5LLQA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119f variant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPFHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Interdomain interactions rearrangements control the reaction steps of a thermostable DNA alkyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5llqA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 5llqA01
1U6GA 3I58A 3JTHA 4N9IA 2XGXA 1YQAA 4IRIA 2J5OA 1FNNA 1R22A 1WWXA 3J81Z 2FNPA 4PZJA 1BI0A 4KIFA 4Y15A 3FWEA 3ERED 3I64A 2M8EA 4A2UA 1CF7B 3E6MA 1OPCA 1F1ZA 2GAUA 2Z9OA 5ILSA 3T8TA 3T1BA 3MCZA 2F5EA 2LNBA 3KP4A 4MTDA 1ONVA 2E1NA 4WX9A 3BDDA 2XASA 3ROUA 3ABUA 3L7WA 3BPVA 2PMUA 3RIRA 4ASNA 3REOA 4CICA 1IW7F 5LLQA 5HS7A 3L00A 1Q1HA 3E3VA 3Q9SA 3LFKA 5FGMA 2OD5A 1Y0UA 1LVAA 2HGCA 3ZMDA 3I59A 2ESHA 4A0YA 1HW2A 5E1ZB 2QQAA 2WV0A 1LDJA 3LA7A 3TGNA 2G9WA 3KETA 1J59A 4BQAA 4RAYA 1IRGA 4R8HA 1I1SA 2PMHA 4IRHA 3ZMSA 1XMKA 2X0LA 2EB7A 4A5MA 3HOSA 3SZTA 4A6DA 5CVVA 3ZPLA 4BXUA 3KLOA 2VBZA 1UHWA 4Z2YA 1TTYA 4CYDA 1K78A 4MEYF 2CSOA 2YX7A 5IT9K 2QBYB 1IXRC 2CFXA 1BIBA 1YYVA 4K2EA 2P5VA 3TO9A 1IN8A 4OIOF 1MZBA 5HS9A 1R23A 2PEXA 5CVIA 1IZ1A 2PFBA 3WE2A 3MQ0A 2WC2A 2CGPA 4YG2F 2M1BA 1KQ0A 1ZRFA 2L54A 5ICEA 1ZLKA 1S8NA 3HSRA 5D5UB 4HX7A 1LB2A 2C6YA 2Q2EA 1R1TA 1R1UA 3R60A 1F9NA 1DPRA 1SAXA 2LSOA 1HW5A 3HRSA 3EETA 2F5CA 1O7LA 2HS5A 4UV9A 4HX8A 2VXZA 3K1PA 3BJ6A 2FEZA 4LK1F 1R1VA 1ZRCA 2BEOA 5CVRA 2K86A 4EQQA 2IW5A 1E2XA 3HTSB 1UCRA 5FLXK 4LJZF 1J7KA 4U7DA 1HSJA 2PN6A 4L9TA 4QLCU 2Z33A 2CO5A 3KZYA 3RJPA 3IC7A 4EM2A 5E8GA 3V7CA 4WCGA 2HYFA 1GXPA 1IN6A 3KP2A 1BC8C 1D8KA 2A6HF 4NB5A 2W85A 2FMLA 4ZH4F 3FHZA 3SZPA 1DPUA 5K5QA 4WXCA 4R79A 2JT1A 1U5TA 1T39A 2JTVA 4L9JA 4N9HA 5LHIA 4ENKA 3R4KA 4RB3C 5F6FA 1RUOA 3BPXA 3FMQA 3W6KB 3FX3A 4MQVA 4OMYA 3IKVA 3WU1B 4XLPF 1YS6A 2FMYA 4RAZA 3RYRA 3JAMK 3HRTA 2VN2A 1B59A 1AWCA 5DD4A 4FHTA 3TDZC 2EA2A 3PFIA 2P7VB 3Q5FA 2Z5UA 2RGVA 4HDUA 5ICGA 2OBPA 1LQ1A 1A04A 4U88A 4ZZDA 1ZHFA 4Y17A 1GVJA 3WTUC 5DYMA 2FBKA 3F72A 3WTZA 1T38A 4I02A 4HBLA 1HQCA 4P55A 3DF8A 2XV4S 2HTSA 2OZ6A 2FU4A 1KU3A 1ON1A 5D5VB 1Z91A 3F8CA 2LKPA 4M6XA 4GGGA 4I01A 1OMIA 2XHKA 2A69F 1WI9A 4UXNA 1BI2A 2QQBA 1FYLA 2RC4A 2KIUA 2HKOA 2RDPA 3IWFA 1K79A 1FC3A 4ZYHA 3JSOA 2UZKA 2DBBA 1W7PD 4MEXF 3NRVA 3ZMUA 3M9AA 4EVIA 5J8FA 1U5TC 2H6CA 3GFIA 4OIPF 2OAZA 3WE3A 4G6DA 2P8TA 4YFKF 5JI6A 5HLIA 1IXCA 1QZYA 3JTGA 1CF7A 2MA3A 1MJBA 5L3CA 1U3EM 4L9NA 1XCBA 2DFIA 2QWWA 2ZMEA 3CJNA 5CYVA 1FLIA 5D4RA 3I53A 4GXOA 1MDMB 3AAFA 4MTEA 1REPC 5LGNA 2BE5F 5DCMB 1U2WA 1OYWA 1W5SA 1ZGJA 3WGIA 1P6RA 2MBFA 1PP7U 5TJJA 1B6AA 4B09A 1TNTA 4RB1A 2DPUA 3FM3A 2YX4A 1DUXC 4RGRA 4I7HA 2RQPA 5LEKA 3FXQA 5HLGA 2FE3A 2M45A 3EDPA 4M74A 3CTAA 3L2CA 2AXLA 3GX4X 1KYWA 1YFHA 1DDNA 2EFOA 4WWCA 3HRUA 2VONA 4DNCA 4ENMA 1QGPA 5ICFA 1X3UA 4EGYA 5HDKA 2DAOA 2IA0A 2VBWA 4XRFA 2A07F 5BQTA 5DDGA 2QBYA 3GWZA 4HV6A 4OOIA 1O3QA 5LHHA 3KP7A 2DW4A 5D8LB 2FXAA 4KN4X 1FZPB 2GXBA 1G3YA 4P5OA 2G7UA 4L5JA 3KEOA 3WTXC 4ENJA 3GLXA 4AIHA 2K4BA 1ON2A 4GCVA 3ZN0A 2W25A 3WGGA 1WRJA 3F23A 5K1YA 2DQLA 2IRFG 4IRGA 3BP8A 1ODDA 2OU2A 4M73A 2HOEA 2XKOA 1BI1A 3V4GA 1Z6TA 1YIOA 4JQFA 1R5GA 1P4XA 1G3WA 4WXHA 4MHGA 1PP8F 1C0WA 2IA2A 1YS7A 1HSTA 3F22A 1J9IA 1BM9A 1J5YA 1IF1A 2YR2A 1XGOA 4WXDA 4OIRF 1ZG3A 1S29A 3I5UA 1KQ9A 4BAYA 3QAHA 2DI3A 4EMSA 3RTRA 5D6EA 4CGZA 1F4KA 3HOTA 1EV7A 2VT3A 1S7AA 2EA4A 2KKOA 5LRRA 1TLHB 3GUDA 3KP5A 1G4DA 4NQWA 1G3SA 3E6CC 3S2WA 5ED4A 1MJAA 3K69A 3F3XA 3J81K 4UVAA 2DU9A 2IVMA 3QPTA 4FX4A 1IXSB 2PJPA 1OKRA 2ISZA 3TOAA 1P92A 1ULYA 1B4AA 2BGCA 3QPHA 2FRHA 2MLKA 3F8FA 1B9MA 4D0PA 3KLNA 2VOPA 3O3KA 4H0EA 2MLGA 2XAQA 4MNUA 3CLOA 3IRQA 1S3JA 2M5WA 4EJUA 4IXAA 4R1HA 3V8KA 2EK5A 1G3TA 2Y75A 2VBXA 4M6YA 2YSRA 4Q4ZF 4G9YA 3WU0A 2LF7A 2XAHA 4GYIA 2XROA 3J80Z 2DPDA 4FT8A 1RZ4A 3RKYA 1KU9A 4PGGA 3DEUA 4O6JA 3HSFA 3MWMA 3KFWX 1F5TA 3IL2A 4CXFA 1SFXA 1HXDA 1BC7C 1SD5A 1SD4A 4IVNA 2P4WA 2NNYA 4CDGA 4I0AA 2JZYA 3LA2A 4JBAA 3GFJA 4AVPA 2EV0A 4KICA 1QBJA 4ON0A 1AOYA 4RGXA 1V3FA 3WGHA 1FY7A 4UUVA 3V8LA 1RI7A 2E7XA 4U0YA 3TO7A 1YO5C 1ZYRF 2E1CA 1TW3A 4GO1A 4CHUA 2OA4A 2EJRA 2HZTA 4LLLA 1PDNC 5L3FA 3EYYA 2ELHA 1HKSA 1KU2A 2FBIA 5BPIA 4AWXB 1D8JA 3DQVC 3DXJF 5FFXA 1BIAA 3H3UA 3QRFF 2YU3A 5H6RA 3FZVA 2FBHA 3P7NA 5LBQA 3F21A 2ETHA 1O3TA 4LK0F 3RI4A 1HKTA 2R3SA 3KEQA 3J7AO 2D1VA 3E6DA 5DCFA 4DQ2A 2L02A 5BMZA 2D45A 4CO8A 1FSEA 2QQ9A 4ZYEA 5HVQC 1LJ9A 1NHAA 4BH9A 2W57A 3K1MA 5DCMA 2CYYA 2L4AA 2Q0OA 3ECOA 3CDHA 2EFNA 4ETSA 1TBXA 1FPQA 3HIFA 3FM5A 2VC0A 1OYYA 2M87A 5J8CA 3BROA 3P9KA 4L18B 2HR3A 2W84A 5L3DA 2HQRA 1YLFA 2W24A 4UHTA 1Z05A 2V1DA 2CW0F 4I09A 1ZLJA 2DQRA 3I4PA 1YW9A 4RGUA 2WWYA 2VE8A 3M7GA 3GVAA 2XAGA 3FXRA 1KQ8A 1QQIA 3QP6A 2BBYA 3LQQA 4HDVA 4HQMA 4EM1A 2XVCA 2O3FA 3ML6A 3GZ6A 3QU6A 5DD8A 2ZCWA 1IN5A 3HYIA 4EJOA 1O57A 2KIMA 5BS6A 4M9XA 3SXYA 5DEQA 2Y48A 3LQRA 4IPAA 1W7PB 4E70A 1UFMA 4AD9A 1XDUA 1O7FA 4U0VA 3JAMZ 3WODF 2H6BA 3TOBA 3HTUA 5KK1A 3DKWA 2P6SA 5BPDA 5HDNA 1KGSA 2JPCA 4G7HF 2ZNZA 4BHCA 3WG9A 2RN7A 1ZG5A 3CUQB 2V1XA 4HX4A 4LLGF 3ZMTA 3FXUA 3WTYC 2XUBA 3WTVC 3GF2A 4OMZA 2KJBA 3TQNA 4O3MA 2ZKZA 2ZJ2A 4EJTA 2ESNA 2PLYA 1FOKA 3BZ6A 3M1EA 3U9GA 2PG4A 5HOOA 2X4HA 4XBFA 4M71A 1GXQA 1YG2A 2MH9A 1CGPA 4Y13A 4LB6B 4F7ZA 5AONA 5DV5A 1RIOH 4IF4A 1I6XA 2EV6A 3F8BA 3QU3A 1S6LA 3BJOA 1TW2A 3I54A 4O5VA 1XGSA 4S04A 1K7AA 3F6VA 2GXGA 1B1BA 2NYXA 1QPMA 2KJCA 1O3RA 3ELKA 3V8JA 1XDSA 4WF2A 3WTSC 5F1RA 4HA8A 2P7CB 2RVCA 2JSCA 2ZFWA 4Q5SF 4HV5A 3RYPA 4AIKA 1EH8A 4UVCA 4UNOA 4HLYA 4HQEA 1RNLA 1PUEE 2KRFA 5IT3A 1STZA 1UB9A 1ZN2A 2V9VA 3C7JA 3ISPA 3E5QA 2JRTA 2QUFA 3K0LA 4IJAA 3Q9VA 3TKYA 1T0FA 1FBUA 1I27A 2ISYA 5E1XA 4L0YB 1XSVA 1OR7A 4FX0A 2L01A 1TQIA 1TQMA 3P9CA 3CO6C 1IUYA 1LDKB 3V7SA 1D3YA 2DT5A 3P9IA 4L9VA 4KIBA 1U5TB 3JSPA 3K2ZA 3GZ5A 2A3SA 5KVRA 2TDXA 1O3SA 3D5LA 4ESJA 1YW8A 2EV5A 1LDDA 1D5VA 1IN4A 3EQLF 2G7HA 2XAJA 2PBIA 1W5TA 4S05A 2DTRA 2QVOA 5E1WA 2XIGA 2FSWA 3I71A 1XD7A 2VE9A 1T6SA 1IAWA 4BHBA 3KP6A 2K7LA 1XSXA 4AIJA 1HKQA 5J6XA 3BY6A 4HOBA 4P96A 1Z7UA 3O6BB 5TRDA 4LD5A 2VOOA 2QZ8A 5EEGA 2HFHA 3C18A 5A2QZ 3FMRA 3BWGA 3GO5A 1R00A 3COAC 4IHSA 5AIQA 4ESFA 3D0SA 1FYMA 3HRMA 1MKMA 3FMSA 1XGNA 3VOEA 3H92A 4BYYA 2ZNYA 1LNWA 5FD5A 4LB5A 4GYGA 3ZQ7A 2K27A 4MGRA 2R7DA 3DV8A 4ZYGA 5ERIA 2FOKA 3GYHX 5E17F 3C3WA 4NHJA 1JE8A 3KZZA 2GA1A 5DUKA 4A5NA 1JGSA 3F6OA 4RB2C 4KN7X 2HDCA 1WSUA 3K1NA 1JHFA 2UXXA 4I2OA 1ZARA 3T5XA 1SFUA 1SMYF 3L09A 1FP2A 2IPQX 1XN7A 2ZMEB 3U2RA 1HW1A 5D8KB 4YIFA 2PI0A 5AIPA 3TO6A 4U0WA 4HYEA 4L5IA 3JW4A 1FYKA 5H20A 2D2WA 3B73A 3B02A 3T0YA 4UV8A 1YTYA 3GEZA 5E18F 1W7PA 2GIVA 4RGSA 1L0OC 1OYIA 1SD6A 1USSA 4P9UA 2V6CA 3F8MA 3E97A 4JK1X 3J80K 4A0XA 3KE2A 3M8FA 1U8RA 4G8XA 2VT2A 4LG0B 2O03A 2NS0A 1BJAA 1B9NA 1LEAA 3CUQA 3I0TA 2IA1A 3LWFA 3M8EA 4CZZA 4QWQA 1L3LA 1XCVA 1J75A 2XKPA 3RDIA 2E7WA 3ZMZA 5JFRA 3SQNA 1ZH5A 1TQPA 3OV8A 3R61A 5IT9Z 3RKXA 3VB2A 2IJLA 5FFZA 5FO5A 1SFEA 3CUOA 4OINF 1U78A 1QZZA 2BV6A 4HW0A 3HHHA 5DUIA 1R58A 3DP7A 3QOPA 3U1DA 3OOPA 4BNCA 2A5YB 4OU0A 2HTJA 2H09A 4I0BA 4KDPA 3ZN1A 2RKHA 5E20A 2HQNA 3FF5A 3O2PE 4N0BA 3ULQB 4BHPA 1BI3A 3WTWC 2ZO4A 4G7ZF 1ZRDA 3IHUA 3IRRA 2K02A 2RNJA 1FWZA 4XSZF 2Z99A 1KA8A 2O0YA 2VBYA 1JHHA 2FQ3A 1FT9A 1MDMA 3RKWA 2A6EF 1HBXG 5LEJA 5LRSA 1MD0A 4PCQA 5CJ9A 4EM0B 3HHGA 4M72A 4HF0A 4MQ9F 4A6EA 1V4RA 1G6NA 4RB0A 2HKXA 2EFQA 5FLXZ 2FF4A 3E6BA 2UWMA 3R6SA 3G3ZA 3CUQC 2ADUA 3NEUA 2H27A 3F8NA 3VODA 5H6QA 2ZBKA 1DP7P 3IKTA 2CG4A 1J0RA 3E5XA 5ILVA 3ZMVA 2P5KA 2KIFA 5JR3A 3LSTA 2Z3YA 5BOXA 3MAJA 1E17A 4M9ZA 1BBYA 2R7FA 2V1UA 2P5LC 2F5DA 5EEHA 2QYOA 4A0ZA 2MH2A 4HZFA 2DLLA 2A61A 1USTA 5D6FA 4G6QA 2LF8A 2NAZA 2EFWA 1Z9CA 5HDGA 2FNAA 3QP5A 4TV7A 4I98B 2AS5F 2FA5A 4G7OF 1MGTA 2O61A 2QLZA 1H9TA 4HLXA 2P6TA 1XGMA 1J2XA 2Y0MA 3LAPA 3DPLC 3CO7C 5D4SA 2CWEA 3RPQA 2ACJA 4XSXF 2O6GE 4YIIA 3T8RA 5CVJA 3I59B 5LGUA 1R5HA 4PDKA 3HSEA 4U7BA 1XMAA 3W6JB 4Q47A 5F64A 3GXOA 5CVUA 2HYGD 1XB4A 2OZUA 5HS8A 4A12A 1IN7A 2H94A 3LA3A 2HEOA 3L9FA 3IWZA 6PAXA 3E5UA 4KMFA 3ZP5A 3PQKA 3SHFA 3MEXA 2IT0A 5HLHA 1K78B 4ENNA 4EV0A 2QENA 2Q8KA 3DFGA 1QO0D 2UXNA 5FB2A 4Q48A 3EUHA 3WTTC 4KA4A 1P2FA 1GHCA 2HWVA 1FBSA 4KUMA 3BJAA 1T2KA 3LAJA 2MD5A 2DK5A 4EJWA 1ZG1A 1I5ZA 2XRNA 4LGWA 4EJVA 5E8IA 2F2EA 2VC1A 1SD7A 5FD6A 1ZREA 2BYVE 3TDUC 4LLNA 3R0JA 1VTNC 5K5RA 2O8XA 3KCCA 4M9SA 1IRFA 2ZXJA 4EGZA 4PGHA 2M30A 4OIQF 2GWRA 5K5OA 1UHMA 3N4MA 1T98A 5ICCA 2EWNA 3VEPA 1P4AA 1FP1D 1ZGAA 2JPBA 1W4MA 3SFZA 1K6OA 2STWA 1BOAA 3NQOA 2GZWA 2WTEA 1H0MA 2B0LA 3GFLA 2MC3A 2A68F 2VODA 4LMYA 3HUGA 3H3ZA 1Z6RA 1TNSA 5JVTA 1S7OA 4IHTA 3R0AA 4LG0A 2OQRA 4RS8A 2XAFA 3G73A 4KT5C 2OQGA 2DK8A 2F5FA 4ESBA 1R36A 2YPRA 1YW7A 2L4MA 4KMUX 2QM3A 2L3DA 5L3GA 3GW2A 4KYWA 1BN5A 1FX7A 3PQJA 4L0ZB 3ABTA 2DO7A 2GA2A 2D1HA 2CQKA 4LFUA 3N97A 3GFMA 2IP2A 3ECHA 4KIGA 1I1GA 1JXSA 1ZAOA 2NNNA 5L3EA 1Z1DA 1FSHA 1EH6A 1XSDA 3EYIA 4KFCA 1MJ9A 1R7JA 3RPUA 3V7RA 4ZYDA 3MZHA 1WQ2A 2K4JA 3VFZA 2NRAC 2J5PA 3K9TA 5JHUA 1EH7A 1QNTA 1LEBA 4HF1A 3MFKA 2STTA 2PQ8A 1H9GA 4B8XA 4P9FA 4KNYA 2V79A 5LHGA 3BOQA 5LGTA 4YFNF 1WKMA 4HAMA 5D5XB 5L3BA 1P4WA 4WK8F 3KP3A 4XLNF 2COMA 2RV8A 4G94A 5A2QK 3MZYA 1RUNA 3DPTA 2EFPA 1KYZA 1KU7A 5CLSA 2GQQA 1FBQA 3C1DA 1SMTA 2LDUA 5ILUA 5D5WB 4YFXF 4UVBA 4HF2A 4ZZLA
chains in the Genus database with same CATH superfamily
1U6GA 1Y8QB 2ZSHB 3I58A 1SANA 3JTHA 4N9IA 2JVAA 1WJDA 2DOFA 2XGXA 1YQAA 2DODA 2RQQA 4IRIA 2J5OA 1FNNA 5FRMA 1AKHA 2LBFB 2BHYA 1R22A 3OIOA 2R7UA 1JUPA 1WWXA 1HA8A 1IDZA 3J81Z 2FNPA 4PZJA 5LL6R 1JK1A 1X1BA 1FOYA 4DBQA 1WGXA 2V8QB 4FK5C 1BI0A 4KIFA 4Y15A 4A3GJ 3FWEA 1U0JA 1WJAA 3S17J 3ERED 3I64A 3SEQA 4ZTFA 2M8EA 3FK7A 1R49A 4A2UA 1CF7B 4XONA 1GT0C 3IWCA 4MLQA 2M7BA 4XLHA 2XAUA 3E6MA 3ZQFA 3B6AA 3ESWB 3HPHA 2EPAA 3HKZA 2B7VA 1ETYA 1OPCA 1F1ZA 2A05A 2GAUA 2Z9OA 2E35A 5IT9C 5ILSA 1V5EA 3T8TA 3CJTB 4XN0A 3T1BA 4A3BJ 3MCZA 2F5EA 2LNBA 2NXNB 2EM5A 3KP4A 4II3A 4MTDA 1ONVA 1A6QA 2E1NA 4WX9A 1MMDA 3BDDA 1MMSA 2XASA 2X51A 5J1RA 3ROUA 1U9OA 3ABUA 1P47A 1FTTA 4AVZA 2RREA 2WB1A 3L7WA 3BPVA 2PMUA 2LY1A 3RIRA 5KCMA 1F43A 4ASNA 3J7AY 3Q0UA 5TSEA 4DV3E 4ITVA 2EINH 3REOA 4CICA 3RKQA 2HGHA 4D7MA 1IW7F 5LLQA 3ZOQB 5HS7A 4KISA 3L00A 4DR5E 3HQ1A 1ZBQA 4H4KC 2J7JA 3VYYA 2EN6A 1Q1HA 2BHZA 3E3VA 3Q9SA 5T6JA 4N4OB 1X4PA 2O7OA 2M7AA 3G2BA 3LFKA 5FGMA 1P7IA 3ZCOA 3RMPA 2OD5A 1WJFA 1Y0UA 1LVAA 2EBIA 2HGCA 2ELZA 1WJEA 4AU7A 1HOMA 2B63J 3ZMDA 1AHDP 3ASOH 2ESHA 3I59A 4A0YA 5CKTA 2FOWA 4F9BB 4JI1E 1HW2A 1Y6IA 5E1ZB 2QQAA 2MABA 2WV0A 3VYXA 1LDJA 2JA6J 2F5VA 3CF2A 1RETA 3LA7A 2ME6A 3TGNA 1BA5A 2G9WA 2KL4A 3KETA 1J59A 1Y1VJ 4RAYA 4BQAA 1IRGA 4R8HA 1I1SA 2PMHA 4IRHA 3ZMSA 2K9NA 2QA4I 1XMKA 2X0LA 4OOGC 2XDVA 2L2KB 2EB7A 3M07A 4A5MA 3HOSA 1NK2P 4QSHA 4LF5E 5BR8E 4BBSJ 2R7WA 3A01A 3SZTA 4A6DA 5CVVA 3ZPLA 4BXUA 3AL0C 3AG2H 3KLOA 3TW7A 2IS4A 2DMUA 4M3BA 3N05A 3L2VA 2EH3A 1VF9A 2VBZA 1Z0XA 4IO9F 1UHWA 1BW6A 2BVMA 4Z2YA 1TTYA 5FKNA 2UXBE 2W00A 1PKPA 4DV2E 5AC4A 4CYDA 1PDAA 2NOJB 1MBGA 4DR7E 1ETKA 1JKQC 2R7QA 1K78A 4MEYF 2XF6A 2ECCA 2CSOA 2YX7A 3A03A 2H8RA 1OCTC 1WHUA 5IT9K 5FLXC 1FMVA 3BG9A 2QBYB 1X3ZB 2IBDA 5HLTA 1A1KA 4F93B 1IXRC 3HOWJ 4XN3A 2EQ3A 2CFXA 1BIBA 3K4KA 1XNRE 1Z21A 2Y9YA 1YYVA 4K2EA 2UUBE 3ZQGA 3OYHA 2P5VA 4YIRX 3TO9A 3I4NJ 1IN8A 2KDOA 4OIOF 1MZBA 1N77A 4B44A 5HS9A 3HOXJ 1R23A 2KRCA 2PEXA 4DJAA 5KL2A 5CVIA 1IZ1A 3VWBA 2YZTA 4XOPA 2WZOA 5AE3A 2PFBA 3WE2A 3MQ0A 3FBIB 2WC2A 2CGPA 2HI3A 4YG2F 2M1BA 1KQ0A 1ZRFA 4PJMA 1O0WA 2L54A 3NARA 2EMXA 5ICEA 2KMUA 1ZLKA 1S8NA 3HSRA 5D5UB 1LE8B 1LFUP 2V26A 2CFOA 4JOMA 4HX7A 4BEHB 2MSYA 1VQMI 1N33E 1LB2A 2DIXA 2C6YA 1F36A 2LT7A 2Q2EA 1OCCH 1R1UA 1R1TA 4NXNE 1YOVB 3R60A 2HDDA 1I3QJ 2LRSA 1F9NA 1DPRA 1JUSA 2Y31A 4XLCA 1YUIA 1ZELA 1SAXA 2L3CA 1TWHJ 1HNXE 3OIPA 2LSOA 4Z6YA 4JI4E 1HW5A 3HRSA 3V42A 3HGYA 1N75A 2ZJRF 3VHTB 1YRNB 3EETA 4X9JA 3LL7A 2F5CA 1TWFJ 1O7LA 1RPWA 2HS5A 3EPLA 4UV9A 1G8XA 1VQNI 2LYCA 4HX8A 2VXZA 4KZSA 3K1PA 3JAMC 2KOUA 2VQFE 3BJ6A 2VXDA 3EPZA 2FEZA 4LK1F 1R1VA 4DV0E 2MGQA 1ZRCA 1BJZA 2BEOA 2IGMA 5CVRA 2WY8Q 5B3SH 2K86A 2LMDA 5DNYA 4J8ZA 1MBFA 1XTAA 1BBGA 4EQQA 3ECRA 2IW5A 1X6EA 1E2XA 3HTSB 2FJ1A 3CP2A 2BY2A 1UCRA 3J7ZI 3I56I 4LF6E 4BQQA 5FLXK 4LJZF 1J7KA 3KYDB 2EL6A 4U7DA 2EOQA 2VE7C 1HSJA 3GMEA 4M2ZA 2PN6A 3C2BA 4L9TA 3RQIA 2UXCE 2HOAA 4QLCU 2Z33A 4E7JA 2CO5A 3KZYA 4G12A 3RJPA 1PJSA 2E71A 2VQGA 4NQWB 3IC7A 3OYMA 2GXAA 1GQEA 3BTJA 1ZR4A 5GP9A 4EM2A 3K7AJ 2LCEA 5E8GA 3V7CA 4WCGA 2HYFA 1GXPA 4JI6E 1BR1A 1IN6A 1N25A 3UKGA 3KP2A 3TP0A 2LRDA 1BC8C 1D8KA 2A6HF 4NB5A 2NA2A 2W85A 3MSWA 2FMLA 4ZH4F 3FHZA 3IH4A 2X6XA 5F04A 3S8PA 3SZPA 4YRVA 2FUG2 2HOTA 1DPUA 2K4VA 5K5QA 4WXCA 2CS3A 2JT1A 4R79A 1U5TA 2UXDE 2W7NA 3HXLA 2JTVA 5M5XJ 3JRCA 3PIPF 1T39A 3C6MA 4L9JA 1H89C 4N9HA 4LIUA 4BDZA 3L2WA 5LHIA 3VYRB 3R4KA 4RB3C 4ENKA 5F6FA 4FCYA 2CTDA 1RUOA 3BPXA 4JI7E 4O24A 5J1UA 4D1QA 4PUSA 3FMQA 2X48A 3W6KB 3FX3A 2MD0A 5C44J 2DMQA 3NWTA 4MQVA 2NVUB 3IKVA 4OMYA 2EMLA 2OV7A 3WU1B 1X1AA 4XLPF 1VQOI 3HPZA 1UG0A 1YS6A 2DYRH 2FMYA 2LMZA 3M99B 4A3CJ 1GUUA 4RAZA 2EM3A 3RYRA 1JUMA 3OOUA 3JAMK 4CYCB 3AUZA 3HRTA 2VN2A 1B59A 1AWCA 5DD4A 4FHTA 2PJRB 3TDZC 4QIWN 2GHFA 2ICWG 5EG0A 2EA2A 3PFIA 2JA8J 4TUIA 4A3KJ 2P7VB 3Q5FA 2Z5UA 4W1UA 4AYBN 3T1YE 2RGVA 3G1MA 2BY1A 1R4MB 4XICA 4XKBA 2GIZA 5ICGA 4HDUA 1IV6A 2OBPA 1LQ1A 4XKVA 2EMYA 2DOEA 1XG1A 5IYCJ 3L2UA 1A04A 4U88A 4ZZDA 2L9VA 3BQYA 1ZHFA 3QPSA 4FASD 2E2IJ 1MEYC 4Y17A 2HDWA 1R4NB 2VQLA 1X49A 1GVJA 4BBYA 3WTUC 3IWDA 5DYMA 2FBKA 2F48A 4LFAE 5IV8B 4X6AJ 2VRDA 3F72A 2KONA 3WTZA 3LSHA 1T38A 4I02A 1CQTA 3S1QJ 1I94E 4DV4E 4HBLA 4XK4A 2ZC2A 3OS2A 3H1CA 4MFDA 1HQCA 4A3LJ 1OQYA 4CCKA 4P55A 4WSGA 3DF8A 2XV4S 1WFXA 1RMDA 1BL0A 2HTSA 2OZ6A 1Y1WJ 2EOFA 2FU4A 1KU3A 1ON1A 1A1JA 5D5VB 1FIPA 1X2MA 3BG7A 1RC9A 4UUTA 2I8DA 4BE2A 1Z91A 5HODA 3F8CA 2LKPA 3BCAA 4M6XA 4GGGA 2XGDA 4JI8E 4RHBB 1HNZE 4I01A 2QF7A 2VB6A 1OMIA 2XHKA 2A69F 3H0DA 2EOOA 3VYUB 1WI9A 4UXNA 2H1KA 1T4LB 4X66E 1BI2A 2BOLA 2QQBA 3S3NA 2PMZN 1FYLA 2RC4A 3THNA 2KIUA 2HKOA 2RDPA 3IWFA 3CQZJ 1K79A 1FC3A 2WCC3 2EPLX 2E1MB 2HZDA 3BLYA 2V9KA 2X6WA 2YTIA 4ZYHA 4J19A 3LSPA 3JSOA 2UZKA 1VNDA 2DBBA 1YJWI 1W7PD 5F1JA 1A1GA 4K0KE 4MEXF 2L92A 3NWSA 3OYBA 2DTZA 1G59A 3JRBA 1YSAC 3NRVA 2L0KA 3HG9A 3ZMUA 5EEAA 2EPOA 3M9AA 1YYKA 4EVIA 2HPIA 2LE2A 5J8FA 2YU8A 1U5TC 1TP4A 2H6CA 3GFIA 2JP9A 2HC5A 4OIPF 2L9SA 3C2GA 3BIDA 4LITA 2OAZA 3ADIA 2M2EA 3WE3A 3OL4A 2EZKA 1EKZA 2YU5A 2EMHA 4G6DA 1B72B 2V85A 2P8TA 2W82A 4MLOA 4XIDA 2EJ4A 4XOTA 4YFKF 2R5ZB 1B69A 2K5CA 5JI6A 5HLIA 1IXCA 3S2HJ 1QZYA 3JTGA 1MNEA 2MA3A 1CF7A 2EWLA 2EZIA 1MJBA 2K3PA 3LOCA 4BBRJ 5L3CA 3MKZA 4OX9E 1U3EM 4L9NA 5C3EJ 5LMNE 1XCBA 2DFIA 2QWWA 2ZMEA 3CJNA 5CYVA 3JU0A 4V19K 4HG2A 4R03A 3H5AA 1FLIA 3CCEI 1DGWY 2M0MA 2LUQA 5D4RA 3I53A 3BGHA 3CC7I 3ABMH 2L7KA 4GXOA 1Z3XA 2XPWA 4X8WA 1MDMB 3GTOJ 2ZJQF 4RLFA 3AAFA 3CCVI 4MTEA 1REPC 2M8GX 5LGNA 2BE5F 4KWYA 5DCMB 1U2WA 3DWLE 2OC6A 1OYWA 2OUMA 1UBDC 1W5SA 1ZGJA 3WGIA 3FXLA 1EF4A 1OCZH 3GZNB 5DM6F 1P6RA 2MBFA 3BF2A 2HYJA 2LTPA 1PP7U 1S9HA 3HKZN 3UNGC 2LY2A 2EN8A 5TJJA 4MIMA 1B6AA 4JP0A 3WG7H 4B09A 4X0GA 3F6GA 1TNTA 4RB1A 5J40A 3A4CA 2QEXI 2QSFX 4BY1J 2B9SA 4NUBA 1R71A 3S3OA 2DPUA 3BZKA 4LFCE 1WJPA 4ZTJA 2IHR1 2N3HA 3QYBA 1W0TA 3FM3A 4NNJA 2CH0A 3H9GA 2HJJA 4XORA 1TWAJ 2YX4A 1DUXC 4WSPA 4F3QA 4RGRA 4I7HA 3LNQA 5KL5A 2RQPA 5LEKA 2WB1N 3FXQA 4BKXA 5HLGA 2L9RA 4BJ5C 2FE3A 3NAUA 5A2QC 2M45A 2E5LE 3EDPA 4M74A 3CTAA 3L2CA 3GTMJ 2YTOA 2R7SA 2EPRA 2AXLA 3GX4X 4JYAE 1KYWA 1YFHA 3PUBA 1DDNA 2EFOA 3EUHC 1YJ9I 2EMBA 4WWCA 4BQOA 3OYDA 3HRUA 4ZYAA 2JJ7A 2VONA 4DNCA 1PUFB 3ADLA 3DCFA 4ENMA 1QGPA 1W5CC 1QPIA 3CDIA 1WZ2A 5AE2A 5IOZA 5ICFA 3GTPJ 1X3UA 4EGYA 5TGTA 4XRSG 1D1CA 5HDKA 4MFEA 3L1PA 4EEFG 2DAOA 2IA0A 3SJMA 5F27A 4M3FA 1BR4A 2EM7A 4MLVA 4HPQA 3CCUI 1VQLI 4X1EA 2CT1A 2VBWA 4XRFA 1MNMC 4YELA 1GV2A 2A07F 2ME0A 1X47A 2B7TA 3C4TA 4DR4E 2Z1DA 4FE4A 5BQTA 4C2MJ 3SFIA 5DDGA 2QBYA 4Q28A 3GWZA 4HV6A 4OOIA 2VKEA 4IZZA 1O3QA 3F9KA 2EN2A 2RS7A 5LHHA 3KP7A 2YTEA 2DW4A 5D8LB 1KONA 2FXAA 1DQUA 4KN4X 1FZPB 1DGCA 2GXBA 1G3YA 4RMNA 5J47A 3AKZA 4P5OA 2G7UA 4DUZE 4L5JA 3KEOA 3PM1A 3J81C 3WTXC 3H0GJ 4ENJA 2LUPB 3GLXA 4AIHA 2E72A 4WYQB 2ZXWH 2K4BA 1ON2A 4GCVA 3ZN0A 2W25A 1JTXA 2ZMEC 1FOWA 3WGGA 1WRJA 3F23A 5K1YA 1PYVA 2DQLA 1GTKA 1A36A 1UZCA 2IRFG 3BTIA 4IRGA 3BP8A 2DA7A 1ODDA 2OU2A 4M73A 4GDFA 3HGGA 2PMZA 4A93J 5FKKA 2HOEA 2XKOA 4NZVA 4BEHA 3OMLA 1BI1A 2FD5A 3BT9A 3V4GA 2WAQA 2HOSA 4HRIA 1NG6A 2DMYA 1Z6TA 1YIOA 4JQFA 1R5GA 3AG1H 1VQ6I 1P4XA 2JN6A 5GAGJ 3OSGA 1G3WA 4WXHA 1K61A 4MHGA 1PP8F 1C0WA 2IA2A 1YS7A 1E3OC 4F9CB 1RC7A 1HSTA 2VJ4A 3F22A 1JJ6C 1J9IA 2EZ6A 1BM9A 1J5YA 1POGA 1ZBTA 1IF1A 4F55A 3OTOE 2YSPA 2YR2A 4P1WA 4F91B 2ELJA 1UELB 1XGOA 3CZ6A 4WXDA 2BZTA 4X62E 5J3LA 4OIRF 4AIDA 2DFEA 2X1CA 2EPCA 1ZG3A 3ZQLA 1S29A 3I5UA 2OPTA 1KQ9A 3BG6A 4BAYA 4XL9A 3QAHA 3OYAA 2DI3A 4EMSA 4HEIA 3PUFA 3RTRA 5D6EA 2CW7A 3CD6I 5KL6A 1R9TJ 4CGZA 3IH3A 4CSWA 5C4JJ 1IDYA 1F4KA 1UN6B 2MKDA 4Y33A 4D5CA 3I9V2 5KHDA 1YZ9A 3SYTA 3HOTA 1EV7A 2VT3A 1SC7A 3BG3A 1S7AA 1WI3A 2EA4A 3KEYA 2KKOA 5LRRA 2E2HJ 1TLHB 3GUDA 3KP5A 2BXZA 2XPVA 1G4DA 2P81A 4NQWA 1G3SA 2DA1A 4U87A 3E6CC 3S2WA 1IQSA 5ED4A 3KYLA 3BR5A 3GTQJ 1MJAA 1QRYA 2LBSB 1WH5A 1FKAE 2R0QC 2VKHA 3K69A 3PSIA 2TCTA 3F3XA 2E36A 2NS7A 3J81K 4R2AA 4UVAA 1MSEC 2DU9A 4BU2A 5CPRB 2OF7A 2IVMA 1PVEA 2EOIA 3QPTA 3OYKA 4BC9A 4DIQA 4FX4A 1T95A 2UV1A 1IXSB 3I4MJ 1VQPI 1OKRA 2PJPA 1K6YA 2ISZA 1S5LC 3TOAA 4B3TE 2HXOA 1N3GA 2DMIA 1P92A 1ULYA 2RS6A 1B4AA 2BGCA 3OYNA 3QPHA 2FRHA 5C4XJ 4G6TB 2MLKA 4M3DA 2R76A 4CCMA 4M3EA 1DGRM 1JT6A 2EOJA 2M4IA 3BTLA 3F8FA 2ENAA 1B9MA 1X1DA 3AG4H 1OLTA 3KLNA 5B1BH 4D0PA 1A35A 2VOPA 2R92J 2LTRA 4JV5E 1VQ8I 2YRHA 3O3KA 2DT6A 2K3FA 4GZNC 4H0EA 1Z77A 4B4CA 2MLGA 2XAQA 2GBYA 1KJKA 4MNUA 3CLOA 3IRQA 4F6MA 1JT0A 1V55H 1S3JA 2M5WA 1T33A 2LVSA 5EYRA 4EJUA 4IXAA 4O5GA 1NH3A 4R1HA 3V8KA 1MIJA 2EK5A 3OR2C 3DBHB 1QZEA 1G3TA 2W48A 2Y75A 2VBXA 4XQFA 2DFHA 3QOEA 4M6YA 4X64E 2W1OA 3TEDA 2LH9A 3HBLA 3GTLJ 1A1IA 2CUEA 2YSRA 4CCJA 4Q4ZF 4G9YA 1SEUA 3WU0A 2CU7A 4C3JJ 2LF7A 3RSNA 4JI0E 2XAHA 4E7IA 4GYIA 4XLEA 4CYCA 2XROA 4XLAA 2HVSA 5KL4A 2FTXB 2IEKA 2V89A 2EORA 3J80Z 2EE8A 2DPDA 1J26A 2E60A 4FT8A 1RZ4A 1IRXA 3RKYA 1R5ID 1KU9A 4PGGA 3DEUA 3OR1C 4O6JA 3HSFA 2ODRD 1GLNA 3MWMA 4LF8E 1NTCA 3KFWX 1F5TA 3IL2A 3FBNB 4FETA 3CCYA 4CXFA 5KL3A 1SFXA 4UUSB 3HUGB 3BG5A 3H36A 2R7ZJ 1B8IB 3E1SA 1HXDA 1BC7C 1SD5A 1SD4A 2JRMA 2L2MA 4IVNA 2P4WA 1SR9A 4R2DA 2NVQJ 2NNYA 2EP3A 3IAS2 4I0AA 1GV5A 4CDGA 2VLAA 1IO2A 3DPUA 4B43A 1T4OA 2JZYA 3LA2A 4JBAA 3OS0A 1YPNA 3BZCA 2EIKH 3GFJA 1N32E 2QSGX 4AVPA 2EV0A 4JX5A 4KICA 2ELYA 2YTFA 2NOGA 1QBJA 4ON0A 1AOYA 4RGXA 1DI2A 4NC8A 1V3FA 4BJ6C 2CQ7A 3WGHA 2XPUA 2YU9J 1OJLA 2GM4A 2WAEA 1WPKA 3ERMA 1FY7A 4UUVA 1IQOA 4Y4RA 3V8LA 3OMYA 2EN7A 1RI7A 2E7XA 4U0YA 3AG3H 3G6EI 3TO7A 4ZDPA 1WJCA 1ZYRF 1YO5C 2E1CA 1TW3A 4GO1A 2JOXA 1ETXA 4CHUA 2IS6A 2OA4A 2EJRA 3ONQA 1A1HA 3C2HA 2HZTA 4LLLA 2HU9A 1PDNC 5L3FA 1R6RA 3ZQHA 3EYYA 5A6BA 2ELHA 2DA2A 3W2WA 4Y7NJ 2WBMA 1HKSA 3IP4B 1KU2A 2FBIA 5BPIA 2I13A 4AWXB 2N8GA 3BTCA 3BR0A 1VFCA 2YUSA 3DQVC 1D8JA 2E1MA 1WCMJ 3A0BC 1NG7A 2K9LA 3DXJF 5GADJ 5FFXA 1BIAA 2VIXA 3H3UA 3OYFA 2W4SA 3QRFF 4B47A 2YU3A 5H6RA 2JA5J 4PJNA 2CMPA 1GVDA 3FZVA 4R2RA 2FBHA 2QQ8A 3P7NA 5LBQA 3F21A 2ETHA 3DLLF 2F6CA 3CCLI 3SDGA 1TF3A 1O3TA 1BR2A 4HSRA 4LK0F 3RI4A 5LFAA 2ECBA 1HKTA 3OYLA 2R3SA 4RAGA 3MKWB 2R5ZA 3KEQA 4BACA 3TQMA 2M3AA 3J7AO 3FXKA 2Y0SA 4JI2E 1LKXA 2D1VA 3E6DA 5DCFA 4DQ2A 2L02A 5BMZA 2D45A 1ERDA 2EN3A 2LO3A 2LR8A 5IYDJ 4CO8A 4KJZA 2KLOA 1FSEA 3H09A 4AC0A 2EMZA 2QQ9A 1IG7A 4DR1E 3DTIA 5FKOA 4ZYEA 5HVQC 2YWQA 1JKPC 3FKIJ 1LJ9A 4Y3OA 1NHAA 1RR7A 3K4JA 4BH9A 1A5JA 3EQ1A 2DA4A 2XB5A 2GLIA 3EPJA 1UJ8A 1Y0NA 2JSPA 5K7FA 2EMFA 4R2QA 3CCQI 1XMOE 2EM8A 1FJGE 3PNVA 2UUAE 3TL4X 2W57A 3BC8A 3K1MA 1U9NA 5DCMA 3QWLA 2ENCA 2CYYA 4OWRB 4DYQA 4DBRA 2L4AA 1ACIA 2CQNA 2Q0OA 3AL0B 2VASA 3ECOA 2HQAA 1APLC 3CDHA 2EFNA 4ETSA 2EIMH 2OTJI 1TBXA 4ZDOA 5GPAA 2DYSH 1FPQA 1ZTRA 3HIFA 3FM5A 1I50J 2VC0A 1OYYA 3KX2A 2A5WA 5FKLA 4PJLA 2M87A 5J8CA 4XMYA 2CQQA 4F52A 2RSMA 1OISA 1YYWA 3BROA 3P9KA 4L18B 2QCOA 3S15J 2VKVA 2HR3A 4E7LA 2W84A 1X1PA 1ZKGA 5L3DA 2HQRA 1YLFA 2JVHA 2W24A 4UHTA 2F4VE 1Z05A 2V1DA 1FTZA 4PK4A 1MBHA 3RPUD 2WA0A 2CW0F 4I09A 5B5EC 1ZLJA 2DQRA 3HJEA 1MBKA 3I4PA 1ITYA 5IP9J 1YW9A 2AQFA 3CCJI 2EPMX 1XMXA 1NCSA 4RGUA 1FEXA 2DFFA 2WWYA 2YTJA 1YUJA 4NXME 2VE8A 1DU0A 3H5NA 1W1WE 3M7GA 2X6YA 3EUKL 3GVAA 1TWCJ 2XAGA 1UMQA 2MW8A 3FXRA 1KQ8A 1QQIA 3QP6A 2BBYA 1PUFA 3K6GA 2MYSA 1Z7LA 2HVQA 3VPRA 1SVMA 3LQQA 2XC7A 4HDVA 4HQMA 2EMCA 3LFUA 1XNQE 4EM1A 4ZC3A 2XVCA 2E2JJ 2O3FA 3ZR8X 3ML6A 3GZ6A 3QU6A 5DD8A 3OL3A 1J09A 1AH5A 2ZCWA 5DM7F 3PNTA 3O8HA 4NC7A 1IN5A 3HYIA 4EJOA 2LY9A 2O8KA 1O57A 3GCMA 3K70C 2L9NA 1SVOA 2KIMA 3FXJA 3CLQA 4C3IJ 3I55I 4LOCA 5BS6A 4C9YA 4M9XA 2LK2A 3SXYA 4CA0A 2WY7Q 5DEQA 2Y48A 1Y56A 3LQRA 4CCNA 4IPAA 1W7PB 4E70A 1UFMA 4AD9A 1XDUA 1Z67A 1A1LA 1O7FA 3KZIC 1X3WB 3MVPA 4HSTA 1JGGA 3SEZA 4U0VA 3BQZA 3JAMZ 1O4XA 2YT4A 1D1AA 4B3RE 3WODF 4RM2A 3M3YJ 3KIOA 3S14J 2IGKA 2EIJH 2H6BA 1WVRA 3TOBA 2L8TA 3HTUA 4IQJA 5KK1A 2E1OA 3DKWA 2P6SA 3FXMA 5BPDA 5HDNA 1KGSA 2JPCA 4BMJA 3RZOJ 3CMEI 5CQEA 4G7HF 3HPGA 2ZNZA 3H9QA 4IS1C 4BHCA 4XKWA 2RN7A 3WG9A 1H8AC 1MH3A 1ZG5A 3CUQB 1P7JA 2V1XA 4HX4A 4LLGF 2L3JA 1I39A 4LIVA 3ZMTA 5EZGA 1STUA 3A02A 3FXUA 1BBOA 4HEA2 3WTYC 3LSRA 1Y8RB 4UB8C 1BB8A 3EUAA 2XUBA 1UHZA 3WTVC 2BB8A 2JUCA 3GF2A 3MN2A 4OMZA 5KL7A 4XM3A 3A01B 2VF1A 1BOBA 2KJBA 1TC3C 3TQNA 3K4NA 4O3MA 2ZKZA 4RBOA 2V86A 2ZJ2A 1ETOA 4EJTA 2ESNA 2M7QA 3ZGKA 2PLYA 1FOKA 3BZ6A 2IXSA 2LOOA 2DT7B 3M1EA 4XKCA 3JRHA 3U9GA 4F6NA 5FKMA 4CCOA 2PG4A 5HOOA 2V88A 4ZZLA 3DEWA 2MKNA 2X4HA 3J7YJ 1DP3A 2IS1A 4DR3E 1PJRA 2LP0A 4XBFA 2WAQN 2Y2ZA 4M71A 1GXQA 1YG2A 2MH9A 3S93A 1CGPA 4Y13A 3MHHC 4BS9A 4LB6B 3DBRB 1X48A 2ZSIB 3CCMI 2YSOA 4F7ZA 5AONA 5IPAA 1V54H 5DV5A 4C30A 1RIOH 3L2RA 4IF4A 4GFBA 4W97A 2LBFA 2ZXHA 1I6XA 1TL8A 2EV6A 9ANTA 3F8BA 3QU3A 5J4VA 1S6LA 4AQYE 3BJOA 1TW2A 4OAYA 3I54A 1M1EB 4O5VA 1T8IA 1YJNI 1ZU1A 3JRAA 1XGSA 3ABLH 4S04A 1YYOA 1K7AA 3F6VA 1WJ5A 2GXGA 1IC8A 4E7ZA 3K4CA 4Q35B 4IJDA 2M9AA 1B1BA 2JUGA 2NYXA 1QPMA 2KJCA 2NVXJ 1K83J 4JYKA 3K6QA 1O3RA 4DZJA 1ZR2A 2DA3A 4II2A 2CV2A 2M34A 4A3EJ 2L2NA 3DLAA 3ELKA 4JX4A 4LFBE 3V8JA 1XDSA 4WF2A 1G2DC 1ZAAC 2AXTC 3WTSC 2RTXA 5F1RA 2R7TA 4HA8A 3IV5A 4BUPA 2P7CB 3DJWA 2RVCA 2X6OA 2JSCA 2ZFWA 4Q5SF 4HV5A 2EQ1A 3CCRI 3RYPA 1MSFC 3HTXA 4AIKA 1EH8A 1E3HA 4YHHE 4UVCA 4UNOA 4HLYA 4XNFA 4HQEA 2KT0A 5JVGF 1RNLA 4B3XA 2R7RA 1MH4A 4BGDA 2WBUA 1RR8C 3QODA 1PUEE 5M5YJ 2KRFA 2DDBA 1WJBA 5IT3A 1STZA 1K4SA 1UB9A 1ZN2A 2V9VA 3C7JA 4IX7A 1T56A 2WV1A 2EMWA 2X85A 3ISPA 2EPNA 5GTIC 3E5QA 1YE9A 3ZQCA 2JRTA 2QUFA 2DCEA 3K0LA 2Y69H 4F92B 4IJAA 4IHXA 2X1DA 3Q9VA 3GTJJ 3K70D 4I99C 4UUSA 2MDGA 3TKYA 1T0FA 1FBUA 4BY7J 5IYBJ 1B8IA 4NBQA 1X19A 1I27A 2ISYA 5E1XA 4L0YB 1VQ9I 2JA2A 5J1YA 3CJRB 1XSVA 1OR7A 4FX0A 2L01A 1TQIA 3CDLA 3LSMA 2R5YB 1PJQA 4DV1E 2KFDA 2ELKA 3K4BA 3OYJA 2WAFA 1TQMA 3P9CA 3CO6C 2YTDA 4LTYA 4QPQA 4JI3E 1IUYA 5JLXA 1LDKB 3VYSB 3V7SA 1D3YA 3FISA 2DT5A 3WHCA 3P9IA 2ZJPF 4L9VA 1Z1BA 1D0YA 3AFHA 2DLQA 3LMMA 2DMPA 3JR9A 2EPZA 4KIBA 1U5TB 3JSPA 3LSJA 3K2ZA 3GZ5A 2A3SA 1V5FA 5IOYA 4ZJZA 3HM5A 5KVRA 2TDXA 1O3SA 4QPOA 3LSKA 3D5LA 4ESJA 1TWGJ 1YW8A 2EV5A 2LTSA 1LDDA 1HC8A 1D5VA 1IN4A 4R2EA 3EQLF 5M5WJ 2G7HA 3VYTB 2EQ0A 5K7ZA 2XAJA 2PBIA 4R2CA 1W5TA 4S05A 3J7Yp 2H36X 2LVHA 2DTRA 4DR6E 2QVOA 1OCRH 3VK6A 5E1WA 4WFTA 1IRZA 2XIGA 2FSWA 4BXFA 2ID3A 4IHVA 3I71A 1TN9A 1XD7A 2VE9A 2XB0X 1MBEA 3DTEA 2XF5A 3F0CA 4M6VA 5KNLA 1ZR9A 1T6SA 1IAWA 4BHBA 2EMGA 2VJ5A 3KP6A 4JI5E 3FK6A 2EPKX 2K7LA 2V7FA 1JTYA 1XSXA 2VQEE 4AIJA 1LE8A 4AM3A 1D1BA 3PJRA 5CQGA 3JCUC 4E6KG 3D1NI 1HKQA 5J6XA 2EILH 3BY6A 1YIJI 1E0EA 2F4IA 4HOBA 2EM9A 4P96A 4D7NA 3THOB 1Z7UA 3O6BB 5TRDA 2R1FA 4DV6E 4LD5A 2GOMA 1AU7A 3GTGJ 4C2UA 1G2FC 1G2HA 2VOOA 2QZ8A 1SFOJ 4DOZA 2MC5A 5EEGA 2HFHA 2DSYA 3C18A 2IGNA 5A2QZ 3FMRA 5EDNA 1YRNA 2ID6A 1IBKE 1LVKA 3BWGA 3CESA 2YRMA 2H1LA 2DGCA 3KWRA 3GO5A 3OY9A 1R00A 2LREA 2LD5A 3OYIA 3COAC 4IHSA 3B6CA 2FGGA 5AIQA 4ESFA 2LFBA 4WPYA 3D0SA 1FYMA 3HRMA 4S0HB 1MKMA 3FKJA 3FMSA 1XGNA 3VOEA 3H92A 2D9HA 4BYYA 2ZNYA 3W3CA 1D0XA 3RCOA 2YS9A 1LNWA 1S7EA 3O8GA 2QKLB 3IH2A 3FXOA 5FD5A 5CFFE 2RQLA 2KZVA 3VSLA 2Y0SN 4GYGA 3ZQ7A 4LB5A 2K27A 4MGRA 2R7DA 3DV8A 3A2KA 2XSDC 3J80C 2TRTA 4BE1A 2L5QA 2V87A 1N36E 4ZYGA 2MFZA 1IJWC 1T0FC 5ERIA 2EZLA 4I8OA 3PIOF 2M4KA 2FOKA 3CMMA 4RDUA 3GYHX 1MMNA 2EM2A 5E17F 3RQ4A 3C3WA 4NHJA 1JE8A 1RQ0A 2F4OB 3KZZA 2EPUA 2V6EA 5GPCA 2R93J 1OR7C 2GA1A 5DUKA 4A5NA 1X1CA 1ETVA 1JGSA 2V1NA 2E5NA 2F4MB 2LC2A 3F6OA 2Z16A 4RB2C 1E3PA 2V4JC 4QTRA 3JRFA 4KN7X 2VUMJ 5F0HA 4HTGA 4FQGA 2WADA 2HDCA 1QHHD 3G1LA 5GTHC 1WSUA 3K1NA 2IS2A 2LJHA 1JHFA 2BW3B 3WU2C 3DU6A 3HOZJ 1A31A 2UXXA 5EZHA 2GPIA 2OTLI 4D5FA 4RA2A 4I2OA 5HNHA 3OYGA 4A3MJ 2NS8A 1ZARA 3T5XA 1SFUA 1YHQI 1N34E 2RAEA 5K7HA 1ZQ3P 1DU6A 3SDBA 1SMYF 3L09A 1MW7A 1FP2A 2E19A 2IPQX 1XN7A 2ZMEB 4X65E 3U2RA 4PSWA 5E3MA 1HW1A 3A1YA 5D8KB 4YIFA 4EATA 2EQRA 2PI0A 2HQ5A 2DDAA 5AIPA 2I9IA 3Q0VA 3S3MA 2JPAA 3TO6A 2K9QA 4U0WA 4HYEA 4L5IA 1EA3A 3JW4A 1FYKA 5H20A 2D2WA 3B73A 1T08B 3B02A 3T0YA 4UV8A 1JJ8C 1YTYA 1S72I 2X1EA 3GEZA 5E18F 2O5RA 1Q1VA 1W7PA 2KDZA 2EL4A 2GIVA 2MC4A 2CQXA 2DA5A 2PJRA 3S2DJ 3TMOA 2LJUA 5A6AA 3JTZA 4PJ0C 3SZGA 2EOXA 4RGSA 2M0CA 4M0VA 1L0OC 1QHGA 2K85A 1OYIA 1SD6A 1USSA 1TT0A 3UR3C 1ZK8A 5B66C 4P9UA 2UUCE 2ADRA 2V6CA 3F8MA 3E97A 3MHSC 4JK1X 3J80K 3A0HC 2NUFA 4A0XA 5J4YA 1VQKI 5EF6A 3KE2A 3AV0A 3M8FA 4HNUA 3QG5C 1U8RA 5B1AH 2EOSA 4GKKE 4IHWA 3RZDJ 4G8XA 2VT2A 4LG0B 2O03A 2NS0A 3H35A 4C2TA 4R8OA 3FIWA 1BJAA 1D5YA 1B9NA 1LEAA 3OSFA 3Q3SA 3CUQA 3I0TA 5IWAE 1YX3A 2CJJA 2IA1A 3JREA 1VI0A 4I76A 4AUXA 3LWFA 3M8EA 4CZZA 1X6HA 3QYFA 1U8BA 4BC7A 3Q0WA 4QWQA 1L3LA 2R7VA 1FMWA 1XCVA 4KT6A 3IUOA 1J75A 2XKPA 3RDIA 3H9JA 2E7WA 1FIAA 3ZMZA 5JFRA 3MKLA 2EL5A 3SQNA 1ZH5A 4B3SE 1TQPA 3UK3C 2VJIA 3MZ8A 2JQ7A 3OV8A 3R61A 5IT9Z 2VQCA 4DV5E 2L7MP 2XRLA 1IV8A 3FDYA 1RESA 3RKXA 3VB2A 2IJLA 3OYCA 2EZHA 4CH7A 5FFZA 2BY3A 5FO5A 2JR1A 1SFEA 5FRNA 3CUOA 4OINF 4J01A 1U78A 1QZZA 2BV6A 4HW0A 3HDDA 3HHHA 5DUIA 5AASA 2Y9ZA 3TW6A 3OWTA 1R58A 3DP7A 3QOPA 3U1DA 3CF5F 2EPXA 3OOPA 2KHMA 1OFCX 4BNCA 2A5YB 5IP7J 2CRGA 5EGOB 3HC7A 4OU0A 2HTJA 2B3TB 2DJNA 2YTPA 2H09A 5JHFA 5F3WA 4I0BA 4CUGA 2AO9A 4KDPA 1QU3A 4O4KA 5TISC 1MMGA 2P0WA 3W2VA 3ZN1A 3ABKH 2RKHA 5E20A 3HOYJ 4LU9A 3W2AA 2HQNA 3FF5A 1B72A 1TZLA 3O2PE 2NUEA 4N0BA 3ULQB 4HNVA 1MMAA 2QSHX 2HVRA 2X9DA 2V83A 3M4OJ 4BHPA 1BI3A 3WTWC 2ZO4A 4G7ZF 4A3IJ 1ZRDA 3CC2I 1HR0E 1QA6A 5E3NA 3IHUA 4RLQA 3IRRA 2DMTA 2DLKA 5F0FA 3QQAA 5FLMJ 2EMIA 5M3FJ 5ADZA 2K02A 2RNJA 1FWZA 4XSZF 3I3LA 2HHHE 1QVUA 2KQRA 2Z99A 2NUGA 1KA8A 2E5ZA 2O0YA 2VBYA 1JHHA 5F08A 2FQ3A 1HDPA 2AHQA 1FT9A 2DMNA 1MDMA 3RKWA 4F2JC 4M9VC 2A6EF 2OJED 4IOAF 1HBXG 2MG4A 5LEJA 1MD0A 5LRSA 2EN1A 2G0EA 4PCQA 1SFKA 5CJ9A 4EM0B 3HHGA 1W0UA 4DYCA 4M72A 4HF0A 4DKKA 4MQ9F 4BE0A 4A6EA 2CV1A 5H2FC 4L8NA 4LG3A 1LFBA 3C4BA 1V4RA 4FISA 1G6NA 2R7OA 2XGCA 1RKTA 4RB0A 2HKXA 2IAIA 3S32A 2EFQA 1JI8A 2CUZA 2EM0A 1EKEA 5FLXZ 2FF4A 3E6BA 2UWMA 1GDTA 3R6SA 3W6VA 3G3ZA 5A6JA 4NHRA 3CUQC 3GTKJ 2ADUA 3HPSA 3ZQQA 3NEUA 1LLMC 3M8JA 2H27A 2Q1ZB 3DTKA 2CUJA 3F8NA 4DMIA 1XPXA 1AKHB 1X2NA 3VODA 1Z3YA 1W36C 1JK2A 2VPLA 2I5UA 5H6QA 2ZBKA 4N4RB 2CSHA 4XRMA 5AE1A 4DR2E 1HF0A 5LD2C 3K4LA 1DP7P 1XC5A 3IKTA 2CG4A 1I6HJ 1J0RA 2RNGA 3JRDA 3EPHA 3E5XA 2MC6A 3IWBA 2GOXB 5ILVA 3ZMVA 2P5KA 2L6MA 2KIFA 5JR3A 3LSTA 2Z3YA 4IOCF 5BOXA 3E7LA 3MAJA 5M3MJ 1E17A 2A6TA 1BBYA 2R7FA 4M9ZA 3BCBA 2V1UA 2YTGA 2P5LC 2F5DA 5EEHA 3BBGA 3S16J 2QYOA 2M9HA 4A0ZA 2BXYA 2R5YA 4UB6C 2COBA 4ZDLA 3MD2A 1HLVA 2MH2A 2RSIA 4HZFA 1P9QC 3EPKA 2BY0A 3MMYB 1TF6A 3LSGA 2DLLA 3CMAI 2A61A 5E3OA 2E1MC 1USTA 4NC6A 1X4OA 5D6FA 3CCSI 4G6QA 2CPNA 4JX6A 1ORKA 1PJTA 3ASNH 1H88C 4GRIA 2LF8A 2NAZA 5BNGA 2EFWA 2WBTA 2EM4A 1Z9CA 1ETQA 5HDGA 2FNAA 2XSJC 3QP5A 4BCAA 4TV7A 4I98B 2AS5F 4OAZA 2YTQA 2FA5A 3DKXA 1UG2A 4G7OF 2YTNA 1MGTA 1V5GA 2O61A 2QLZA 2Q8UA 2KRHA 1X58A 1H9TA 3K4MA 4HLXA 2P6TA 1XGMA 2N3GA 4TUGA 1J2XA 2Y0MA 3LAPA 2F8BA 3DPLC 3CO7C 5D4SA 4A3FJ 2XF7A 2CWEA 2AQEA 3RPQA 4BDYA 2NABA 3K2AA 2ACJA 2CUFA 4IHYA 4XSXF 2LG4A 3PFYA 1WHNA 5IY5H 2O6GE 3T1HE 4YIIA 4LF9E 1RKWA 3T8RA 5CVJA 3D5SC 4IEJA 2OCCH 3I59B 3ZOBA 5LGUA 3QPLA 3G4SI 1R5HA 2LKXA 4PDKA 4E7SA 4LF4E 1YX5A 2EMAA 2VQHA 3HSEA 2PRTA 2PX9A 4U7BA 4RM3A 1T4NA 1XMAA 3W6JB 4F54A 4Q47A 5F64A 1IBLE 3GXOA 2DRPA 2EMKA 5CVUA 4CZCA 2EPFA 1HNWE 2L7ZA 2LV2A 2BVLA 3F6HA 2HYGD 3LLHA 3BR3A 1XB4A 1BW5A 4L5EA 2OZUA 1KZHA 4A69C 4DGWB 5HS8A 4A12A 1IN7A 2H94A 3LA3A 3LSIA 2ZFUA 2HEOA 3L9FA 5FLVA 5FROA 1X3CA 3IWZA 6PAXA 3E5UA 1UAAA 4Y52J 2ENHA 4KMFA 3CP8A 1N78A 3ZP5A 1NEIA 3PQKA 3SHFA 4P78A 4J00A 3MEXA 2IT0A 5HLHA 4O43A 1K78B 4ENNA 2JXPA 2DXIA 4EV0A 2QENA 2Q8KA 3PO3J 3DFGA 1QO0D 2UXNA 5FB2A 4A3JJ 3DBLB 4Q48A 5E3LA 4B3AA 3ZXSA 3EUHA 1D0ZA 3HEFA 3WTTC 4KA4A 1P2FA 3QYEA 1GHCA 2HWVA 2JWOA 3ADGA 3M1CA 2MDRA 4ABZA 1FBSA 4IL6C 2HNHA 2K40A 4XR6A 4KUMA 3BJAA 2Y30A 3CJQB 1A1FA 2LKSA 1Y39A 3L2QA 2FV4B 1T2KA 1JKRC 3LAJA 2MD5A 2EOYA 3DF6A 2DK5A 1XS9A 2XGEA 1X5WA 5FJ8J 4EJWA 4R2PA 4BL0B 2GLOA 1ZG1A 1I5ZA 2XRNA 3U1KA 3HZJA 4LGWA 2I10A 2H8WA 1DQ3A 1RRJA 2CW8A 3G1OA 4EJVA 5E8IA 2F2EA 2VC1A 3H3VK 1UILA 3VDXA 4FTHA 2B9DA 1SD7A 5FD6A 1ZREA 3C6KA 2BW3A 2BYVE 2KIQA 3ZQIA 4GKJE 4IQ4A 4C3HJ 1A6IA 2Q2EB 1IBME 3TDUC 4P7DA 2VJJA 4LLNA 3R0JA 1VTNC 5DTDA 2JMWA 5JLWA 3U21A 5K5RA 4E4HA 1LPQA 2O8XA 3KCCA 4M9SA 1IRFA 4PSXA 4PJJA 2BBGA 2EOEA 2ZXJA 1ENHA 4EGZA 3KYCB 4PGHA 2M30A 1W36D 4OIQF 2GWRA 5K5OA 4DUYE 1UHMA 3H5RA 3ADJA 5A69A 2B7EA 2QGUA 4L5NC 4HNTA 1X6FA 3PL8A 3KPHA 3N4MA 3TP3A 1T98A 1KYQA 5ICCA 2RPCA 2EWNA 3VEPA 4D9JA 3X2QH 4E7KA 4PFOA 1P4AA 2IGOA 3HOUJ 2UU9E 1FP1D 1ZGAA 2JPBA 4NDLA 2WBSA 2ZXIA 2R7XA 1W4MA 3JRIA 1OCPA 1K4TA 3SFZA 1K6OA 2YRKA 2VL8A 3WHBA 2M1SA 1OCOH 4MO7A 5DS9A 5A6BD 5LMUE 2STWA 1BOAA 3NQOA 2GZWA 4N4NB 3S1NJ 4PFPA 3P1XA 2WTEA 1SAUA 1H0MA 2L33A 2B0LA 1L4SA 1QVTA 4IKFA 3GFLA 2MC3A 3P5JA 4XLFA 2A68F 1NK3P 2VODA 4LMYA 3HUGA 3H3ZA 1Z6RA 4ANJA 3S1MJ 1TNSA 5JVTA 3J7AG 1S7OA 4XRSA 4B3ME 2HXIA 1VQ7I 4IHTA 2JA7J 3R0AA 2EOHA 2EN4A 2ZB9A 2DJIA 4V2GA 1LUJB 4LG0A 2L7FP 3VSKA 4DZPA 5KAFC 1I3AA 2OQRA 3OS1A 2E34A 4RS8A 4LF7E 1IMUA 2XAFA 4B1RA 3G73A 2JY9A 4KT5C 2OQGA 1VQ5I 5F0CA 5A6KA 4FE7A 1AAYA 3DU5A 2DK8A 2F5FA 5KAIC 2K7IA 3TBIA 4DYRA 4ESBA 1R36A 3HL2A 1UHSA 2YPRA 1YW7A 2L4MA 4KMUX 2QM3A 3K10A 2L3DA 3D5RC 5L3GA 3MKYB 3GW2A 4BXXJ 4KYWA 2ZM6E 1BN5A 1MBJA 1FX7A 1SVLA 2KP6A 3PQJA 4M3GA 4L0ZB 4R2SA 2L2OA 2DO7A 1LFPA 3ABTA 4DW6A 2GA2A 2D1HA 2VI6A 4M30A 2VKDA 3GLLA 2CQKA 4AYBA 4LFUA 2ODRC 3N97A 3GFMA 1QU6A 2IP2A 4BJTA 3ECHA 3OIQA 4KIGA 2YPNA 1IUFA 1I1GA 1JXSA 1ZAOA 2JWTA 2NVYJ 2NNNA 1ZGWA 2KISA 5L3EA 1FOXA 5IXMB 1Z1DA 4F9AB 4A3DJ 1TT5B 1FSHA 1EH6A 3FIGA 2VPRA 5GAHJ 1XSDA 4DV7E 3DKYA 2M4GA 1MNDA 2K9SA 3EYIA 3BR6A 5EG0B 5EGOA 4KFCA 1MJ9A 4YY3E 2QKMB 1R7JA 1HDDC 3RPUA 3HOVJ 3V7RA 4ZYDA 1VQ4I 3MZHA 2KHXA 1WQ2A 1ETWA 2K4JA 4YEJA 2K9MA 2J5PA 3K9TA 3VFZA 2NRAC 4GEQB 5JHUA 1EH7A 1QNTA 2NVTJ 1LEBA 2FX0A 4HF1A 1XMQE 3MFKA 2KZGA 2STTA 4BQNA 3CMYA 5EJCA 3CC4I 2KPMA 3DEEA 4B48A 2PQ8A 1H9GA 1JKOC 4B8XA 5GAEJ 4P9FA 1YI2I 4KNYA 2V79A 5LHGA 2JOBA 2A25A 2JK3A 3BOQA 5LGTA 3BR2A 3FHNA 4YFNF 1WKMA 5E79C 2CV0A 3E0JB 2EM6A 4HAMA 5D5XB 1FJLA 2EPPA 5L3BA 3JRGA 2R4GA 1YITI 1P4WA 2HPMA 4WK8F 2FQ4A 3IAM2 1J5EE 3KP3A 3ZRGA 2DA6A 2COMA 2RV8A 4XLNF 1WHQA 2EOMA 2LLKA 4G94A 3PSFA 4KITB 5A2QK 3OYEA 3PNYA 3MZYA 4V2FA 1RUNA 3DPTA 2N8XA 2JVGA 2UUZA 4KHPE 1WH7A 2EFPA 2D5VA 2DB2A 1KYZA 1KU7A 2Z2SB 5CLSA 1XX5A 2GQQA 1FBQA 2V9PA 3G71I 2DN0A 5IP6A 3HB9A 3C1DA 4I6ZA 3S1RJ 4E7HA 4RH8A 5HNFA 3PO2J 3LMLA 1SMTA 1EJ9A 5AC5A 1WXRA 2LDUA 5ILUA 2EOZA 4UY8I 5D5WB 4YFXF 2O9LA 2OCEA 1GZ6A 1F2IG 4UVBA 4CCLA 1IGNA 3GBGA 1HCRA 4RAFA 1VZ0A 2JYAA 4HF2A 2DOAA 3BR1A 1AA7A
chains in the Genus database with same CATH topology
1U6GA 3I58A 3JTHA 4N9IA 2XGXA 1YQAA 4IRIA 2J5OA 1FNNA 1R22A 1WWXA 3J81Z 2FNPA 4PZJA 1BI0A 4KIFA 4Y15A 3FWEA 3ERED 3I64A 2M8EA 4A2UA 1CF7B 3E6MA 1OPCA 1F1ZA 2GAUA 2Z9OA 5ILSA 3T8TA 3T1BA 3MCZA 2F5EA 2LNBA 3KP4A 4MTDA 1ONVA 2E1NA 4WX9A 3BDDA 2XASA 3ROUA 3ABUA 3L7WA 3BPVA 2PMUA 3RIRA 4ASNA 3REOA 4CICA 1IW7F 5LLQA 5HS7A 3L00A 1Q1HA 3E3VA 3Q9SA 3LFKA 5FGMA 2OD5A 1Y0UA 1LVAA 2HGCA 3ZMDA 3I59A 2ESHA 4A0YA 1HW2A 5E1ZB 2QQAA 2WV0A 1LDJA 3LA7A 3TGNA 2G9WA 3KETA 1J59A 4BQAA 4RAYA 1IRGA 4R8HA 1I1SA 2PMHA 4IRHA 3ZMSA 1XMKA 2X0LA 2EB7A 4A5MA 3HOSA 3SZTA 4A6DA 5CVVA 3ZPLA 4BXUA 3KLOA 2VBZA 1UHWA 4Z2YA 1TTYA 4CYDA 1K78A 4MEYF 2CSOA 2YX7A 5IT9K 2QBYB 1IXRC 2CFXA 1BIBA 1YYVA 4K2EA 2P5VA 3TO9A 1IN8A 4OIOF 1MZBA 5HS9A 1R23A 2PEXA 5CVIA 1IZ1A 2PFBA 3WE2A 3MQ0A 2WC2A 2CGPA 4YG2F 2M1BA 1KQ0A 1ZRFA 2L54A 5ICEA 1ZLKA 1S8NA 3HSRA 5D5UB 4HX7A 1LB2A 2C6YA 2Q2EA 1R1TA 1R1UA 3R60A 1F9NA 1DPRA 1SAXA 2LSOA 1HW5A 3HRSA 3EETA 2F5CA 1O7LA 2HS5A 4UV9A 4HX8A 2VXZA 3K1PA 3BJ6A 2FEZA 4LK1F 1R1VA 1ZRCA 2BEOA 5CVRA 2K86A 4EQQA 2IW5A 1E2XA 3HTSB 1UCRA 5FLXK 4LJZF 1J7KA 4U7DA 1HSJA 2PN6A 4L9TA 4QLCU 2Z33A 2CO5A 3KZYA 3RJPA 3IC7A 4EM2A 5E8GA 3V7CA 4WCGA 2HYFA 1GXPA 1IN6A 3KP2A 1BC8C 1D8KA 2A6HF 4NB5A 2W85A 2FMLA 4ZH4F 3FHZA 3SZPA 1DPUA 5K5QA 4WXCA 4R79A 2JT1A 1U5TA 1T39A 2JTVA 4L9JA 4N9HA 5LHIA 4ENKA 3R4KA 4RB3C 5F6FA 1RUOA 3BPXA 3FMQA 3W6KB 3FX3A 4MQVA 4OMYA 3IKVA 3WU1B 4XLPF 1YS6A 2FMYA 4RAZA 3RYRA 3JAMK 3HRTA 2VN2A 1B59A 1AWCA 5DD4A 4FHTA 3TDZC 2EA2A 3PFIA 2P7VB 3Q5FA 2Z5UA 2RGVA 4HDUA 5ICGA 2OBPA 1LQ1A 1A04A 4U88A 4ZZDA 1ZHFA 4Y17A 1GVJA 3WTUC 5DYMA 2FBKA 3F72A 3WTZA 1T38A 4I02A 4HBLA 1HQCA 4P55A 3DF8A 2XV4S 2HTSA 2OZ6A 2FU4A 1KU3A 1ON1A 5D5VB 1Z91A 3F8CA 2LKPA 4M6XA 4GGGA 4I01A 1OMIA 2XHKA 2A69F 1WI9A 4UXNA 1BI2A 2QQBA 1FYLA 2RC4A 2KIUA 2HKOA 2RDPA 3IWFA 1K79A 1FC3A 4ZYHA 3JSOA 2UZKA 2DBBA 1W7PD 4MEXF 3NRVA 3ZMUA 3M9AA 4EVIA 5J8FA 1U5TC 2H6CA 3GFIA 4OIPF 2OAZA 3WE3A 4G6DA 2P8TA 4YFKF 5JI6A 5HLIA 1IXCA 1QZYA 3JTGA 1CF7A 2MA3A 1MJBA 5L3CA 1U3EM 4L9NA 1XCBA 2DFIA 2QWWA 2ZMEA 3CJNA 5CYVA 1FLIA 5D4RA 3I53A 4GXOA 1MDMB 3AAFA 4MTEA 1REPC 5LGNA 2BE5F 5DCMB 1U2WA 1OYWA 1W5SA 1ZGJA 3WGIA 1P6RA 2MBFA 1PP7U 5TJJA 1B6AA 4B09A 1TNTA 4RB1A 2DPUA 3FM3A 2YX4A 1DUXC 4RGRA 4I7HA 2RQPA 5LEKA 3FXQA 5HLGA 2FE3A 2M45A 3EDPA 4M74A 3CTAA 3L2CA 2AXLA 3GX4X 1KYWA 1YFHA 1DDNA 2EFOA 4WWCA 3HRUA 2VONA 4DNCA 4ENMA 1QGPA 5ICFA 1X3UA 4EGYA 5HDKA 2DAOA 2IA0A 2VBWA 4XRFA 2A07F 5BQTA 5DDGA 2QBYA 3GWZA 4HV6A 4OOIA 1O3QA 5LHHA 3KP7A 2DW4A 5D8LB 2FXAA 4KN4X 1FZPB 2GXBA 1G3YA 4P5OA 2G7UA 4L5JA 3KEOA 3WTXC 4ENJA 3GLXA 4AIHA 2K4BA 1ON2A 4GCVA 3ZN0A 2W25A 3WGGA 1WRJA 3F23A 5K1YA 2DQLA 2IRFG 4IRGA 3BP8A 1ODDA 2OU2A 4M73A 2HOEA 2XKOA 1BI1A 3V4GA 1Z6TA 1YIOA 4JQFA 1R5GA 1P4XA 1G3WA 4WXHA 4MHGA 1PP8F 1C0WA 2IA2A 1YS7A 1HSTA 3F22A 1J9IA 1BM9A 1J5YA 1IF1A 2YR2A 1XGOA 4WXDA 4OIRF 1ZG3A 1S29A 3I5UA 1KQ9A 4BAYA 3QAHA 2DI3A 4EMSA 3RTRA 5D6EA 4CGZA 1F4KA 3HOTA 1EV7A 2VT3A 1S7AA 2EA4A 2KKOA 5LRRA 1TLHB 3GUDA 3KP5A 1G4DA 4NQWA 1G3SA 3E6CC 3S2WA 5ED4A 1MJAA 3K69A 3F3XA 3J81K 4UVAA 2DU9A 2IVMA 3QPTA 4FX4A 1IXSB 2PJPA 1OKRA 2ISZA 3TOAA 1P92A 1ULYA 1B4AA 2BGCA 3QPHA 2FRHA 2MLKA 3F8FA 1B9MA 4D0PA 3KLNA 2VOPA 3O3KA 4H0EA 2MLGA 2XAQA 4MNUA 3CLOA 3IRQA 1S3JA 2M5WA 4EJUA 4IXAA 4R1HA 3V8KA 2EK5A 1G3TA 2Y75A 2VBXA 4M6YA 2YSRA 4Q4ZF 4G9YA 3WU0A 2LF7A 2XAHA 4GYIA 2XROA 3J80Z 2DPDA 4FT8A 1RZ4A 3RKYA 1KU9A 4PGGA 3DEUA 4O6JA 3HSFA 3MWMA 3KFWX 1F5TA 3IL2A 4CXFA 1SFXA 1HXDA 1BC7C 1SD5A 1SD4A 4IVNA 2P4WA 2NNYA 4CDGA 4I0AA 2JZYA 3LA2A 4JBAA 3GFJA 4AVPA 2EV0A 4KICA 1QBJA 4ON0A 1AOYA 4RGXA 1V3FA 3WGHA 1FY7A 4UUVA 3V8LA 1RI7A 2E7XA 4U0YA 3TO7A 1YO5C 1ZYRF 2E1CA 1TW3A 4GO1A 4CHUA 2OA4A 2EJRA 2HZTA 4LLLA 1PDNC 5L3FA 3EYYA 2ELHA 1HKSA 1KU2A 2FBIA 5BPIA 4AWXB 1D8JA 3DQVC 3DXJF 5FFXA 1BIAA 3H3UA 3QRFF 2YU3A 5H6RA 3FZVA 2FBHA 3P7NA 5LBQA 3F21A 2ETHA 1O3TA 4LK0F 3RI4A 1HKTA 2R3SA 3KEQA 3J7AO 2D1VA 3E6DA 5DCFA 4DQ2A 2L02A 5BMZA 2D45A 4CO8A 1FSEA 2QQ9A 4ZYEA 5HVQC 1LJ9A 1NHAA 4BH9A 2W57A 3K1MA 5DCMA 2CYYA 2L4AA 2Q0OA 3ECOA 3CDHA 2EFNA 4ETSA 1TBXA 1FPQA 3HIFA 3FM5A 2VC0A 1OYYA 2M87A 5J8CA 3BROA 3P9KA 4L18B 2HR3A 2W84A 5L3DA 2HQRA 1YLFA 2W24A 4UHTA 1Z05A 2V1DA 2CW0F 4I09A 1ZLJA 2DQRA 3I4PA 1YW9A 4RGUA 2WWYA 2VE8A 3M7GA 3GVAA 2XAGA 3FXRA 1KQ8A 1QQIA 3QP6A 2BBYA 3LQQA 4HDVA 4HQMA 4EM1A 2XVCA 2O3FA 3ML6A 3GZ6A 3QU6A 5DD8A 2ZCWA 1IN5A 3HYIA 4EJOA 1O57A 2KIMA 5BS6A 4M9XA 3SXYA 5DEQA 2Y48A 3LQRA 4IPAA 1W7PB 4E70A 1UFMA 4AD9A 1XDUA 1O7FA 4U0VA 3JAMZ 3WODF 2H6BA 3TOBA 3HTUA 5KK1A 3DKWA 2P6SA 5BPDA 5HDNA 1KGSA 2JPCA 4G7HF 2ZNZA 4BHCA 3WG9A 2RN7A 1ZG5A 3CUQB 2V1XA 4HX4A 4LLGF 3ZMTA 3FXUA 3WTYC 2XUBA 3WTVC 3GF2A 4OMZA 2KJBA 3TQNA 4O3MA 2ZKZA 2ZJ2A 4EJTA 2ESNA 2PLYA 1FOKA 3BZ6A 3M1EA 3U9GA 2PG4A 5HOOA 2X4HA 4XBFA 4M71A 1GXQA 1YG2A 2MH9A 1CGPA 4Y13A 4LB6B 4F7ZA 5AONA 5DV5A 1RIOH 4IF4A 1I6XA 2EV6A 3F8BA 3QU3A 1S6LA 3BJOA 1TW2A 3I54A 4O5VA 1XGSA 4S04A 1K7AA 3F6VA 2GXGA 1B1BA 2NYXA 1QPMA 2KJCA 1O3RA 3ELKA 3V8JA 1XDSA 4WF2A 3WTSC 5F1RA 4HA8A 2P7CB 2RVCA 2JSCA 2ZFWA 4Q5SF 4HV5A 3RYPA 4AIKA 1EH8A 4UVCA 4UNOA 4HLYA 4HQEA 1RNLA 1PUEE 2KRFA 5IT3A 1STZA 1UB9A 1ZN2A 2V9VA 3C7JA 3ISPA 3E5QA 2JRTA 2QUFA 3K0LA 4IJAA 3Q9VA 3TKYA 1T0FA 1FBUA 1I27A 2ISYA 5E1XA 4L0YB 1XSVA 1OR7A 4FX0A 2L01A 1TQIA 1TQMA 3P9CA 3CO6C 1IUYA 1LDKB 3V7SA 1D3YA 2DT5A 3P9IA 4L9VA 4KIBA 1U5TB 3JSPA 3K2ZA 3GZ5A 2A3SA 5KVRA 2TDXA 1O3SA 3D5LA 4ESJA 1YW8A 2EV5A 1LDDA 1D5VA 1IN4A 3EQLF 2G7HA 2XAJA 2PBIA 1W5TA 4S05A 2DTRA 2QVOA 5E1WA 2XIGA 2FSWA 3I71A 1XD7A 2VE9A 1T6SA 1IAWA 4BHBA 3KP6A 2K7LA 1XSXA 4AIJA 1HKQA 5J6XA 3BY6A 4HOBA 4P96A 1Z7UA 3O6BB 5TRDA 4LD5A 2VOOA 2QZ8A 5EEGA 2HFHA 3C18A 5A2QZ 3FMRA 3BWGA 3GO5A 1R00A 3COAC 4IHSA 5AIQA 4ESFA 3D0SA 1FYMA 3HRMA 1MKMA 3FMSA 1XGNA 3VOEA 3H92A 4BYYA 2ZNYA 1LNWA 5FD5A 4LB5A 4GYGA 3ZQ7A 2K27A 4MGRA 2R7DA 3DV8A 4ZYGA 5ERIA 2FOKA 3GYHX 5E17F 3C3WA 4NHJA 1JE8A 3KZZA 2GA1A 5DUKA 4A5NA 1JGSA 3F6OA 4RB2C 4KN7X 2HDCA 1WSUA 3K1NA 1JHFA 2UXXA 4I2OA 1ZARA 3T5XA 1SFUA 1SMYF 3L09A 1FP2A 2IPQX 1XN7A 2ZMEB 3U2RA 1HW1A 5D8KB 4YIFA 2PI0A 5AIPA 3TO6A 4U0WA 4HYEA 4L5IA 3JW4A 1FYKA 5H20A 2D2WA 3B73A 3B02A 3T0YA 4UV8A 1YTYA 3GEZA 5E18F 1W7PA 2GIVA 4RGSA 1L0OC 1OYIA 1SD6A 1USSA 4P9UA 2V6CA 3F8MA 3E97A 4JK1X 3J80K 4A0XA 3KE2A 3M8FA 1U8RA 4G8XA 2VT2A 4LG0B 2O03A 2NS0A 1BJAA 1B9NA 1LEAA 3CUQA 3I0TA 2IA1A 3LWFA 3M8EA 4CZZA 4QWQA 1L3LA 1XCVA 1J75A 2XKPA 3RDIA 2E7WA 3ZMZA 5JFRA 3SQNA 1ZH5A 1TQPA 3OV8A 3R61A 5IT9Z 3RKXA 3VB2A 2IJLA 5FFZA 5FO5A 1SFEA 3CUOA 4OINF 1U78A 1QZZA 2BV6A 4HW0A 3HHHA 5DUIA 1R58A 3DP7A 3QOPA 3U1DA 3OOPA 4BNCA 2A5YB 4OU0A 2HTJA 2H09A 4I0BA 4KDPA 3ZN1A 2RKHA 5E20A 2HQNA 3FF5A 3O2PE 4N0BA 3ULQB 4BHPA 1BI3A 3WTWC 2ZO4A 4G7ZF 1ZRDA 3IHUA 3IRRA 2K02A 2RNJA 1FWZA 4XSZF 2Z99A 1KA8A 2O0YA 2VBYA 1JHHA 2FQ3A 1FT9A 1MDMA 3RKWA 2A6EF 1HBXG 5LEJA 5LRSA 1MD0A 4PCQA 5CJ9A 4EM0B 3HHGA 4M72A 4HF0A 4MQ9F 4A6EA 1V4RA 1G6NA 4RB0A 2HKXA 2EFQA 5FLXZ 2FF4A 3E6BA 2UWMA 3R6SA 3G3ZA 3CUQC 2ADUA 3NEUA 2H27A 3F8NA 3VODA 5H6QA 2ZBKA 1DP7P 3IKTA 2CG4A 1J0RA 3E5XA 5ILVA 3ZMVA 2P5KA 2KIFA 5JR3A 3LSTA 2Z3YA 5BOXA 3MAJA 1E17A 4M9ZA 1BBYA 2R7FA 2V1UA 2P5LC 2F5DA 5EEHA 2QYOA 4A0ZA 2MH2A 4HZFA 2DLLA 2A61A 1USTA 5D6FA 4G6QA 2LF8A 2NAZA 2EFWA 1Z9CA 5HDGA 2FNAA 3QP5A 4TV7A 4I98B 2AS5F 2FA5A 4G7OF 1MGTA 2O61A 2QLZA 1H9TA 4HLXA 2P6TA 1XGMA 1J2XA 2Y0MA 3LAPA 3DPLC 3CO7C 5D4SA 2CWEA 3RPQA 2ACJA 4XSXF 2O6GE 4YIIA 3T8RA 5CVJA 3I59B 5LGUA 1R5HA 4PDKA 3HSEA 4U7BA 1XMAA 3W6JB 4Q47A 5F64A 3GXOA 5CVUA 2HYGD 1XB4A 2OZUA 5HS8A 4A12A 1IN7A 2H94A 3LA3A 2HEOA 3L9FA 3IWZA 6PAXA 3E5UA 4KMFA 3ZP5A 3PQKA 3SHFA 3MEXA 2IT0A 5HLHA 1K78B 4ENNA 4EV0A 2QENA 2Q8KA 3DFGA 1QO0D 2UXNA 5FB2A 4Q48A 3EUHA 3WTTC 4KA4A 1P2FA 1GHCA 2HWVA 1FBSA 4KUMA 3BJAA 1T2KA 3LAJA 2MD5A 2DK5A 4EJWA 1ZG1A 1I5ZA 2XRNA 4LGWA 4EJVA 5E8IA 2F2EA 2VC1A 1SD7A 5FD6A 1ZREA 2BYVE 3TDUC 4LLNA 3R0JA 1VTNC 5K5RA 2O8XA 3KCCA 4M9SA 1IRFA 2ZXJA 4EGZA 4PGHA 2M30A 4OIQF 2GWRA 5K5OA 1UHMA 3N4MA 1T98A 5ICCA 2EWNA 3VEPA 1P4AA 1FP1D 1ZGAA 2JPBA 1W4MA 3SFZA 1K6OA 2STWA 1BOAA 3NQOA 2GZWA 2WTEA 1H0MA 2B0LA 3GFLA 2MC3A 2A68F 2VODA 4LMYA 3HUGA 3H3ZA 1Z6RA 1TNSA 5JVTA 1S7OA 4IHTA 3R0AA 4LG0A 2OQRA 4RS8A 2XAFA 3G73A 4KT5C 2OQGA 2DK8A 2F5FA 4ESBA 1R36A 2YPRA 1YW7A 2L4MA 4KMUX 2QM3A 2L3DA 5L3GA 3GW2A 4KYWA 1BN5A 1FX7A 3PQJA 4L0ZB 3ABTA 2DO7A 2GA2A 2D1HA 2CQKA 4LFUA 3N97A 3GFMA 2IP2A 3ECHA 4KIGA 1I1GA 1JXSA 1ZAOA 2NNNA 5L3EA 1Z1DA 1FSHA 1EH6A 1XSDA 3EYIA 4KFCA 1MJ9A 1R7JA 3RPUA 3V7RA 4ZYDA 3MZHA 1WQ2A 2K4JA 3VFZA 2NRAC 2J5PA 3K9TA 5JHUA 1EH7A