B7VA 2ELYA 2MKNA 4KZSA 2EL6A 1X5WA 1YSAC 5AASA 2JY9A 2ENHA 1GTKA 1JK1A 1QU6A 4JI7E 2HJJA 2RSIA 1AAYA 3T1YE 2DMIA 5LLQA 2F4VE 4JI8E 2JOXA 4NXNE 4WSGA 1QNTA 1ZBTA 2M4IA 2YTNA 1IQOA 1STUA 1T4NA 2MC6A 4HTGA 2EMZA 2JPAA 1O0WA 1EH8A 2B7TA 2G7HA 4IJDA 5ADZA 1YPNA 1ZR9A 1GZ6A 4NZVA 1YUIA 3LMLA 2EN2A 2EL5A 3BF2A 1IBME 2YRMA 1YZ9A 2R76A 4R2SA 4K0KE 3K6QA 4LTYA 4RH8A 1Z1BA 2YU5A 3KZZA 1P47A 2EN7A 1G2DC 3LLHA 4DR2E 2WZOA 4Q28A 3DJWA 2EM4A 2MDRA 2LBSB 3J80C 2LE2A 2ENCA 4DUYE 2YTQA 4GKKE 2YTGA 5IWAE 3KWRA 2N3HA 3F6HA 2JP9A 2EMKA 4ZYHA 4F9BB 4JI1E 2YT4A 1PDAA 5IV8B 5KL6A 1A1IA 4DKKA 4TUIA 4R2CA 2UXCE 2EOSA 5DNYA 2EOYA 1SR9A 2D9HA 2KHXA 2WCC3 4DV0E 2FTXB 3KZYA 2EPZA 2ELZA 4LFCE 1EH7A 4DV3E 2EPPA 5AE3A 1X6FA 3BBGA 2JOBA 2EN8A 3C6KA 4WSPA 3HXLA 4NHRA 2V89A 4BMJA 5LL6R 2L8TA 2EZ6A 2NUGA 1A1JA 1N34E 4P7DA 2L92A 2M1SA 2YTFA 4O4KA 3AUZA 4OOGC 3EPKA 4B3TE 4LFBE 4JV5E 2EMLA 4DV7E 1XMQE 2DB2A 2EM3A 4DR4E 2YTEA 3THNA 4FK5C 3EPJA 1DGCA 1DQ3A 4X66E 1DI2A 2EL4A 4R8OA 1HNZE 1TN9A 1N32E 2EQ3A 1J5EE 4BHBA 2YTDA 2EORA 3C6MA 4TUGA 4GEQB 2B3TB 5T6JA 2J7JA 4BBYA 1YYKA 4BC7A 1KJKA 1GQEA 4O24A 1N36E 2L6MA 4R2PA 1LLMC 2EPRA 2JR1A 1XNRE 4F9CB 4MLQA 2V88A 4F2JC 3IWBA 2ODRD 2YTOA
chains in the Genus database with same CATH topology
4IJDA 2EOMA 2EPAA 2EMIA 4R2AA 3EPLA 2LCEA 1ZR9A 1YUIA 2YRKA 1B69A 2EN2A 1MEYC 2EL5A 2EMWA 1YUJA 1NCSA 2YRMA 1BBOA 4R2SA 1JK2A 2YSOA 2EQ1A 2EM6A 1UN6B 2WBSA 2EMXA 2MDGA 1A1KA 2EPXA 2EOXA 1Z1BA 2YU5A 2EN4A 1P47A 2EM0A 2EOQA 2EN7A 4R2QA 1G2DC 2BB8A 2YSPA 2EP3A 4F6MA 2YU8A 5KL2A 5KL3A 4R2RA 2EM4A 2PRTA 2ENCA 2DLKA 1X6EA 2GHFA 2A25A 2YTQA 2EM9A 2EMAA 2EMGA 2VRDA 4X9JA 2YTGA 1TF3A 1UBDC 1A1HA 1A1LA 5KL7A 1ZU1A 2WBTA 3EPHA 2EM5A 2YTPA 2JP9A 1X3CA 2EMKA 2ADRA 2RPCA 2EMCA 2LT7A 3UK3C 2LVHA 2CTDA 5KL6A 1A1FA 1A1IA 3MHSC 4R2CA 2EOSA 2EOFA 5KL5A 2EOYA 2D9HA 2EJ4A 2YTIA 2WCC3 2EMHA 2EPZA 2LO3A 2EOJA 2ELZA 2R1FA 2EPUA 2GLIA 2EMFA 2EPPA 2EQ0A 1X6FA 2EN8A 2CSHA 4IS1C 2DLQA 3VHTB 2EOEA 1A1JA 1A1GA 1X6HA 3EPKA 2YTFA 2YRHA 4R2EA 2EOHA 2ENAA 1WJPA 2EMLA 2MKDA 2EM3A 1TF6A 2YTEA 4FK5C 3MHHC 2EN3A 2LV2A 2EMYA 2EMBA 2I13A 5KL4A 2EOOA 3EPJA 1BB8A 4F6NA 1DGCA 2CT1A 2ELYA 2WBUA 2MKNA 1RMDA 2EL6A 2EN1A 4GZNC 2EL4A 1X5WA 2DGCA 1TN9A 2EPCA 2EE8A 2NABA 1YSAC 2ENHA 2HGHA 4R2DA 2EQ3A 1JK1A 2YTDA 3M99B 2EORA 2RSIA 1AAYA 2EM8A 2EM7A 2EM2A 2DMIA 2J7JA 1G2FC 2EN6A 1KJKA 1F2IG 4R2PA 2DRPA 2EOIA 4WSGA 1LLMC 4M9VC 2EPRA 2EOZA 2YTNA 2M9AA 2YTJA 2E72A 2EMZA 4F2JC 2JPAA 1ZAAC 2YTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  2EOM A;  2EPA A;  2EMI A;  4R2A A;  3EPL A;  2LCE A;  1ZR9 A;  1YUI A;  2YRK A;  1B69 A;  2EN2 A;  1MEY C;  2EL5 A;  2EMW A;  1YUJ A;  1NCS A;  2YRM A;  1BBO A;  4R2S A;  1JK2 A;  2YSO A;  2EQ1 A;  2EM6 A;  1UN6 B;  2WBS A;  2EMX A;  2MDG A;  1A1K A;  2EPX A;  2EOX A;  1Z1B A;  2YU5 A;  2EN4 A;  1P47 A;  2EM0 A;  2EOQ A;  2EN7 A;  4R2Q A;  1G2D C;  2BB8 A;  2YSP A;  2EP3 A;  4F6M A;  2YU8 A;  5KL2 A;  5KL3 A;  4R2R A;  2EM4 A;  2PRT A;  2ENC A;  2DLK A;  1X6E A;  2GHF A;  2A25 A;  2YTQ A;  2EM9 A;  2EMA A;  2EMG A;  2VRD A;  4X9J A;  2YTG A;  1TF3 A;  1UBD C;  1A1H A;  1A1L A;  5KL7 A;  1ZU1 A;  2WBT A;  3EPH A;  2EM5 A;  2YTP A;  2JP9 A;  1X3C A;  2EMK A;  2ADR A;  2RPC A;  2EMC A;  2LT7 A;  3UK3 C;  2LVH A;  2CTD A;  5KL6 A;  1A1F A;  1A1I A;  3MHS C;  4R2C A;  2EOS A;  2EOF A;  5KL5 A;  2EOY A;  2D9H A;  2EJ4 A;  2YTI A;  2WCC 3;  2EMH A;  2EPZ A;  2LO3 A;  2EOJ A;  2ELZ A;  2R1F A;  2EPU A;  2GLI A;  2EMF A;  2EPP A;  2EQ0 A;  1X6F A;  2EN8 A;  2CSH A;  4IS1 C;  2DLQ A;  3VHT B;  2EOE A;  1A1J A;  1A1G A;  1X6H A;  3EPK A;  2YTF A;  2YRH A;  4R2E A;  2EOH A;  2ENA A;  1WJP A;  2EML A;  2MKD A;  2EM3 A;  1TF6 A;  2YTE A;  4FK5 C;  3MHH C;  2EN3 A;  2LV2 A;  2EMY A;  2EMB A;  2I13 A;  5KL4 A;  2EOO A;  3EPJ A;  1BB8 A;  4F6N A;  1DGC A;  2CT1 A;  2ELY A;  2WBU A;  2MKN A;  1RMD A;  2EL6 A;  2EN1 A;  4GZN C;  2EL4 A;  1X5W A;  2DGC A;  1TN9 A;  2EPC A;  2EE8 A;  2NAB A;  1YSA C;  2ENH A;  2HGH A;  4R2D A;  2EQ3 A;  1JK1 A;  2YTD A;  3M99 B;  2EOR A;  2RSI A;  1AAY A;  2EM8 A;  2EM7 A;  2EM2 A;  2DMI A;  2J7J A;  1G2F C;  2EN6 A;  1KJK A;  1F2I G;  4R2P A;  2DRP A;  2EOI A;  4WSG A;  1LLM C;  4M9V C;  2EPR A;  2EOZ A;  2YTN A;  2M9A A;  2YTJ A;  2E72 A;  2EMZ A;  4F2J C;  2JPA A;  1ZAA C;  2YTO A; 
#chains in the Genus database with same CATH topology
 2EOM A;  3BGH A;  1IMU A;  2EMI A;  2LCE A;  1UHZ A;  4L5N C;  2YRK A;  1YUJ A;  1NCS A;  5A6B D;  1JK2 A;  2YSO A;  4DMI A;  1UN6 B;  5A6A A;  5FLX C;  2HC5 A;  2BB8 A;  2YSP A;  1WRJ A;  5KL2 A;  4R2R A;  1EH6 A;  2PRT A;  3HPS A;  2LMZ A;  2EM9 A;  2EMA A;  2EMG A;  3FIG A;  1UBD C;  5KL7 A;  3THO B;  2UXD E;  2EM5 A;  2N8X A;  2VE7 C;  2GPI A;  2Q8U A;  2EMC A;  2LJH A;  4JI2 E;  4LF6 E;  4LF7 E;  3ECR A;  2V83 A;  4X8W A;  2EJ4 A;  2YTI A;  5IT9 C;  5A69 A;  2JYA A;  2LO3 A;  1IBK E;  2UXB E;  1IQS A;  2EOJ A;  3HPZ A;  3VK6 A;  4WXC A;  1RC7 A;  4NXM E;  3P1X A;  1NEI A;  2EMF A;  4B3S E;  2EQ0 A;  1XMO E;  4WPY A;  3OML A;  4BHC A;  4IS1 C;  2YZT A;  3ADL A;  2YWQ A;  1ZBQ A;  4MLV A;  4X62 E;  3J81 C;  1X6H A;  2JVA A;  1A1G A;  2YRH A;  4R2E A;  1PJS A;  2EOH A;  2UUA E;  5AE1 A;  4JI6 E;  3ADG A;  2EN3 A;  4KWY A;  1RQ0 A;  2EMY A;  4ZYE A;  4P78 A;  4J8Z A;  1IBL E;  4WXD A;  1AH5 A;  4BS9 A;  3H09 A;  4GZN C;  1YYO A;  4DR6 E;  4DV5 E;  1YYW A;  4BC9 A;  2DGC A;  2NAB A;  2EE8 A;  1X49 A;  2JXP A;  4M2Z A;  4R2D A;  3IWD A;  3ZOQ B;  2FGG A;  2JWO A;  2EM8 A;  2EM7 A;  3C4T A;  2EN6 A;  1X47 A;  2V85 A;  2DRP A;  2EOI A;  4M9V C;  3F6G A;  4F54 A;  2L3J A;  4LF8 E;  4JI4 E;  4WYQ B;  2EPA A;  4DV6 E;  2K4V A;  4LU9 A;  4B3M E;  1B69 A;  3VYY A;  1SFE A;  5AC4 A;  1PJT A;  4DR5 E;  4DR7 E;  2EQ1 A;  4JI0 E;  2WBS A;  4DV1 E;  4KHP E;  2UUB E;  2EPX A;  2EOX A;  2EOQ A;  3J7Y p;  1T4L B;  1T4O A;  2YU8 A;  1T38 A;  2EPN A;  1X6E A;  2CPN A;  4O43 A;  3HQ1 A;  5A6J A;  4X64 E;  1EKZ A;  2E5L E;  4LF4 E;  1N3G A;  3RMP A;  3IWC A;  2VRD A;  1T39 A;  2IHR 1;  1A1L A;  2YTP A;  1PJQ A;  3C4B A;  2E1M A;  2RPC A;  3BID A;  2M7Q A;  4F9A B;  2NUF A;  1FJG E;  2L33 A;  2LVH A;  2ZM6 E;  2UU9 E;  2EPK X;  3MHS C;  5KL5 A;  2LRS A;  4YHH E;  4OX9 E;  4B3R E;  4LFA E;  4DR3 E;  2EPU A;  2BBG A;  4ZYD A;  2GLI A;  3HTX A;  2EPO A;  1PKP A;  2V8Q B;  3JTZ A;  4I8O A;  2CSH A;  3ADI A;  3JAM C;  3T1H E;  5A2Q C;  2RQL A;  2EOE A;  2NUE A;  2DSY A;  2YPN A;  4M30 A;  4DV2 E;  2ODR C;  4LF5 E;  1N33 E;  2MKD A;  2RTX A;  2LUP B;  1TF6 A;  4HEI A;  2LV2 A;  2I13 A;  2EMB A;  3QG5 C;  2EOO A;  1BB8 A;  4F6N A;  3DF6 A;  2L2M A;  2CT1 A;  2EPM X;  2V86 A;  4Q35 B;  2WBU A;  5F3W A;  1RMD A;  2MC5 A;  4JI3 E;  2EN1 A;  4L8N A;  2B9D A;  2EPC A;  3JU0 A;  2HGH A;  2FV4 B;  3M99 B;  4RHB B;  4WFT A;  2L2N A;  1HNX E;  2EM2 A;  5BR8 E;  2LJU A;  1G2F C;  2K7I A;  1F2I G;  3VYX A;  1WHN A;  2EOZ A;  2M9A A;  2YTJ A;  4GKJ E;  4DV4 E;  2E72 A;  1ZAA C;  2LTS A;  5A6B A;  4YY3 E;  2LTR A;  2KOU A;  3TQM A;  2EPL X;  4WX9 A;  4LF9 E;  2RS6 A;  5CFF E;  4R2A A;  3EPL A;  5A6K A;  3MSW A;  1MEY C;  2EMW A;  1BBO A;  2EWL A;  3ADJ A;  2EM6 A;  2EMX A;  2H36 X;  3J7A G;  2MDG A;  3L00 A;  1A1K A;  1HNW E;  2EN4 A;  2EM0 A;  4R2Q A;  2VQF E;  4JI5 E;  1I94 E;  2EP3 A;  4F6M A;  1HR0 E;  5KL3 A;  1XNQ E;  2DLK A;  1MGT A;  2GHF A;  2HHH E;  2A25 A;  4X9J A;  4M0V A;  1TF3 A;  1A1H A;  5LMN E;  5TSE A;  1ZU1 A;  5AC5 A;  2WBT A;  3EPH A;  1KYQ A;  1X3C A;  4ZYG A;  2ADR A;  4X65 E;  2LT7 A;  1YFH A;  3UK3 C;  2CTD A;  2N3G A;  1X48 A;  1A1F A;  2EOF A;  2V87 A;  2LUQ A;  3AV0 A;  2EMH A;  2VQE E;  2L2K B;  2I9I A;  2R1F A;  1WXR A;  4BCA A;  5LMU E;  1BBG A;  2RSM A;  2DIX A;  2RS7 A;  4R03 A;  3OTO E;  1J26 A;  4DR1 E;  2L3C A;  1FKA E;  2UUC E;  4O5G A;  2KON A;  2DLQ A;  3VHT B;  4DUZ E;  3EQ1 A;  2DMY A;  5AE2 A;  2ENA A;  1WJP A;  2NA2 A;  1WHQ A;  1UIL A;  5IXM B;  3MHH C;  4N4R B;  4AQY E;  2VF1 A;  5KL4 A;  4JYA E;  1L4S A;  2F8B A;  2B7V A;  2ELY A;  2MKN A;  4KZS A;  2EL6 A;  1X5W A;  1YSA C;  5AAS A;  2JY9 A;  2ENH A;  1GTK A;  1JK1 A;  1QU6 A;  4JI7 E;  2HJJ A;  2RSI A;  1AAY A;  3T1Y E;  2DMI A;  5LLQ A;  2F4V E;  4JI8 E;  2JOX A;  4NXN E;  4WSG A;  1QNT A;  1ZBT A;  2M4I A;  2YTN A;  1IQO A;  1STU A;  1T4N A;  2MC6 A;  4HTG A;  2EMZ A;  2JPA A;  1O0W A;  1EH8 A;  2B7T A;  2G7H A;  4IJD A;  5ADZ A;  1YPN A;  1ZR9 A;  1GZ6 A;  4NZV A;  1YUI A;  3LML A;  2EN2 A;  2EL5 A;  3BF2 A;  1IBM E;  2YRM A;  1YZ9 A;  2R76 A;  4R2S A;  4K0K E;  3K6Q A;  4LTY A;  4RH8 A;  1Z1B A;  2YU5 A;  3KZZ A;  1P47 A;  2EN7 A;  1G2D C;  3LLH A;  4DR2 E;  2WZO A;  4Q28 A;  3DJW A;  2EM4 A;  2MDR A;  2LBS B;  3J80 C;  2LE2 A;  2ENC A;  4DUY E;  2YTQ A;  4GKK E;  2YTG A;  5IWA E;  3KWR A;  2N3H A;  3F6H A;  2JP9 A;  2EMK A;  4ZYH A;  4F9B B;  4JI1 E;  2YT4 A;  1PDA A;  5IV8 B;  5KL6 A;  1A1I A;  4DKK A;  4TUI A;  4R2C A;  2UXC E;  2EOS A;  5DNY A;  2EOY A;  1SR9 A;  2D9H A;  2KHX A;  2WCC 3;  4DV0 E;  2FTX B;  3KZY A;  2EPZ A;  2ELZ A;  4LFC E;  1EH7 A;  4DV3 E;  2EPP A;  5AE3 A;  1X6F A;  3BBG A;  2JOB A;  2EN8 A;  3C6K A;  4WSP A;  3HXL A;  4NHR A;  2V89 A;  4BMJ A;  5LL6 R;  2L8T A;  2EZ6 A;  2NUG A;  1A1J A;  1N34 E;  4P7D A;  2L92 A;  2M1S A;  2YTF A;  4O4K A;  3AUZ A;  4OOG C;  3EPK A;  4B3T E;  4LFB E;  4JV5 E;  2EML A;  4DV7 E;  1XMQ E;  2DB2 A;  2EM3 A;  4DR4 E;  2YTE A;  3THN A;  4FK5 C;  3EPJ A;  1DGC A;  1DQ3 A;  4X66 E;  1DI2 A;  2EL4 A;  4R8O A;  1HNZ E;  1TN9 A;  1N32 E;  2EQ3 A;  1J5E E;  4BHB A;  2YTD A;  2EOR A;  3C6M A;  4TUG A;  4GEQ B;  2B3T B;  5T6J A;  2J7J A;  4BBY A;  1YYK A;  4BC7 A;  1KJK A;  1GQE A;  4O24 A;  1N36 E;  2L6M A;  4R2P A;  1LLM C;  2EPR A;  2JR1 A;  1XNR E;  4F9C B;  4MLQ A;  2V88 A;  4F2J C;  3IWB A;  2ODR D;  2YTO A; 
#chains in the Genus database with same CATH homology
 4IJD A;  2EOM A;  2EPA A;  2EMI A;  4R2A A;  3EPL A;  2LCE A;  1ZR9 A;  1YUI A;  2YRK A;  1B69 A;  2EN2 A;  1MEY C;  2EL5 A;  2EMW A;  1YUJ A;  1NCS A;  2YRM A;  1BBO A;  4R2S A;  1JK2 A;  2YSO A;  2EQ1 A;  2EM6 A;  1UN6 B;  2WBS A;  2EMX A;  2MDG A;  1A1K A;  2EPX A;  2EOX A;  1Z1B A;  2YU5 A;  2EN4 A;  1P47 A;  2EM0 A;  2EOQ A;  2EN7 A;  4R2Q A;  1G2D C;  2BB8 A;  2YSP A;  2EP3 A;  4F6M A;  2YU8 A;  5KL2 A;  5KL3 A;  4R2R A;  2EM4 A;  2PRT A;  2ENC A;  2DLK A;  1X6E A;  2GHF A;  2A25 A;  2YTQ A;  2EM9 A;  2EMA A;  2EMG A;  2VRD A;  4X9J A;  2YTG A;  1TF3 A;  1UBD C;  1A1H A;  1A1L A;  5KL7 A;  1ZU1 A;  2WBT A;  3EPH A;  2EM5 A;  2YTP A;  2JP9 A;  1X3C A;  2EMK A;  2ADR A;  2RPC A;  2EMC A;  2LT7 A;  3UK3 C;  2LVH A;  2CTD A;  5KL6 A;  1A1F A;  1A1I A;  3MHS C;  4R2C A;  2EOS A;  2EOF A;  5KL5 A;  2EOY A;  2D9H A;  2EJ4 A;  2YTI A;  2WCC 3;  2EMH A;  2EPZ A;  2LO3 A;  2EOJ A;  2ELZ A;  2R1F A;  2EPU A;  2GLI A;  2EMF A;  2EPP A;  2EQ0 A;  1X6F A;  2EN8 A;  2CSH A;  4IS1 C;  2DLQ A;  3VHT B;  2EOE A;  1A1J A;  1A1G A;  1X6H A;  3EPK A;  2YTF A;  2YRH A;  4R2E A;  2EOH A;  2ENA A;  1WJP A;  2EML A;  2MKD A;  2EM3 A;  1TF6 A;  2YTE A;  4FK5 C;  3MHH C;  2EN3 A;  2LV2 A;  2EMY A;  2EMB A;  2I13 A;  5KL4 A;  2EOO A;  3EPJ A;  1BB8 A;  4F6N A;  1DGC A;  2CT1 A;  2ELY A;  2WBU A;  2MKN A;  1RMD A;  2EL6 A;  2EN1 A;  4GZN C;  2EL4 A;  1X5W A;  2DGC A;  1TN9 A;  2EPC A;  2EE8 A;  2NAB A;  1YSA C;  2ENH A;  2HGH A;  4R2D A;  2EQ3 A;  1JK1 A;  2YTD A;  3M99 B;  2EOR A;  2RSI A;  1AAY A;  2EM8 A;  2EM7 A;  2EM2 A;  2DMI A;  2J7J A;  1G2F C;  2EN6 A;  1KJK A;  1F2I G;  4R2P A;  2DRP A;  2EOI A;  4WSG A;  1LLM C;  4M9V C;  2EPR A;  2EOZ A;  2YTN A;  2M9A A;  2YTJ A;  2E72 A;  2EMZ A;  4F2J C;  2JPA A;  1ZAA C;  2YTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...