2ENAA

Solution structure of the c2h2 type zinc finger (region 311-343) of human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 311-343) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2enaA00
1G2FC 2EM9A 2YTNA 2WBUA 5KL7A 2E72A 2LT7A 2VRDA 2ELZA 2YU5A 2JP9A 2YTEA 2ENAA 1G2DC 2CSHA 2EOHA 2LVHA 4F6MA 2EN7A 1RMDA 4IJDA 2GHFA 4R2RA 2GLIA 3EPKA 2YTOA 1A1KA 2EMYA 2YSOA 2EOIA 2EMXA 2EM8A 2YTFA 2WBSA 2EM5A 5KL4A 2EMIA 2EOZA 2EOOA 2RSIA 1TF6A 2YSPA 4FK5C 1BBOA 2BB8A 4R2CA 2CTDA 3M99B 5KL3A 1UBDC 2EOJA 2YTPA 2EE8A 2EMZA 2EPZA 1P47A 2LO3A 1YUJA 2EN1A 2MKDA 2NABA 2EOEA 2EN4A 2WCC3 2PRTA 2EJ4A 2DRPA 4M9VC 1AAYA 2RPCA 4R2SA 2YTJA 2CT1A 2DMIA 1UN6B 2EPXA 1TN9A 1TF3A 2ADRA 1WJPA 1MEYC 2YTIA 2EPCA 2EM3A 2ENHA 1X6EA 4F6NA 2HGHA 2EMHA 4GZNC 2EMLA 2EOQA 2EPPA 1X6HA 5KL2A 2EN8A 3MHHC 1A1HA 2EMAA 2EPUA 3UK3C 2YRHA 1ZAAC 1KJKA 2ENCA 2EMFA 1LLMC 2YTDA 2EQ3A 4R2AA 2EOYA 2EM6A 2EQ1A 2A25A 2EM2A 1YSAC 2M9AA 2EM0A 2WBTA 2DLKA 3MHSC 4F2JC 2DLQA 4R2PA 2EM4A 2YU8A 1X3CA 2YRMA 1Z1BA 2EPAA 1B69A 4R2QA 1F2IG 2EL6A 2J7JA 4R2DA 2R1FA 2EOSA 2YRKA 1A1GA 1BB8A 1ZR9A 5KL6A 2EM7A 1A1JA 2EN2A 2EOXA 2ELYA 1JK2A 2EMKA 2EORA 1A1FA 2EMWA 3EPHA 5KL5A 2YTQA 1NCSA 1JK1A 1ZU1A 1X6FA 2EMCA 2EMGA 2LCEA 2MDGA 4WSGA 1X5WA 2EP3A 2EN3A 2YTGA 4X9JA 1A1LA 4IS1C 2MKNA 3EPJA 1A1IA 4R2EA 2EOFA 2I13A 2D9HA 2EL4A 2DGCA 2EOMA 3VHTB 2EPRA 2LV2A 2JPAA 2EL5A 2EN6A 2EMBA 1DGCA 3EPLA 2EQ0A 1YUIA
chains in the Genus database with same CATH superfamily
3F6GA 4O4KA 5AASA 1IQSA 4WYQB 2FTXB 3HPSA 2K7IA 2BBGA 2YU5A 2L2MA 5AC4A 4R8OA 1T4LB 2UXDE 4DV4E 2LVHA 2EPOA 1RMDA 4R2RA 3VYYA 3EPKA 1EKZA 2EMYA 2WBSA 3AV0A 5LLQA 2EMIA 1XNRE 2EOZA 4B3ME 4M2ZA 4R2CA 1AH5A 1YYKA 3M99B 4JI5E 4DKKA 2EMZA 1P47A 4GEQB 3THNA 2EN1A 2UXBE 3ADIA 2N8XA 4M9VC 4ZYGA 1ZBQA 3HPZA 2YTJA 3P1XA 2B9DA 1TN9A 2B3TB 4BMJA 3BF2A 1MEYC 2EPCA 2L2KB 2EM3A 3HXLA 1X6EA 2HGHA 4NHRA 4DR7E 2EPKX 3JAMC 4ZYDA 4DR3E 3J80C 3UK3C 3EQ1A 4X65E 2KONA 5CFFE 4TUIA 4I8OA 4LF5E 1QU6A 2EQ3A 2EQ1A 3OMLA 5F3WA 1FJGE 4WPYA 2WBTA 4B3TE 2DLKA 5AE1A 4BC7A 2FGGA 2YZTA 2LMZA 2YU8A 2YRMA 1B69A 4KWYA 5A6KA 2R1FA 4BHBA 2YRKA 2MC6A 4NXNE 2EPMX 2N3HA 1GTKA 1JK2A 2EMWA 5LL6R 2YTQA 1PDAA 4DV0E 2NA2A 4F54A 1ZBTA 2LCEA 2HJJA 4DV2E 2L33A 4LF6E 4WSGA 2UUBE 2FV4B 2RS7A 2EN3A 2N3GA 1BBGA 2YTGA 3KZYA 2MKNA 2Q8UA 3VHTB 1UHZA 2LBSB 2EPRA 2JPAA 1WRJA 5DNYA 5TSEA 1YYOA 1X47A 2EWLA 2JWOA 1G2FC 2DSYA 2YTNA 4O5GA 2JXPA 2VRDA 4BHCA 5A2QC 5A6BD 4LF4E 2M1SA 4GKKE 2L92A 2L8TA 1KYQA 4IJDA 3J7AG 2LRSA 4L8NA 2E5LE 1A1KA 1GQEA 2EMXA 3VK6A 3H09A 5KL4A 4B3RE 1EH6A 2BB8A 1UBDC 2EE8A 4WFTA 1PJQA 2NABA 4JI3E 2EOEA 2EN4A 2EJ4A 2R76A 2DRPA 2V87A 2DMIA 4B3SE 1WJPA 2YTIA 5AC5A 4JYAE 4JI0E 2HC5A 5A69A 4JI1E 2LJUA 4GZNC 2EMLA 1X6HA 2EN8A 3MHHC 3ECRA 3QG5C 3IWDA 4WX9A 1KJKA 2EMFA 1LLMC 2YTDA 2MDRA 4DR6E 4P78A 1PKPA 3TQMA 2EOYA 4R2AA 1DI2A 2A25A 4JI7E 5BR8E 2EM0A 2RTXA 4F2JC 2B7VA 2DLQA 4R2PA 4OOGC 1PJSA 4DMIA 2EM4A 1Z1BA 1IBME 4R2QA 1F2IG 4M30A 2J7JA 4R2DA 2JY9A 2EPLX 1A1GA 5A6JA 1ZR9A 1EH8A 2RS6A 5KL6A 2EM7A 4DR1E 1HNXE 3C4TA 2EMKA 4LF8E 4LFCE 1X49A 2EPNA 3EPHA 1NCSA 1WHNA 2VQEE 1ZU1A 2EMCA 4R03A 2DIXA 1X5WA 2EP3A 5LMNE 3DJWA 4MLQA 3BBGA 4IS1C 2DMYA 2GPIA 3EPJA 1A1IA 2RSMA 4R2EA 5AE3A 1UILA 3AUZA 4BBYA 2D9HA 2EL4A 4F9BB 2EOMA 4YY3E 4DUZE 4NXME 4DR5E 2EL5A 2WZOA 2F8BA 1NEIA 1YUIA 3BIDA 3ADJA 1N34E 3THOB 2JVAA 2M7QA 4HTGA 2JP9A 2YTEA 2ENAA 5ADZA 2CSHA 4P7DA 2EOHA 4F6MA 4Q28A 1IQOA 2GHFA 2V86A 3MSWA 2YSOA 4Q35B 2EM8A 2EM5A 4LU9A 4N4RB 1FKAE 1X48A 2EOOA 2RSIA 1TF6A 2CPNA 4JI6E 1L4SA 2E1MA 2CTDA 5KL3A 2EOJA 2YTPA 1STUA 2EPZA 1YUJA 2KOUA 2LO3A 4DR2E 2V85A 1I94E 3ADLA 2MKDA 2PRTA 2WCC3 2H36X 1AAYA 3IWCA 3BGHA 2LTSA 2CT1A 1J26A 3T1YE 4O24A 2EPXA 5A6AA 4DR4E 1TF3A 4LF7E 2NUFA 3KZZA 2ENHA 2ODRD 4F6NA 4DV5E 2EMHA 1IBKE 1QNTA 4DV3E 2VQFE 1RC7A 4JI2E 5KL2A 1A1HA 2EMAA 4HEIA 3DF6A 2YRHA 4GKJE 4LFBE 1WHQA 2ENCA 4RHBB 4YHHE 4LTYA 3ZOQB 1XMQE 2EM6A 2EM2A 4X66E 2M9AA 4NZVA 2V83A 2VE7C 3MHSC 1YYWA 3C6KA 3K6QA 1X3CA 2HHHE 2EPAA 1RQ0A 4DV1E 2KHXA 1XMOE 4TUGA 2IHR1 2JOBA 5IXMB 2EOSA 2L2NA 1DQ3A 1T39A 1A1JA 1J5EE 1YFHA 2UUCE 1GZ6A 2ELYA 1A1FA 2EORA 4X62E 5KL5A 5IV8B 1JK1A 2LUQA 3JU0A 2I9IA 2YWQA 2VF1A 3JTZA 3L00A 3OTOE 2LUPB 2JOXA 4X9JA 1A1LA 1EH7A 2NUGA 4LFAE 2EOFA 4JV5E 2G7HA 1N33E 2DGCA 1HR0E 2EN6A 2EMBA 2M4IA 4LF9E 2EM9A 5A6BA 2RQLA 3LMLA 2WBUA 5KL7A 2E72A 1N32E 4KZSA 2LT7A 2ELZA 1HNZE 2UXCE 2MC5A 1G2DC 2EN7A 4JI8E 2GLIA 2YTOA 2EOIA 2JYAA 2YTFA 4K0KE 1YZ9A 1N36E 1T4OA 1O0WA 2YSPA 4FK5C 1BBOA 2L3CA 2LJHA 2ODRC 5FLXC 3HQ1A 4BS9A 1N3GA 5AE2A 2RPCA 5T6JA 5IT9C 1SFEA 1YPNA 4R2SA 2YPNA 3IWBA 1UN6B 2V88A 3HTXA 4M0VA 2ADRA 4JI4E 2LTRA 2K4VA 2LE2A 4J8ZA 4F9CB 5IWAE 3VYXA 2DB2A 4AQYE 2EOQA 2EPPA 4WSPA 2ZM6E 4MLVA 3F6HA 2EPUA 1ZAAC 3RMPA 4X64E 2EZ6A 2V8QB 4OX9E 2F4VE 4DV6E 1YSAC 1SR9A 4KHPE 4RH8A 2YT4A 3J81C 4DV7E 2L3JA 4X8WA 4ZYHA 4ZYEA 4WXDA 1IBLE 2EL6A 1T4NA 1T38A 1DGCA 2L6MA 2UU9E 2UUAE 1BB8A 1MGTA 2EN2A 1HNWE 2EOXA 4BCAA 4O43A 2V89A 4WXCA 3J7Yp 1WXRA 2EMGA 1X6FA 2MDGA 1XNQE 2NUEA 3C4BA 3LLHA 3T1HE 2JR1A 4F9AB 3C6MA 4L5NC 3FIGA 1IMUA 3ADGA 1PJTA 4DUYE 2I13A 2LV2A 4BC9A 3KWRA 2B7TA 5LMUE 3EPLA 2EQ0A
chains in the Genus database with same CATH topology
1G2FC 2EM9A 2YTNA 2WBUA 5KL7A 2E72A 2LT7A 2VRDA 2ELZA 2YU5A 2JP9A 2YTEA 2ENAA 1G2DC 2CSHA 2EOHA 2LVHA 4F6MA 2EN7A 1RMDA 4IJDA 2GHFA 4R2RA 2GLIA 3EPKA 2YTOA 1A1KA 2EMYA 2YSOA 2EOIA 2EMXA 2EM8A 2YTFA 2WBSA 2EM5A 5KL4A 2EMIA 2EOZA 2EOOA 2RSIA 1TF6A 2YSPA 4FK5C 1BBOA 2BB8A 4R2CA 2CTDA 3M99B 5KL3A 1UBDC 2EOJA 2YTPA 2EE8A 2EMZA 2EPZA 1P47A 2LO3A 1YUJA 2EN1A 2MKDA 2NABA 2EOEA 2EN4A 2WCC3 2PRTA 2EJ4A 2DRPA 4M9VC 1AAYA 2RPCA 4R2SA 2YTJA 2CT1A 2DMIA 1UN6B 2EPXA 1TN9A 1TF3A 2ADRA 1WJPA 1MEYC 2YTIA 2EPCA 2EM3A 2ENHA 1X6EA 4F6NA 2HGHA 2EMHA 4GZNC 2EMLA 2EOQA 2EPPA 1X6HA 5KL2A 2EN8A 3MHHC 1A1HA 2EMAA 2EPUA 3UK3C 2YRHA 1ZAAC 1KJKA 2ENCA 2EMFA 1LLMC 2YTDA 2EQ3A 4R2AA 2EOYA 2EM6A 2EQ1A 2A25A 2EM2A 1YSAC 2M9AA 2EM0A 2WBTA 2DLKA 3MHSC 4F2JC 2DLQA 4R2PA 2EM4A 2YU8A 1X3CA 2YRMA 1Z1BA 2EPAA 1B69A 4R2QA 1F2IG 2EL6A 2J7JA 4R2DA 2R1FA 2EOSA 2YRKA 1A1GA 1BB8A 1ZR9A 5KL6A 2EM7A 1A1JA 2EN2A 2EOXA 2ELYA 1JK2A 2EMKA 2EORA 1A1FA 2EMWA 3EPHA 5KL5A 2YTQA 1NCSA 1JK1A 1ZU1A 1X6FA 2EMCA 2EMGA 2LCEA 2MDGA 4WSGA 1X5WA 2EP3A 2EN3A 2YTGA 4X9JA 1A1LA 4IS1C 2MKNA 3EPJA 1A1IA 4R2EA 2EOFA 2I13A 2D9HA 2EL4A 2DGCA 2EOMA 3VHTB 2EPRA 2LV2A 2JPAA 2EL5A 2EN6A 2EMBA 1DGCA 3EPLA 2EQ0A 1YUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2F C;  2EM9 A;  2YTN A;  2WBU A;  5KL7 A;  2E72 A;  2LT7 A;  2VRD A;  2ELZ A;  2YU5 A;  2JP9 A;  2YTE A;  2ENA A;  1G2D C;  2CSH A;  2EOH A;  2LVH A;  4F6M A;  2EN7 A;  1RMD A;  4IJD A;  2GHF A;  4R2R A;  2GLI A;  3EPK A;  2YTO A;  1A1K A;  2EMY A;  2YSO A;  2EOI A;  2EMX A;  2EM8 A;  2YTF A;  2WBS A;  2EM5 A;  5KL4 A;  2EMI A;  2EOZ A;  2EOO A;  2RSI A;  1TF6 A;  2YSP A;  4FK5 C;  1BBO A;  2BB8 A;  4R2C A;  2CTD A;  3M99 B;  5KL3 A;  1UBD C;  2EOJ A;  2YTP A;  2EE8 A;  2EMZ A;  2EPZ A;  1P47 A;  2LO3 A;  1YUJ A;  2EN1 A;  2MKD A;  2NAB A;  2EOE A;  2EN4 A;  2WCC 3;  2PRT A;  2EJ4 A;  2DRP A;  4M9V C;  1AAY A;  2RPC A;  4R2S A;  2YTJ A;  2CT1 A;  2DMI A;  1UN6 B;  2EPX A;  1TN9 A;  1TF3 A;  2ADR A;  1WJP A;  1MEY C;  2YTI A;  2EPC A;  2EM3 A;  2ENH A;  1X6E A;  4F6N A;  2HGH A;  2EMH A;  4GZN C;  2EML A;  2EOQ A;  2EPP A;  1X6H A;  5KL2 A;  2EN8 A;  3MHH C;  1A1H A;  2EMA A;  2EPU A;  3UK3 C;  2YRH A;  1ZAA C;  1KJK A;  2ENC A;  2EMF A;  1LLM C;  2YTD A;  2EQ3 A;  4R2A A;  2EOY A;  2EM6 A;  2EQ1 A;  2A25 A;  2EM2 A;  1YSA C;  2M9A A;  2EM0 A;  2WBT A;  2DLK A;  3MHS C;  4F2J C;  2DLQ A;  4R2P A;  2EM4 A;  2YU8 A;  1X3C A;  2YRM A;  1Z1B A;  2EPA A;  1B69 A;  4R2Q A;  1F2I G;  2EL6 A;  2J7J A;  4R2D A;  2R1F A;  2EOS A;  2YRK A;  1A1G A;  1BB8 A;  1ZR9 A;  5KL6 A;  2EM7 A;  1A1J A;  2EN2 A;  2EOX A;  2ELY A;  1JK2 A;  2EMK A;  2EOR A;  1A1F A;  2EMW A;  3EPH A;  5KL5 A;  2YTQ A;  1NCS A;  1JK1 A;  1ZU1 A;  1X6F A;  2EMC A;  2EMG A;  2LCE A;  2MDG A;  4WSG A;  1X5W A;  2EP3 A;  2EN3 A;  2YTG A;  4X9J A;  1A1L A;  4IS1 C;  2MKN A;  3EPJ A;  1A1I A;  4R2E A;  2EOF A;  2I13 A;  2D9H A;  2EL4 A;  2DGC A;  2EOM A;  3VHT B;  2EPR A;  2LV2 A;  2JPA A;  2EL5 A;  2EN6 A;  2EMB A;  1DGC A;  3EPL A;  2EQ0 A;  1YUI A; 
#chains in the Genus database with same CATH topology
 3F6G A;  4O4K A;  5AAS A;  1IQS A;  4WYQ B;  2FTX B;  3HPS A;  2K7I A;  2BBG A;  2YU5 A;  2L2M A;  5AC4 A;  4R8O A;  1T4L B;  2UXD E;  4DV4 E;  2LVH A;  2EPO A;  1RMD A;  4R2R A;  3VYY A;  3EPK A;  1EKZ A;  2EMY A;  2WBS A;  3AV0 A;  5LLQ A;  2EMI A;  1XNR E;  2EOZ A;  4B3M E;  4M2Z A;  4R2C A;  1AH5 A;  1YYK A;  3M99 B;  4JI5 E;  4DKK A;  2EMZ A;  1P47 A;  4GEQ B;  3THN A;  2EN1 A;  2UXB E;  3ADI A;  2N8X A;  4M9V C;  4ZYG A;  1ZBQ A;  3HPZ A;  2YTJ A;  3P1X A;  2B9D A;  1TN9 A;  2B3T B;  4BMJ A;  3BF2 A;  1MEY C;  2EPC A;  2L2K B;  2EM3 A;  3HXL A;  1X6E A;  2HGH A;  4NHR A;  4DR7 E;  2EPK X;  3JAM C;  4ZYD A;  4DR3 E;  3J80 C;  3UK3 C;  3EQ1 A;  4X65 E;  2KON A;  5CFF E;  4TUI A;  4I8O A;  4LF5 E;  1QU6 A;  2EQ3 A;  2EQ1 A;  3OML A;  5F3W A;  1FJG E;  4WPY A;  2WBT A;  4B3T E;  2DLK A;  5AE1 A;  4BC7 A;  2FGG A;  2YZT A;  2LMZ A;  2YU8 A;  2YRM A;  1B69 A;  4KWY A;  5A6K A;  2R1F A;  4BHB A;  2YRK A;  2MC6 A;  4NXN E;  2EPM X;  2N3H A;  1GTK A;  1JK2 A;  2EMW A;  5LL6 R;  2YTQ A;  1PDA A;  4DV0 E;  2NA2 A;  4F54 A;  1ZBT A;  2LCE A;  2HJJ A;  4DV2 E;  2L33 A;  4LF6 E;  4WSG A;  2UUB E;  2FV4 B;  2RS7 A;  2EN3 A;  2N3G A;  1BBG A;  2YTG A;  3KZY A;  2MKN A;  2Q8U A;  3VHT B;  1UHZ A;  2LBS B;  2EPR A;  2JPA A;  1WRJ A;  5DNY A;  5TSE A;  1YYO A;  1X47 A;  2EWL A;  2JWO A;  1G2F C;  2DSY A;  2YTN A;  4O5G A;  2JXP A;  2VRD A;  4BHC A;  5A2Q C;  5A6B D;  4LF4 E;  2M1S A;  4GKK E;  2L92 A;  2L8T A;  1KYQ A;  4IJD A;  3J7A G;  2LRS A;  4L8N A;  2E5L E;  1A1K A;  1GQE A;  2EMX A;  3VK6 A;  3H09 A;  5KL4 A;  4B3R E;  1EH6 A;  2BB8 A;  1UBD C;  2EE8 A;  4WFT A;  1PJQ A;  2NAB A;  4JI3 E;  2EOE A;  2EN4 A;  2EJ4 A;  2R76 A;  2DRP A;  2V87 A;  2DMI A;  4B3S E;  1WJP A;  2YTI A;  5AC5 A;  4JYA E;  4JI0 E;  2HC5 A;  5A69 A;  4JI1 E;  2LJU A;  4GZN C;  2EML A;  1X6H A;  2EN8 A;  3MHH C;  3ECR A;  3QG5 C;  3IWD A;  4WX9 A;  1KJK A;  2EMF A;  1LLM C;  2YTD A;  2MDR A;  4DR6 E;  4P78 A;  1PKP A;  3TQM A;  2EOY A;  4R2A A;  1DI2 A;  2A25 A;  4JI7 E;  5BR8 E;  2EM0 A;  2RTX A;  4F2J C;  2B7V A;  2DLQ A;  4R2P A;  4OOG C;  1PJS A;  4DMI A;  2EM4 A;  1Z1B A;  1IBM E;  4R2Q A;  1F2I G;  4M30 A;  2J7J A;  4R2D A;  2JY9 A;  2EPL X;  1A1G A;  5A6J A;  1ZR9 A;  1EH8 A;  2RS6 A;  5KL6 A;  2EM7 A;  4DR1 E;  1HNX E;  3C4T A;  2EMK A;  4LF8 E;  4LFC E;  1X49 A;  2EPN A;  3EPH A;  1NCS A;  1WHN A;  2VQE E;  1ZU1 A;  2EMC A;  4R03 A;  2DIX A;  1X5W A;  2EP3 A;  5LMN E;  3DJW A;  4MLQ A;  3BBG A;  4IS1 C;  2DMY A;  2GPI A;  3EPJ A;  1A1I A;  2RSM A;  4R2E A;  5AE3 A;  1UIL A;  3AUZ A;  4BBY A;  2D9H A;  2EL4 A;  4F9B B;  2EOM A;  4YY3 E;  4DUZ E;  4NXM E;  4DR5 E;  2EL5 A;  2WZO A;  2F8B A;  1NEI A;  1YUI A;  3BID A;  3ADJ A;  1N34 E;  3THO B;  2JVA A;  2M7Q A;  4HTG A;  2JP9 A;  2YTE A;  2ENA A;  5ADZ A;  2CSH A;  4P7D A;  2EOH A;  4F6M A;  4Q28 A;  1IQO A;  2GHF A;  2V86 A;  3MSW A;  2YSO A;  4Q35 B;  2EM8 A;  2EM5 A;  4LU9 A;  4N4R B;  1FKA E;  1X48 A;  2EOO A;  2RSI A;  1TF6 A;  2CPN A;  4JI6 E;  1L4S A;  2E1M A;  2CTD A;  5KL3 A;  2EOJ A;  2YTP A;  1STU A;  2EPZ A;  1YUJ A;  2KOU A;  2LO3 A;  4DR2 E;  2V85 A;  1I94 E;  3ADL A;  2MKD A;  2PRT A;  2WCC 3;  2H36 X;  1AAY A;  3IWC A;  3BGH A;  2LTS A;  2CT1 A;  1J26 A;  3T1Y E;  4O24 A;  2EPX A;  5A6A A;  4DR4 E;  1TF3 A;  4LF7 E;  2NUF A;  3KZZ A;  2ENH A;  2ODR D;  4F6N A;  4DV5 E;  2EMH A;  1IBK E;  1QNT A;  4DV3 E;  2VQF E;  1RC7 A;  4JI2 E;  5KL2 A;  1A1H A;  2EMA A;  4HEI A;  3DF6 A;  2YRH A;  4GKJ E;  4LFB E;  1WHQ A;  2ENC A;  4RHB B;  4YHH E;  4LTY A;  3ZOQ B;  1XMQ E;  2EM6 A;  2EM2 A;  4X66 E;  2M9A A;  4NZV A;  2V83 A;  2VE7 C;  3MHS C;  1YYW A;  3C6K A;  3K6Q A;  1X3C A;  2HHH E;  2EPA A;  1RQ0 A;  4DV1 E;  2KHX A;  1XMO E;  4TUG A;  2IHR 1;  2JOB A;  5IXM B;  2EOS A;  2L2N A;  1DQ3 A;  1T39 A;  1A1J A;  1J5E E;  1YFH A;  2UUC E;  1GZ6 A;  2ELY A;  1A1F A;  2EOR A;  4X62 E;  5KL5 A;  5IV8 B;  1JK1 A;  2LUQ A;  3JU0 A;  2I9I A;  2YWQ A;  2VF1 A;  3JTZ A;  3L00 A;  3OTO E;  2LUP B;  2JOX A;  4X9J A;  1A1L A;  1EH7 A;  2NUG A;  4LFA E;  2EOF A;  4JV5 E;  2G7H A;  1N33 E;  2DGC A;  1HR0 E;  2EN6 A;  2EMB A;  2M4I A;  4LF9 E;  2EM9 A;  5A6B A;  2RQL A;  3LML A;  2WBU A;  5KL7 A;  2E72 A;  1N32 E;  4KZS A;  2LT7 A;  2ELZ A;  1HNZ E;  2UXC E;  2MC5 A;  1G2D C;  2EN7 A;  4JI8 E;  2GLI A;  2YTO A;  2EOI A;  2JYA A;  2YTF A;  4K0K E;  1YZ9 A;  1N36 E;  1T4O A;  1O0W A;  2YSP A;  4FK5 C;  1BBO A;  2L3C A;  2LJH A;  2ODR C;  5FLX C;  3HQ1 A;  4BS9 A;  1N3G A;  5AE2 A;  2RPC A;  5T6J A;  5IT9 C;  1SFE A;  1YPN A;  4R2S A;  2YPN A;  3IWB A;  1UN6 B;  2V88 A;  3HTX A;  4M0V A;  2ADR A;  4JI4 E;  2LTR A;  2K4V A;  2LE2 A;  4J8Z A;  4F9C B;  5IWA E;  3VYX A;  2DB2 A;  4AQY E;  2EOQ A;  2EPP A;  4WSP A;  2ZM6 E;  4MLV A;  3F6H A;  2EPU A;  1ZAA C;  3RMP A;  4X64 E;  2EZ6 A;  2V8Q B;  4OX9 E;  2F4V E;  4DV6 E;  1YSA C;  1SR9 A;  4KHP E;  4RH8 A;  2YT4 A;  3J81 C;  4DV7 E;  2L3J A;  4X8W A;  4ZYH A;  4ZYE A;  4WXD A;  1IBL E;  2EL6 A;  1T4N A;  1T38 A;  1DGC A;  2L6M A;  2UU9 E;  2UUA E;  1BB8 A;  1MGT A;  2EN2 A;  1HNW E;  2EOX A;  4BCA A;  4O43 A;  2V89 A;  4WXC A;  3J7Y p;  1WXR A;  2EMG A;  1X6F A;  2MDG A;  1XNQ E;  2NUE A;  3C4B A;  3LLH A;  3T1H E;  2JR1 A;  4F9A B;  3C6M A;  4L5N C;  3FIG A;  1IMU A;  3ADG A;  1PJT A;  4DUY E;  2I13 A;  2LV2 A;  4BC9 A;  3KWR A;  2B7T A;  5LMU E;  3EPL A;  2EQ0 A; 
#chains in the Genus database with same CATH homology
 1G2F C;  2EM9 A;  2YTN A;  2WBU A;  5KL7 A;  2E72 A;  2LT7 A;  2VRD A;  2ELZ A;  2YU5 A;  2JP9 A;  2YTE A;  2ENA A;  1G2D C;  2CSH A;  2EOH A;  2LVH A;  4F6M A;  2EN7 A;  1RMD A;  4IJD A;  2GHF A;  4R2R A;  2GLI A;  3EPK A;  2YTO A;  1A1K A;  2EMY A;  2YSO A;  2EOI A;  2EMX A;  2EM8 A;  2YTF A;  2WBS A;  2EM5 A;  5KL4 A;  2EMI A;  2EOZ A;  2EOO A;  2RSI A;  1TF6 A;  2YSP A;  4FK5 C;  1BBO A;  2BB8 A;  4R2C A;  2CTD A;  3M99 B;  5KL3 A;  1UBD C;  2EOJ A;  2YTP A;  2EE8 A;  2EMZ A;  2EPZ A;  1P47 A;  2LO3 A;  1YUJ A;  2EN1 A;  2MKD A;  2NAB A;  2EOE A;  2EN4 A;  2WCC 3;  2PRT A;  2EJ4 A;  2DRP A;  4M9V C;  1AAY A;  2RPC A;  4R2S A;  2YTJ A;  2CT1 A;  2DMI A;  1UN6 B;  2EPX A;  1TN9 A;  1TF3 A;  2ADR A;  1WJP A;  1MEY C;  2YTI A;  2EPC A;  2EM3 A;  2ENH A;  1X6E A;  4F6N A;  2HGH A;  2EMH A;  4GZN C;  2EML A;  2EOQ A;  2EPP A;  1X6H A;  5KL2 A;  2EN8 A;  3MHH C;  1A1H A;  2EMA A;  2EPU A;  3UK3 C;  2YRH A;  1ZAA C;  1KJK A;  2ENC A;  2EMF A;  1LLM C;  2YTD A;  2EQ3 A;  4R2A A;  2EOY A;  2EM6 A;  2EQ1 A;  2A25 A;  2EM2 A;  1YSA C;  2M9A A;  2EM0 A;  2WBT A;  2DLK A;  3MHS C;  4F2J C;  2DLQ A;  4R2P A;  2EM4 A;  2YU8 A;  1X3C A;  2YRM A;  1Z1B A;  2EPA A;  1B69 A;  4R2Q A;  1F2I G;  2EL6 A;  2J7J A;  4R2D A;  2R1F A;  2EOS A;  2YRK A;  1A1G A;  1BB8 A;  1ZR9 A;  5KL6 A;  2EM7 A;  1A1J A;  2EN2 A;  2EOX A;  2ELY A;  1JK2 A;  2EMK A;  2EOR A;  1A1F A;  2EMW A;  3EPH A;  5KL5 A;  2YTQ A;  1NCS A;  1JK1 A;  1ZU1 A;  1X6F A;  2EMC A;  2EMG A;  2LCE A;  2MDG A;  4WSG A;  1X5W A;  2EP3 A;  2EN3 A;  2YTG A;  4X9J A;  1A1L A;  4IS1 C;  2MKN A;  3EPJ A;  1A1I A;  4R2E A;  2EOF A;  2I13 A;  2D9H A;  2EL4 A;  2DGC A;  2EOM A;  3VHT B;  2EPR A;  2LV2 A;  2JPA A;  2EL5 A;  2EN6 A;  2EMB A;  1DGC A;  3EPL A;  2EQ0 A;  1YUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...