3IWDA

T. maritima adometdc complex with 5'-deoxy-5'-dimethyl thioadenosine
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
55
structure length
55
Chain Sequence
HLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords S-adenosylmethionine decarboxylase
publication title Complexes of Thermotoga maritimaS-adenosylmethionine decarboxylase provide insights into substrate specificity.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 7
structure length 55
sequence length 55
chains with identical sequence C
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.750 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3iwdA00
3IWDA 3IWBA 3IWCA
chains in the Genus database with same CATH superfamily
2EOXA 2N8XA 2L2NA 1X47A 5T6JA 2EMCA 2LMZA 4LTYA 2EPNA 3EPLA 1EH8A 4RH8A 2YU5A 4MLVA 1G2FC 2ELZA 2YSOA 2V86A 2YRMA 3MHSC 4HEIA 1GQEA 3T1HE 5A6BA 2EM5A 2EJ4A 2LJUA 3F6GA 2R1FA 3VYYA 2MKNA 3T1YE 1BBOA 1IQOA 2EQ1A 1HR0E 2UXCE 1HNXE 2EOHA 3ADLA 3ECRA 2GLIA 3KZZA 4R2RA 1N3GA 5IT9C 4R2QA 3KWRA 2WBTA 4GEQB 4BHBA 4ZYHA 2L92A 3HPZA 1MGTA 1T4NA 1IBME 1GTKA 2EPRA 4WXDA 4DV0E 4GKKE 2YTJA 2M1SA 4KWYA 2RSIA 4LF8E 4DUZE 2RSMA 2UUAE 4F2JC 3AV0A 2HHHE 2LUPB 1UHZA 1YFHA 2J7JA 2ADRA 3BF2A 4WX9A 3RMPA 2M4IA 4LFCE 1EH7A 2EORA 1HNZE 1HNWE 2DRPA 2KHXA 3ADIA 1WJPA 4BBYA 5AE1A 4R8OA 2L6MA 5F3WA 2HC5A 5AC5A 2L3CA 4OX9E 2VQFE 1KJKA 2DB2A 4IJDA 4R2CA 4R2PA 4DR4E 1X3CA 2B7VA 4K0KE 2EP3A 3OMLA 2NUGA 2EPPA 2EMAA 4M2ZA 2M9AA 4NXME 4P78A 2DMIA 1ZU1A 2EMFA 2EPKX 5LMUE 1WHNA 4LF5E 2LT7A 2YTFA 2BB8A 2F8BA 2RTXA 3JTZA 1ZBQA 2EM8A 5A6AA 1A1IA 2YTDA 2GHFA 2DGCA 4JI5E 4YY3E 2EMLA 3LLHA 4F6NA 2EQ0A 4BC9A 4R2AA 2EPCA 4LF9E 1T4OA 2DSYA 4R2SA 2E1MA 5LLQA 4X66E 1N33E 2JR1A 2EL4A 4M0VA 5AE3A 3EPHA 2EOMA 2LCEA 1UN6B 1A1HA 1O0WA 5AC4A 2UUBE 3TQMA 2EPZA 4L8NA 4O43A 1I94E 1DGCA 2FV4B 2ENCA 2IHR1 1RC7A 4BMJA 4X62E 2EMKA 2EOQA 2L8TA 4LU9A 2EOYA 4R2EA 1NEIA 2LTSA 1IQSA 4WFTA 1WXRA 4LFAE 5A6BD 1PJTA 2DLKA 2F4VE 5IWAE 3K6QA 3OTOE 3HXLA 1AAYA 4WSPA 3EPJA 1KYQA 4NHRA 2RS6A 1X6EA 4RHBB 4JI2E 2L3JA 2EN7A 2EM7A 1IMUA 1YUIA 2EM9A 1G2DC 1YUJA 2WCC3 2G7HA 2YPNA 2YTOA 2JOBA 4DV2E 1A1KA 4HTGA 2BBGA 2N3HA 3C6MA 2LE2A 4GZNC 2LJHA 1T38A 5KL3A 2RS7A 4LFBE 3J81C 2B9DA 2YSPA 3BBGA 2HJJA 1PDAA 2VF1A 2ENAA 2EOJA 3HQ1A 4DV5E 3L00A 3THNA 2V89A 2EE8A 4NZVA 5BR8E 3BGHA 2EN8A 2EPOA 2YTQA 1DI2A 4B3TE 2MKDA 2EOOA 2ODRC 1X48A 4YHHE 5KL6A 2EL5A 1QU6A 4N4RB 4O5GA 1ZBTA 4F9AB 2V8QB 4Q28A 4X64E 2MC6A 2RQLA 3FIGA 2YRHA 5A6JA 2EN1A 5KL2A 4LF4E 4FK5C 4DV4E 1FKAE 1UBDC 2EOEA 2HGHA 3QG5C 2YTPA 2B3TB 4JI4E 1IBKE 1TF6A 2EN4A 5AE2A 1XNQE 4DR1E 4BCAA 4DMIA 1STUA 3J7Yp 4Q35B 3C4TA 4KHPE 4LF6E 2KOUA 1BBGA 5A2QC 4BHCA 3BIDA 1YPNA 2EMXA 4I8OA 2WBUA 4JI6E 3C4BA 2JXPA 3IWCA 1SR9A 2EM6A 2EM4A 2EOZA 2EN3A 2EOSA 4B3SE 1YZ9A 2PRTA 1J5EE 1IBLE 4DR6E 2UUCE 1LLMC 4R2DA 2EMWA 4B3ME 2EMBA 4WPYA 4X65E 2EN6A 4BC7A 2EOIA 1X49A 4DR3E 4F6MA 4JV5E 4GKJE 1ZAAC 4B3RE 2JOXA 2JYAA 4TUIA 4BS9A 2I13A 2ODRD 2VQEE 1RMDA 3ZOQB 2UU9E 4MLQA 4ZYEA 4KZSA 5KL7A 4DV6E 1SFEA 2JWOA 2V85A 1NCSA 2LV2A 2YZTA 2ENHA 2CSHA 2R76A 1F2IG 2CT1A 1T39A 2V83A 2JP9A 2EM0A 2EN2A 5KL5A 2EMGA 2K7IA 2YTEA 5FLXC 5A6KA 1BB8A 2FTXB 1P47A 4P7DA 3EPKA 5CFFE 3DJWA 3JAMC 2EM2A 4DR5E 2Q8UA 1YYKA 2EPAA 2MDRA 1EKZA 2E72A 5DNYA 1TF3A 2EQ3A 2YTNA 3IWDA 4L5NC 2RPCA 1YYOA 2LBSB 4WXCA 2WBSA 2NA2A 4F9BB 1QNTA 5LMNE 3F6HA 2L2MA 5A69A 3HPSA 3M99B 3C6KA 5ADZA 3KZYA 1JK1A 4DKKA 3DF6A 1PKPA 4O4KA 1EH6A 1ZR9A 2LVHA 2VRDA 3IWBA 1MEYC 2MDGA 5TSEA 5IV8B 2EOFA 2YRKA 1XNRE 2L33A 4M9VC 1B69A 1A1LA 5KL4A 1UILA 2ELYA 2EL6A 1XMOE 2LO3A 4TUGA 3UK3C 2YU8A 1L4SA 1N34E 4O24A 2MC5A 1TN9A 2NUEA 2DLQA 4JI8E 3J7AG 2WZOA 5LL6R 1J26A 4JI7E 1GZ6A 4JI1E 1AH5A 2EZ6A 1A1GA 3JU0A 3VHTB 4NXNE 2GPIA 4ZYDA 2FGGA 2LRSA 2UXBE 2M7QA 1WRJA 3MSWA 2JY9A 2VE7C 2EMYA 2DIXA 2K4VA 1YSAC 2EMHA 1JK2A 2H36X 1X6HA 4F9CB 2YT4A 4F54A 1N32E 3J80C 2L2KB 3LMLA 4DV3E 2CPNA 4IS1C 4DR7E 4OOGC 3MHHC 5IXMB 2LUQA 4DV1E 2YWQA 1DQ3A 4JI3E 2DMYA 2CTDA 2EPLX 2EM3A 4X8WA 2EPUA 3H09A 2YTIA 1A1FA 4R03A 2UXDE 4JI0E 4LF7E 3AUZA 2I9IA 4ZYGA 2JPAA 1PJSA 3HTXA 1XMQE 5AASA 4X9JA 3ADJA 2EPMX 2EMZA 1FJGE 1YYWA 1PJQA 2LTRA 2EWLA 2V88A 4WSGA 4DV7E 4AQYE 2EPXA 2E5LE 3P1XA 4DR2E 1A1JA 1Z1BA 1RQ0A 2D9HA 2N3GA 2ZM6E 2V87A 4WYQB 1X5WA 1X6FA 2A25A 2NABA 3VK6A 1T4LB 3VYXA 4J8ZA 3THOB 2YTGA 1WHQA 4DUYE 1N36E 2EMIA 4M30A 2NUFA 4JYAE 2KONA 2B7TA 2JVAA 3EQ1A 3ADGA
chains in the Genus database with same CATH topology
4DMIA 1STUA 3J7Yp 4JI5E 2L2NA 1UILA 3C4TA 1X47A 3LLHA 4YY3E 4KHPE 5T6JA 2LMZA 4LF6E 1XMOE 4LTYA 2KOUA 4BC9A 5A2QC 4LF9E 1T4OA 4TUGA 4I8OA 2DSYA 4JI6E 2E1MA 4X66E 3C4BA 1N33E 3IWCA 1SR9A 2JR1A 4M0VA 5AE3A 1N34E 4B3SE 1YZ9A 2MC5A 2V86A 2NUEA 4JI8E 1J5EE 1IBLE 4DR6E 3J7AG 2WZOA 1O0WA 5LL6R 2UUBE 4JI7E 4L8NA 2UUCE 1GQEA 1GZ6A 3T1HE 4B3ME 4JI1E 2EZ6A 3F6GA 4WPYA 4X65E 1I94E 2FV4B 4BC7A 3JU0A 4NXNE 2IHR1 1X49A 4BMJA 4DR3E 1RC7A 4JV5E 3VYYA 4X62E 4GKJE 2L8TA 3T1YE 4LU9A 2FGGA 2LRSA 4B3RE 2JOXA 4TUIA 2UXBE 2M7QA 1HR0E 2UXCE 4BS9A 1HNXE 2LTSA 2ODRD 4WFTA 1WXRA 4LFAE 3MSWA 2JY9A 2VQEE 3ADLA 2VE7C 3ZOQB 2UU9E 2F4VE 2DIXA 2K4VA 5IWAE 3K6QA 3OTOE 3HXLA 4KZSA 2H36X 4WSPA 4DV6E 4F9CB 2JWOA 2V85A 2YT4A 2YZTA 5IT9C 2RS6A 4F54A 4JI2E 1N32E 3KWRA 3J80C 2L2KB 2L3JA 3LMLA 4DV3E 2CPNA 4GEQB 1J26A 2L92A 3HPZA 4DR7E 4OOGC 2G7HA 2V83A 2LUQA 1T4NA 2JOBA 4DV1E 4DV2E 1DQ3A 1IBME 4JI3E 2DMYA 4DV0E 4GKKE 2N3HA 2LE2A 2M1SA 4X8WA 3H09A 2LJHA 5FLXC 4LF8E 4R03A 2RS7A 2RSMA 4DUZE 2UUAE 4LFBE 3J81C 3AV0A 2HHHE 2UXDE 2B9DA 2FTXB 4JI0E 2LUPB 1UHZA 3AUZA 4P7DA 4LF7E 5CFFE 3DJWA 3JAMC 2VF1A 3RMPA 2M4IA 3HQ1A 4LFCE 4DV5E 4DR5E 1HNZE 1HNWE 3ADIA 2KHXA 2V89A 3HTXA 4BBYA 5BR8E 5AE1A 4R8OA 5AASA 1XMQE 1YYKA 2L6MA 3ADJA 2MDRA 5F3WA 1DI2A 1FJGE 2L3CA 4OX9E 4B3TE 2VQFE 1YYWA 2DB2A 2LTRA 2V88A 2EWLA 4DV7E 2ODRC 1X48A 5DNYA 4AQYE 4YHHE 1EKZA 2E5LE 1QU6A 3IWDA 4L5NC 4DR4E 3P1XA 2B7VA 4K0KE 1ZBTA 4F9AB 2V8QB 3OMLA 4DR2E 2LBSB 1YYOA 2NUGA 1RQ0A 4DR1E 4Q28A 2N3GA 2NA2A 4X64E 4F9BB 2ZM6E 4M2ZA 2V87A 5LMNE 4P78A 4NXME 2MC6A 3F6HA 2L2MA 3FIGA 4WYQB 3HPSA 5LMUE 5ADZA 1WHNA 3VK6A 4DKKA 4LF5E 3DF6A 1T4LB 4LF4E 4DV4E 1FKAE 1PKPA 3VYXA 4J8ZA 4DUYE 1WHQA 1N36E 2F8BA 3IWBA 2B3TB 4M30A 2NUFA 4JYAE 2RTXA 2KONA 3JTZA 2B7TA 1ZBQA 1IBKE 4JI4E 2L33A 1XNRE 2JVAA 5AE2A 1XNQE 3ADGA 4BCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWD A;  3IWB A;  3IWC A; 
#chains in the Genus database with same CATH topology
 2EOX A;  2N8X A;  2L2N A;  1X47 A;  5T6J A;  2EMC A;  2LMZ A;  4LTY A;  2EPN A;  3EPL A;  1EH8 A;  4RH8 A;  2YU5 A;  4MLV A;  1G2F C;  2ELZ A;  2YSO A;  2V86 A;  2YRM A;  3MHS C;  4HEI A;  1GQE A;  3T1H E;  5A6B A;  2EM5 A;  2EJ4 A;  2LJU A;  3F6G A;  2R1F A;  3VYY A;  2MKN A;  3T1Y E;  1BBO A;  1IQO A;  2EQ1 A;  1HR0 E;  2UXC E;  1HNX E;  2EOH A;  3ADL A;  3ECR A;  2GLI A;  3KZZ A;  4R2R A;  1N3G A;  5IT9 C;  4R2Q A;  3KWR A;  2WBT A;  4GEQ B;  4BHB A;  4ZYH A;  2L92 A;  3HPZ A;  1MGT A;  1T4N A;  1IBM E;  1GTK A;  2EPR A;  4WXD A;  4DV0 E;  4GKK E;  2YTJ A;  2M1S A;  4KWY A;  2RSI A;  4LF8 E;  4DUZ E;  2RSM A;  2UUA E;  4F2J C;  3AV0 A;  2HHH E;  2LUP B;  1UHZ A;  1YFH A;  2J7J A;  2ADR A;  3BF2 A;  4WX9 A;  3RMP A;  2M4I A;  4LFC E;  1EH7 A;  2EOR A;  1HNZ E;  1HNW E;  2DRP A;  2KHX A;  3ADI A;  1WJP A;  4BBY A;  5AE1 A;  4R8O A;  2L6M A;  5F3W A;  2HC5 A;  5AC5 A;  2L3C A;  4OX9 E;  2VQF E;  1KJK A;  2DB2 A;  4IJD A;  4R2C A;  4R2P A;  4DR4 E;  1X3C A;  2B7V A;  4K0K E;  2EP3 A;  3OML A;  2NUG A;  2EPP A;  2EMA A;  4M2Z A;  2M9A A;  4NXM E;  4P78 A;  2DMI A;  1ZU1 A;  2EMF A;  2EPK X;  5LMU E;  1WHN A;  4LF5 E;  2LT7 A;  2YTF A;  2BB8 A;  2F8B A;  2RTX A;  3JTZ A;  1ZBQ A;  2EM8 A;  5A6A A;  1A1I A;  2YTD A;  2GHF A;  2DGC A;  4JI5 E;  4YY3 E;  2EML A;  3LLH A;  4F6N A;  2EQ0 A;  4BC9 A;  4R2A A;  2EPC A;  4LF9 E;  1T4O A;  2DSY A;  4R2S A;  2E1M A;  5LLQ A;  4X66 E;  1N33 E;  2JR1 A;  2EL4 A;  4M0V A;  5AE3 A;  3EPH A;  2EOM A;  2LCE A;  1UN6 B;  1A1H A;  1O0W A;  5AC4 A;  2UUB E;  3TQM A;  2EPZ A;  4L8N A;  4O43 A;  1I94 E;  1DGC A;  2FV4 B;  2ENC A;  2IHR 1;  1RC7 A;  4BMJ A;  4X62 E;  2EMK A;  2EOQ A;  2L8T A;  4LU9 A;  2EOY A;  4R2E A;  1NEI A;  2LTS A;  1IQS A;  4WFT A;  1WXR A;  4LFA E;  5A6B D;  1PJT A;  2DLK A;  2F4V E;  5IWA E;  3K6Q A;  3OTO E;  3HXL A;  1AAY A;  4WSP A;  3EPJ A;  1KYQ A;  4NHR A;  2RS6 A;  1X6E A;  4RHB B;  4JI2 E;  2L3J A;  2EN7 A;  2EM7 A;  1IMU A;  1YUI A;  2EM9 A;  1G2D C;  1YUJ A;  2WCC 3;  2G7H A;  2YPN A;  2YTO A;  2JOB A;  4DV2 E;  1A1K A;  4HTG A;  2BBG A;  2N3H A;  3C6M A;  2LE2 A;  4GZN C;  2LJH A;  1T38 A;  5KL3 A;  2RS7 A;  4LFB E;  3J81 C;  2B9D A;  2YSP A;  3BBG A;  2HJJ A;  1PDA A;  2VF1 A;  2ENA A;  2EOJ A;  3HQ1 A;  4DV5 E;  3L00 A;  3THN A;  2V89 A;  2EE8 A;  4NZV A;  5BR8 E;  3BGH A;  2EN8 A;  2EPO A;  2YTQ A;  1DI2 A;  4B3T E;  2MKD A;  2EOO A;  2ODR C;  1X48 A;  4YHH E;  5KL6 A;  2EL5 A;  1QU6 A;  4N4R B;  4O5G A;  1ZBT A;  4F9A B;  2V8Q B;  4Q28 A;  4X64 E;  2MC6 A;  2RQL A;  3FIG A;  2YRH A;  5A6J A;  2EN1 A;  5KL2 A;  4LF4 E;  4FK5 C;  4DV4 E;  1FKA E;  1UBD C;  2EOE A;  2HGH A;  3QG5 C;  2YTP A;  2B3T B;  4JI4 E;  1IBK E;  1TF6 A;  2EN4 A;  5AE2 A;  1XNQ E;  4DR1 E;  4BCA A;  4DMI A;  1STU A;  3J7Y p;  4Q35 B;  3C4T A;  4KHP E;  4LF6 E;  2KOU A;  1BBG A;  5A2Q C;  4BHC A;  3BID A;  1YPN A;  2EMX A;  4I8O A;  2WBU A;  4JI6 E;  3C4B A;  2JXP A;  3IWC A;  1SR9 A;  2EM6 A;  2EM4 A;  2EOZ A;  2EN3 A;  2EOS A;  4B3S E;  1YZ9 A;  2PRT A;  1J5E E;  1IBL E;  4DR6 E;  2UUC E;  1LLM C;  4R2D A;  2EMW A;  4B3M E;  2EMB A;  4WPY A;  4X65 E;  2EN6 A;  4BC7 A;  2EOI A;  1X49 A;  4DR3 E;  4F6M A;  4JV5 E;  4GKJ E;  1ZAA C;  4B3R E;  2JOX A;  2JYA A;  4TUI A;  4BS9 A;  2I13 A;  2ODR D;  2VQE E;  1RMD A;  3ZOQ B;  2UU9 E;  4MLQ A;  4ZYE A;  4KZS A;  5KL7 A;  4DV6 E;  1SFE A;  2JWO A;  2V85 A;  1NCS A;  2LV2 A;  2YZT A;  2ENH A;  2CSH A;  2R76 A;  1F2I G;  2CT1 A;  1T39 A;  2V83 A;  2JP9 A;  2EM0 A;  2EN2 A;  5KL5 A;  2EMG A;  2K7I A;  2YTE A;  5FLX C;  5A6K A;  1BB8 A;  2FTX B;  1P47 A;  4P7D A;  3EPK A;  5CFF E;  3DJW A;  3JAM C;  2EM2 A;  4DR5 E;  2Q8U A;  1YYK A;  2EPA A;  2MDR A;  1EKZ A;  2E72 A;  5DNY A;  1TF3 A;  2EQ3 A;  2YTN A;  3IWD A;  4L5N C;  2RPC A;  1YYO A;  2LBS B;  4WXC A;  2WBS A;  2NA2 A;  4F9B B;  1QNT A;  5LMN E;  3F6H A;  2L2M A;  5A69 A;  3HPS A;  3M99 B;  3C6K A;  5ADZ A;  3KZY A;  1JK1 A;  4DKK A;  3DF6 A;  1PKP A;  4O4K A;  1EH6 A;  1ZR9 A;  2LVH A;  2VRD A;  3IWB A;  1MEY C;  2MDG A;  5TSE A;  5IV8 B;  2EOF A;  2YRK A;  1XNR E;  2L33 A;  4M9V C;  1B69 A;  1A1L A;  5KL4 A;  1UIL A;  2ELY A;  2EL6 A;  1XMO E;  2LO3 A;  4TUG A;  3UK3 C;  2YU8 A;  1L4S A;  1N34 E;  4O24 A;  2MC5 A;  1TN9 A;  2NUE A;  2DLQ A;  4JI8 E;  3J7A G;  2WZO A;  5LL6 R;  1J26 A;  4JI7 E;  1GZ6 A;  4JI1 E;  1AH5 A;  2EZ6 A;  1A1G A;  3JU0 A;  3VHT B;  4NXN E;  2GPI A;  4ZYD A;  2FGG A;  2LRS A;  2UXB E;  2M7Q A;  1WRJ A;  3MSW A;  2JY9 A;  2VE7 C;  2EMY A;  2DIX A;  2K4V A;  1YSA C;  2EMH A;  1JK2 A;  2H36 X;  1X6H A;  4F9C B;  2YT4 A;  4F54 A;  1N32 E;  3J80 C;  2L2K B;  3LML A;  4DV3 E;  2CPN A;  4IS1 C;  4DR7 E;  4OOG C;  3MHH C;  5IXM B;  2LUQ A;  4DV1 E;  2YWQ A;  1DQ3 A;  4JI3 E;  2DMY A;  2CTD A;  2EPL X;  2EM3 A;  4X8W A;  2EPU A;  3H09 A;  2YTI A;  1A1F A;  4R03 A;  2UXD E;  4JI0 E;  4LF7 E;  3AUZ A;  2I9I A;  4ZYG A;  2JPA A;  1PJS A;  3HTX A;  1XMQ E;  5AAS A;  4X9J A;  3ADJ A;  2EPM X;  2EMZ A;  1FJG E;  1YYW A;  1PJQ A;  2LTR A;  2EWL A;  2V88 A;  4WSG A;  4DV7 E;  4AQY E;  2EPX A;  2E5L E;  3P1X A;  4DR2 E;  1A1J A;  1Z1B A;  1RQ0 A;  2D9H A;  2N3G A;  2ZM6 E;  2V87 A;  4WYQ B;  1X5W A;  1X6F A;  2A25 A;  2NAB A;  3VK6 A;  1T4L B;  3VYX A;  4J8Z A;  3THO B;  2YTG A;  1WHQ A;  4DUY E;  1N36 E;  2EMI A;  4M30 A;  2NUF A;  4JYA E;  2KON A;  2B7T A;  2JVA A;  3EQ1 A;  3ADG A; 
#chains in the Genus database with same CATH homology
 4DMI A;  1STU A;  3J7Y p;  4JI5 E;  2L2N A;  1UIL A;  3C4T A;  1X47 A;  3LLH A;  4YY3 E;  4KHP E;  5T6J A;  2LMZ A;  4LF6 E;  1XMO E;  4LTY A;  2KOU A;  4BC9 A;  5A2Q C;  4LF9 E;  1T4O A;  4TUG A;  4I8O A;  2DSY A;  4JI6 E;  2E1M A;  4X66 E;  3C4B A;  1N33 E;  3IWC A;  1SR9 A;  2JR1 A;  4M0V A;  5AE3 A;  1N34 E;  4B3S E;  1YZ9 A;  2MC5 A;  2V86 A;  2NUE A;  4JI8 E;  1J5E E;  1IBL E;  4DR6 E;  3J7A G;  2WZO A;  1O0W A;  5LL6 R;  2UUB E;  4JI7 E;  4L8N A;  2UUC E;  1GQE A;  1GZ6 A;  3T1H E;  4B3M E;  4JI1 E;  2EZ6 A;  3F6G A;  4WPY A;  4X65 E;  1I94 E;  2FV4 B;  4BC7 A;  3JU0 A;  4NXN E;  2IHR 1;  1X49 A;  4BMJ A;  4DR3 E;  1RC7 A;  4JV5 E;  3VYY A;  4X62 E;  4GKJ E;  2L8T A;  3T1Y E;  4LU9 A;  2FGG A;  2LRS A;  4B3R E;  2JOX A;  4TUI A;  2UXB E;  2M7Q A;  1HR0 E;  2UXC E;  4BS9 A;  1HNX E;  2LTS A;  2ODR D;  4WFT A;  1WXR A;  4LFA E;  3MSW A;  2JY9 A;  2VQE E;  3ADL A;  2VE7 C;  3ZOQ B;  2UU9 E;  2F4V E;  2DIX A;  2K4V A;  5IWA E;  3K6Q A;  3OTO E;  3HXL A;  4KZS A;  2H36 X;  4WSP A;  4DV6 E;  4F9C B;  2JWO A;  2V85 A;  2YT4 A;  2YZT A;  5IT9 C;  2RS6 A;  4F54 A;  4JI2 E;  1N32 E;  3KWR A;  3J80 C;  2L2K B;  2L3J A;  3LML A;  4DV3 E;  2CPN A;  4GEQ B;  1J26 A;  2L92 A;  3HPZ A;  4DR7 E;  4OOG C;  2G7H A;  2V83 A;  2LUQ A;  1T4N A;  2JOB A;  4DV1 E;  4DV2 E;  1DQ3 A;  1IBM E;  4JI3 E;  2DMY A;  4DV0 E;  4GKK E;  2N3H A;  2LE2 A;  2M1S A;  4X8W A;  3H09 A;  2LJH A;  5FLX C;  4LF8 E;  4R03 A;  2RS7 A;  2RSM A;  4DUZ E;  2UUA E;  4LFB E;  3J81 C;  3AV0 A;  2HHH E;  2UXD E;  2B9D A;  2FTX B;  4JI0 E;  2LUP B;  1UHZ A;  3AUZ A;  4P7D A;  4LF7 E;  5CFF E;  3DJW A;  3JAM C;  2VF1 A;  3RMP A;  2M4I A;  3HQ1 A;  4LFC E;  4DV5 E;  4DR5 E;  1HNZ E;  1HNW E;  3ADI A;  2KHX A;  2V89 A;  3HTX A;  4BBY A;  5BR8 E;  5AE1 A;  4R8O A;  5AAS A;  1XMQ E;  1YYK A;  2L6M A;  3ADJ A;  2MDR A;  5F3W A;  1DI2 A;  1FJG E;  2L3C A;  4OX9 E;  4B3T E;  2VQF E;  1YYW A;  2DB2 A;  2LTR A;  2V88 A;  2EWL A;  4DV7 E;  2ODR C;  1X48 A;  5DNY A;  4AQY E;  4YHH E;  1EKZ A;  2E5L E;  1QU6 A;  3IWD A;  4L5N C;  4DR4 E;  3P1X A;  2B7V A;  4K0K E;  1ZBT A;  4F9A B;  2V8Q B;  3OML A;  4DR2 E;  2LBS B;  1YYO A;  2NUG A;  1RQ0 A;  4DR1 E;  4Q28 A;  2N3G A;  2NA2 A;  4X64 E;  4F9B B;  2ZM6 E;  4M2Z A;  2V87 A;  5LMN E;  4P78 A;  4NXM E;  2MC6 A;  3F6H A;  2L2M A;  3FIG A;  4WYQ B;  3HPS A;  5LMU E;  5ADZ A;  1WHN A;  3VK6 A;  4DKK A;  4LF5 E;  3DF6 A;  1T4L B;  4LF4 E;  4DV4 E;  1FKA E;  1PKP A;  3VYX A;  4J8Z A;  4DUY E;  1WHQ A;  1N36 E;  2F8B A;  3IWB A;  2B3T B;  4M30 A;  2NUF A;  4JYA E;  2RTX A;  2KON A;  3JTZ A;  2B7T A;  1ZBQ A;  1IBK E;  4JI4 E;  2L33 A;  1XNR E;  2JVA A;  5AE2 A;  1XNQ E;  3ADG A;  4BCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...