5LLQA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119f variant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
b'MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPFHRVIAENGIGGYSRGVKLKRALLELEGVKIPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Interdomain interactions rearrangements control the reaction steps of a thermostable DNA alkyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5llqA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 5llqA01
3EETA 1O3TA 2UZKA 1BJAA 3ZMUA 4EMSA 3F22A 3GYHX 3KP3A 2PMUA 1IN8A 4S04A 4I02A 1XSXA 3IHUA 4YFNF 2CFXA 5DCMB 4MGRA 2MA3A 4KNYA 1MJAA 3DV8A 1BI0A 3F72A 5ICCA 2XROA 1BC7C 4HYEA 3DFGA 4NQWA 2W57A 1ZREA 4L9NA 3VEPA 1ZRDA 1OYWA 2FXAA 3RKXA 1W7PB 4RB0A 4Y15A 5CLSA 1SD4A 5AIPA 2COMA 4JK1X 1WSUA 3ZMTA 2PG4A 1U5TC 3Q5FA 3I0TA 4F7ZA 4OOIA 5FLXK 3U2RA 1S29A 5HDKA 2RC4A 2M87A 4HQMA 2EA2A 1IN6A 4Q4ZF 2XGXA 1RZ4A 2O8XA 1U6GA 3GFMA 3TO7A 3LQQA 4G7HF 3GXOA 5K5QA 1B1BA 1BOAA 4PGHA 4IHSA 1HXDA 3HSEA 2PI0A 3JAMK 4OMYA 1STZA 3V8JA 2HS5A 2XKPA 1R5GA 3TO9A 1AOYA 4EJTA 4IXAA 3TDZC 3DQVC 3TGNA 1YIOA 1ZYRF 2A6EF 2A07F 1FSHA 4AIKA 2K7LA 5HOOA 5A2QZ 3GFLA 1BM9A 1FSEA 4GYGA 1O57A 2FNAA 4MNUA 1FYKA 4M72A 5CYVA 1OKRA 3FF5A 3BJOA 5F6FA 4Z2YA 4EJVA 1WQ2A 3DP7A 2A5YB 3C7JA 2NNYA 5E1XA 1R22A 1TNTA 4AD9A 1SD5A 1J5YA 1FC3A 1SMYF 1FBQA 2NAZA 3BY6A 4WXHA 1HW2A 4RB2C 3JTHA 1Z9CA 3KP5A 3IRQA 2E7WA 1YW7A 2XKOA 1YQAA 3FM3A 5ICGA 3C18A 5L3BA 4OIOF 4O5VA 2H09A 3C1DA 3RIRA 3RPQA 3GFJA 4CXFA 2JPCA 3J80Z 2F5EA 2IP2A 3RJPA 4CO8A 1FYMA 2QUFA 1BI2A 2HYFA 2EFOA 3HHGA 2PMHA 2KIFA 1E17A 5A2QK 1XCBA 4UXNA 2VBZA 1XMKA 3MZYA 1TLHB 2KJCA 2YX4A 3WE3A 1YYVA 3FWEA 1IZ1A 3KP4A 4KMUX 2DQRA 4RGSA 3WU1B 1LDKB 1LDDA 1W7PD 2MH2A 1J2XA 3KZZA 4CGZA 4A2UA 1W5TA 1L0OC 4G94A 3SXYA 4LB5A 4WXCA 2EFWA 1PP7U 2TDXA 2CG4A 4KDPA 2CQKA 2GQQA 4I09A 2EV6A 1XN7A 2OBPA 4BH9A 4KT5C 4U7BA 3KE2A 3I71A 3J80K 3RTRA 2MH9A 3DEUA 5DCMA 4B09A 3I59B 3GEZA 5J8CA 5FB2A 1TBXA 2JPBA 2Y0MA 2NS0A 3T5XA 2DPUA 1TTYA 4A0XA 1XCVA 4UNOA 1W7PA 2HZTA 2O61A 1IXCA 1SD6A 5JI6A 4MHGA 2V9VA 1KU3A 3NRVA 3SQNA 5HDNA 2KKOA 2DLLA 3E6MA 3NEUA 4G6DA 5TRDA 4CDGA 2Q8KA 1DDNA 1KQ0A 2ETHA 2OU2A 5TJJA 3GO5A 2FNPA 2AXLA 3HOSA 2LNBA 1HQCA 3FHZA 1RUNA 4HF1A 3I54A 1ZARA 2CW0F 1EV7A 3ROUA 4BHPA 4LD5A 3F6OA 2J5OA 3ABTA 3GUDA 4AIHA 3IRRA 1O7LA 1P4WA 1JHFA 1P92A 2D2WA 3F21A 4HLXA 3HUGA 1LDJA 3WTZA 2XVCA 1T2KA 1TQPA 4JQFA 5LGUA 1HW5A 5JVTA 1LJ9A 2XAGA 5LEKA 2OAZA 4I7HA 2GWRA 3COAC 4P96A 2Y75A 3S2WA 1KYWA 3T8TA 1F5TA 4ASNA 2DTRA 4LJZF 2BE5F 2VBWA 3K1PA 3ZN1A 4KIBA 1TQIA 4FT8A 5K1YA 3DF8A 5DUIA 3ZPLA 1T39A 2CO5A 4FX4A 3W6JB 3MZHA 4WWCA 4YFXF 3FMQA 3RYRA 1P4AA 5JR3A 4HA8A 4HZFA 3RI4A 2YU3A 1U3EM 3E97A 4O6JA 4WXDA 1ZG3A 1IW7F 4TV7A 2VT3A 3F8FA 2RDPA 3VODA 4Q47A 4ZYEA 2C6YA 1FZPB 2XAQA 3KCCA 2F5FA 3GZ6A 5BPDA 4KN7X 3B73A 3ZN0A 3N4MA 3ZMZA 4BAYA 3RYPA 4R8HA 5L3EA 3PQKA 4WK8F 5EEGA 3BPVA 4OIPF 2O6GE 1I27A 1U8RA 5DDGA 5D8LB 2VODA 1FOKA 1R36A 2IA0A 3JSPA 3BJAA 3HHHA 4E70A 3IKVA 3F8CA 2FF4A 4LMYA 2GIVA 5FD5A 3IWZA 2XV4S 1HSTA 1GXQA 3R4KA 3M9AA 1IAWA 3QPHA 1QNTA 3SZPA 4G7ZF 2FRHA 2DFIA 4M9ZA 2ACJA 1C0WA 1QQIA 2XAFA 4LB6B 2WWYA 1USSA 2HKXA 2QQBA 4B8XA 3V7RA 4L5IA 4IJAA 4RB1A 1ZN2A 2UXXA 1ODDA 3HRMA 2ESHA 2AS5F 2E1NA 3LSTA 5CVUA 2M45A 4U88A 5BOXA 3M8FA 5DEQA 4ZH4F 1FWZA 5FFZA 3E5UA 2Z5UA 1GHCA 5J8FA 2PEXA 2OD5A 2RNJA 2L3DA 3WTWC 1XSDA 5E18F 3P9IA 2O3FA 2FEZA 2HR3A 3E6DA 2K02A 2JZYA 2IT0A 3RKWA 5FO5A 5D4RA 4ZYHA 3KZYA 3R61A 1FPQA 2YX7A 1FNNA 1B4AA 3GZ5A 2V6CA 2WTEA 3IC7A 2VT2A 2L01A 4OIQF 1HW1A 3F8BA 3FXRA 5L3FA 1BI1A 4CHUA 2L4AA 3J7AO 4OU0A 2DK5A 1YG2A 3LA2A 1CF7A 1Z1DA 3ZQ7A 2DAOA 2DT5A 2D1HA 4EVIA 2FE3A 3QU3A 3GFIA 2JT1A 4CZZA 2H6CA 2IW5A 1ZRFA 4WF2A 1KQ9A 4EM1A 1B9NA 3QOPA 2GA1A 2ZNZA 1R23A 4IHTA 1W4MA 1U5TA 3LA7A 4IPAA 1HKQA 2QYOA 4XBFA 3FMRA 2K27A 4DNCA 4IF4A 1UCRA 1J75A 2IVMA 2NNNA 4ZZLA 2M8EA 1EH7A 2RKHA 3OOPA 1NHAA 2ZNYA 4EJOA 5FD6A 3CJNA 1YLFA 1Z05A 2GA2A 4XSZF 1IN4A 1U2WA 5DYMA 4XRFA 1FBSA 1HSJA 1MZBA 3MAJA 1I1SA 3V8LA 1OMIA 1UHWA 3CUQA 2DO7A 2EFQA 3WTYC 4XLNF 4P9UA 3LFKA 5L3CA 3R6SA 3FM5A 2HQRA 3GVAA 3JSOA 1XSVA 2XASA 4I2OA 5D6FA 1LQ1A 1J7KA 2HGCA 3BPXA 1IXRC 1QGPA 3KP2A 4KICA 1RIOH 5AIQA 2HKOA 1IF1A 1ZGJA 4OINF 1TW3A 1WKMA 3REOA 5LLQA 1OPCA 4ENKA 3QAHA 4BQAA 2XRNA 3RKYA 3ZMDA 4MTEA 1SFUA 4Y17A 4IRIA 2VOPA 1XGNA 2V1DA 4MTDA 2RN7A 1BIBA 1D8KA 2M1BA 2UWMA 4KYWA 3F8NA 3E6CC 1R1UA 1J59A 4KIFA 3TOAA 2VOOA 2GXGA 1SMTA 1HBXG 3SFZA 2FBKA 2EV5A 2H27A 1QZZA 5FFXA 4XSXF 2VE8A 5H20A 2VBYA 2KIMA 3FX3A 2IRFG 1B59A 2HQNA 1WWXA 5LRSA 2L4MA 1REPC 3DPLC 3M1EA 3WG9A 5IT9Z 4EQQA 3Q9VA 1K79A 4MQ9F 5J6XA 4L18B 4M74A 2NYXA 4LG0A 1DUXC 1RNLA 1IXSB 3RPUA 3V7CA 4M9SA 3DXJF 2PFBA 1QO0D 4EJUA 2ZO4A 1TNSA 1QBJA 2ZFWA 4L5JA 4UVAA 2LKPA 2FA5A 3CLOA 1PDNC 4L0ZB 1H9GA 4PGGA 4LFUA 3O2PE 4WX9A 4H0EA 3EDPA 1TQMA 3WTUC 4LLLA 2FOKA 2R7DA 2G7HA 2R3SA 4LLNA 1F9NA 1R58A 4I0AA 2MD5A 1BI3A 1P4XA 1R5HA 5BPIA 1GXPA 2F5DA 5K5OA 5IT9K 1O7FA 2YPRA 4ENJA 4UV8A 2HOEA 3H3UA 1VTNC 3ELKA 1UHMA 2MLGA 2GXBA 2DPDA 5CVVA 3ISPA 5ILUA 1WRJA 2CGPA 1KA8A 1LVAA 2QENA 2VN2A 3F6VA 2EB7A 2P7VB 3F8MA 3F23A 1YFHA 4M6XA 3EYIA 4G7OF 1G3SA 4CICA 1D3YA 2G9WA 3HSFA 2BV6A 1DPRA 3L9FA 4G9YA 1T98A 2QQAA 4R1HA 2L54A 5EEHA 4G6QA 2H94A 4UHTA 1KU2A 1XDSA 4GGGA 1CF7B 2O0YA 5ED4A 3ML6A 2XIGA 3GW2A 2P6SA 3U1DA 3BZ6A 2F5CA 3P7NA 2K4JA 4HX7A 3WGHA 1R1TA 1XGMA 5DD4A 4LLGF 5D5UB 2RGVA 1Q1HA 3CTAA 4BHBA 1U5TB 1LEAA 4N9HA 2LDUA 1K7AA 2HTSA 3WODF 3M8EA 4Q5SF 1KGSA 1KU7A 1T38A 1QZYA 3QRFF 1L3LA 1V3FA 2IPQX 2UXNA 4KUMA 3T8RA 3BOQA 3FMSA 1D5VA 2R7FA 5LGNA 1O3SA 4ZZDA 4YIFA 1F4KA 1XMAA 2BEOA 2Y48A 2ZKZA 5LRRA 5HLHA 4AWXB 1ZLJA 4EM2A 1JGSA 4EJWA 2OQGA 3DPTA 1X3UA 2DQLA 3L09A 2OQRA 3R60A 2ZXJA 3BWGA 2ISYA 2ELHA 3I5UA 1PP8F 3CUQB 1QPMA 4CYDA 4YFKF 3WGIA 1S3JA 5F64A 1OYYA 4PDKA 3EUHA 2XAHA 1CGPA 3W6KB 3FXQA 2A68F 4L9JA 3L00A 4ESFA 2P5KA 5HLIA 1MJ9A 5JFRA 4RB3C 2PJPA 1ZLKA 3KEOA 3HSRA 3K9TA 2MC3A 1DPUA 3KP7A 1Z91A 2NRAC 2EJRA 1SFEA 3MFKA 3K0LA 3VOEA 4N0BA 3KETA 1T0FA 3E3VA 4A12A 3GF2A 4UVBA 1SAXA 2L02A 1FT9A 1S8NA 3E5XA 3EQLF 5BS6A 1FP1D 4UV9A 4AIJA 5HS8A 4BXUA 5CJ9A 1S7AA 4RGXA 4HV6A 3MCZA 3KP6A 5L3DA 1H9TA 3TQNA 1G3TA 2GZWA 1RI7A 5AONA 1I6XA 3P9CA 2P5LC 5BMZA 1MDMB 4KA4A 2W24A 1FX7A 1SFXA 3L7WA 5LGTA 1T6SA 3WTXC 1KYZA 4GCVA 4D0PA 5HVQC 2STTA 2DW4A 2ZMEB 1Z6TA 2Q2EA 2W85A 1IRFA 5K5RA 4ZYGA 1FY7A 1U78A 3H92A 2EWNA 2BGCA 3LWFA 1DP7P 3ZP5A 3D0SA 1ZAOA 4LG0B 1HKSA 2HEOA 1LB2A 3K1MA 1G3WA 4M73A 3E6BA 2P6TA 1PUEE 1GVJA 1HKTA 3O6BB 2W25A 4A5NA 3WTVC 2ZCWA 3HTUA 1USTA 5KVRA 3K1NA 1O3RA 2G7UA 1ON2A 5E8IA 3C3WA 3JAMZ 4RAYA 5CVIA 3VB2A 1F1ZA 2K86A 4BYYA 2DU9A 3ULQB 3KLNA 4L9VA 4I0BA 4QLCU 4MQVA 3K2ZA 3WE2A 3LQRA 4M71A 3BDDA 2V1XA 3D5LA 1G4DA 3CUOA 2JSCA 2ZBKA 1RUOA 3OV8A 3IWFA 5E20A 3U9GA 2DK8A 4L9TA 3MEXA 2D45A 1G6NA 2VBXA 5D5VB 3TDUC 4HBLA 3O3KA 2FMLA 3HRSA 3G3ZA 5D8KB 2RQPA 2WV0A 5D5WB 1XDUA 2D1VA 3ECOA 3KLOA 4NHJA 2PLYA 4HV5A 2IA2A 5E8GA 1AWCA 1P6RA 4IVNA 2IJLA 3IKTA 2PN6A 3T0YA 4YG2F 4Q48A 1KQ8A 4A0ZA 4U7DA 2KIUA 4A6EA 1EH6A 3HRUA 1B6AA 1P2FA 1MJBA 1ULYA 2HWVA 4L0YB 3GX4X 1ZG5A 2RV8A 3CUQC 4RGUA 4HF0A 2YR2A 4UVCA 1FBUA 4YIIA 3NQOA 1YW9A 3BP8A 2V79A 2KJBA 3QU6A 2ISZA 4NB5A 3I4PA 2OZ6A 2OZUA 3AAFA 2OA4A 3ECHA 4LK1F 1JE8A 4OIRF 2K4BA 4HQEA 2P8TA 1BC8C 2QBYB 3HTSB 2M30A 3TOBA 3J81Z 1UB9A 4PCQA 1LNWA 4RS8A 3FXUA 4HLYA 1YO5C 4MEXF 1KU9A 2KRFA 4ENMA 4JBAA 1XD7A 3CO6C 5DCFA 3V7SA 2X4HA 2HDCA 4GXOA 3WTTC 2Z99A 2P7CB 2A6HF 4P55A 2Q0OA 1MDMA 3JW4A 4HF2A 3TKYA 2YSRA 4GO1A 4MEYF 2LSOA 5LHGA 3T1BA 2ZMEA 1ZG1A 4O3MA 3DKWA 4IRHA 4A0YA 2VC1A 3HIFA 5LHHA 2FMYA 1K78A 1ZRCA 3SZTA 3KFWX 2VC0A 1J9IA 1J0RA 2DI3A 3M7GA 4HDUA 3N97A 4KIGA 1IUYA 2QWWA 1LEBA 1I5ZA 3J81K 4FHTA 1IN5A 4P9FA 3CDHA 5FGMA 1S7OA 3H3ZA 1K6OA 3GWZA 2QQ9A 4EGZA 1E2XA 1Z7UA 1BIAA 4A6DA 3P9KA 5LHIA 3HOTA 1R7JA 2V1UA 4M9XA 3V4GA 4ENNA 2FSWA 5H6RA 2P5VA 5IT3A 4N9IA 2PQ8A 1D8JA 2FBIA 5H6QA 4LK0F 4DQ2A 4UUVA 3LAPA 2WC2A 3L2CA 1EH8A 2VONA 2Z3YA 3BJ6A 2QVOA 1A04A 4U0YA 1MKMA 3R0AA 2J5PA 2M5WA 4OMZA 3K69A 4AVPA 5E1WA 5D5XB 4I98B 1WI9A 4P5OA 1JHHA 1YW8A 1G3YA 5BQTA 2QLZA 3GLXA 3PQJA 3E5QA 2O03A 2EA4A 1TW2A 1OR7A 2XAJA 1W5SA 5JHUA 3PFIA 5D4SA 4KFCA 2EV0A 1MGTA 2MLKA 4WCGA 1BN5A 3FZVA 4HAMA 3IL2A 1YTYA 4BHCA 4R79A 3R0JA 1H0MA 3B02A 4RAZA 5ERIA 2E1CA 2VE9A 2FBHA 1YS7A 6PAXA 5KK1A 2ADUA 4HOBA 3F3XA 2HFHA 3KEQA 1XGSA 2DBBA 4Y13A 4G8XA 3WTSC 3V8KA 3VFZA 4KMFA 3QP6A 4FX0A 2CWEA 3G73A 1ZHFA 1XB4A 3QP5A 5DUKA 1ZGAA 3JTGA 4IRGA 2ESNA 3ABUA 5LEJA 4ON0A 5E1ZB 2CSOA 1FP2A 1SD7A 1BBYA 1Y0UA 2VXZA 2QBYA 1R00A 3SHFA 2A3SA 4PZJA 1IRGA 3WU0A 2IA1A 2XUBA 2X0LA 3Q9SA 1O3QA 2LF8A 3EYYA 4EV0A 4M6YA 2Z33A 4I01A 4A5MA 4EM0B 1XGOA 2BYVE 2EK5A 1Z6RA 5E17F 1UFMA 3I53A 5HDGA 4S05A 5HS7A 2EFPA 3CO7C 2FQ3A 4HX4A 1MD0A 2PBIA 2BBYA 2MBFA 2GAUA 2HTJA 1ON1A 3MWMA 4HW0A 4ESJA 1I1GA 2B0LA 4U0VA 1FYLA 2XHKA 2H6BA 1R1VA 1B9MA 1OYIA 2RVCA 2HYGD 1JXSA 3QPTA 4HX8A 2EFNA 3I58A 5F1RA 2Z9OA 5HS9A 5ILVA 4XLPF 3LA3A 2FU4A 4QWQA 3MQ0A 2A69F 2P4WA 3BROA 5ICFA 2E7XA 5CVRA 2QM3A 2F2EA 2JRTA 3ZMVA 3ZMSA 3I59A 4RGRA 1ONVA 4LGWA 2A61A 1IN7A 4K2EA 4EGYA 3HYIA 1FLIA 1V4RA 4U0WA 3ERED 5DD8A 1ZH5A 3LAJA 5L3GA 5CVJA 2ZJ2A 2CYYA 4GYIA 5D6EA 4ETSA 5LBQA 2STWA 3I64A 4KN4X 2W84A 2LF7A 5HLGA 5ICEA 2QZ8A 4HDVA 3TO6A 3HRTA 5DV5A 5ILSA 1S6LA 1K78B 4BNCA 3WGGA 4ESBA 4ZYDA 2JTVA 1YS6A 5FLXZ 3RDIA
chains in the Genus database with same CATH superfamily
4M3EA 2LG4A 1IQSA 5C4JJ 3EETA 5A69A 4FTHA 1O3TA 2UZKA 2R92J 1BJAA 1Y8QB 5HLTA 3ZMUA 2K4VA 2I10A 2YTOA 4EMSA 3F22A 3LSRA 1MMDA 3GYHX 3KP3A 4X9JA 2PMUA 3LL7A 1IN8A 4S04A 1WJBA 3CJRB 4QPQA 2ME6A 2OCEA 1TWFJ 2IGKA 2EL4A 1YJWI 4I02A 4RBOA 4BE0A 3CESA 1Y39A 1W36C 1X3WB 1XSXA 3CCYA 5HODA 3IHUA 4YFNF 2CFXA 5DCMB 4ABZA 2B9SA 2EN3A 1DP3A 4MGRA 1AA7A 2MA3A 4KNYA 1MJAA 1SVLA 2M7BA 1VQOI 3DV8A 1ORKA 3GCMA 1BI0A 3F72A 3OL3A 5ICCA 2XROA 3GTKJ 4LIUA 1BC7C 2X6OA 1RRJA 2HOAA 2I5UA 3FXLA 2XF6A 2YS9A 4HYEA 3DFGA 2RSIA 4NQWA 2W57A 1ZREA 4L9NA 3VEPA 1ZRDA 1OYWA 4DV2E 2FXAA 2HVQA 1K4SA 3RKXA 2L33A 3H9JA 1P9QC 3PM1A 4XIDA 1W7PB 2VL8A 4RB0A 4Y15A 1RMDA 4C3JJ 4BBYA 2EOSA 2GBYA 2IXSA 1UILA 2H36X 5CLSA 3VHTB 1SD4A 1CQTA 5A6KA 1F43A 5AIPA 2COMA 4JK1X 1WSUA 3ZMTA 5FROA 2PG4A 5AE1A 3EPJA 4DGWB 2DMIA 3KWRA 4DIQA 4BE2A 5JLXA 1U5TC 1LFUP 1PKPA 1MW7A 3Q5FA 2PJRA 3I0TA 1OQYA 2UU9E 4F7ZA 4OOIA 2BOLA 5FLXK 1N32E 1HNWE 1RETA 1S29A 4NC8A 3U2RA 2JOXA 2EN2A 5HDKA 2YRHA 3K6QA 2IBDA 2BY1A 2RC4A 2M87A 4HQMA 2EA2A 5J1YA 5DM7F 2R5ZA 2L92A 1IN6A 4Q4ZF 2TRTA 1RZ4A 1VNDA 1U6GA 2O8XA 2XGXA 3H1CA 3J7ZI 3F6HA 3TQMA 3GFMA 3ASNH 3TO7A 3CCUI 1WXRA 2YPNA 1R4MB 2CUFA 5J47A 3LQQA 2R4GA 4G7HF 3ESWB 3GXOA 3HGGA 4EATA 5K5QA 5KL3A 1B1BA 4M3BA 5F0FA 1BOAA 4PGHA 4IHSA 4F91B 2XF7A 2VQGA 1HXDA 3HSEA 1B8IB 2PI0A 3JAMK 3QYFA 4OMYA 3PFYA 1STZA 3V8JA 1RESA 2HS5A 2EMIA 2LFBA 1R5GA 2XKPA 3K4JA 2M0MA 4OAYA 3TO9A 1RQ0A 3DJWA 1AOYA 4ZYAA 1TZLA 3K2AA 2X1EA 4EJTA 1PJQA 4IXAA 3TDZC 3DQVC 1AAYA 3TGNA 2VQFE 2ELYA 1YIOA 1ZYRF 2A6EF 2EQ1A 2DMYA 2P81A 2LTRA 2DA2A 2LKSA 2KOUA 5CFFE 3IV5A 2A07F 4RM2A 1JT0A 1FSHA 1N25A 4AIKA 2K7LA 5HOOA 2LC2A 4MLQA 2K5CA 3LSHA 3BCBA 4FE7A 5A2QZ 3GFLA 1BM9A 3BR6A 2IS2A 1FSEA 5BR8E 4V2FA 3OR1C 4GYGA 3SYTA 2EM4A 4BBRJ 1O57A 2FNAA 4MNUA 4BL0B 3OYIA 2F6CA 1FYKA 2KLOA 4M72A 4XQFA 1DQ3A 5CYVA 3FXOA 1OKRA 3FF5A 4O4KA 3KIOA 3HC7A 2DDAA 3BJOA 5F6FA 4Z2YA 4EJVA 1WQ2A 1RC9A 4DYQA 1SFKA 3DP7A 2A5YB 3C7JA 2NNYA 5E1XA 2LH9A 1R22A 1TNTA 3BZKA 2DYSH 4AD9A 1SD5A 2JUGA 4NHRA 1J5YA 1FC3A 4ITVA 1SMYF 3VYUB 2BVLA 5DTDA 5J4YA 1VQPI 1A1JA 2QGUA 1FBQA 1JTXA 2DMQA 2NAZA 2WB1A 2DDBA 3BY6A 2RPCA 4YHHE 4WXHA 2M8GX 1ETQA 1HW2A 2ID6A 4JP0A 4RB2C 2WAQN 3JTHA 1Z9CA 3KP5A 2YTPA 3S32A 3IRQA 1XNRE 4IZZA 2E7WA 2JR1A 1YW7A 1XTAA 2XKOA 1YQAA 3FM3A 5ICGA 5IYCJ 5KL6A 3GTMJ 3C18A 5L3BA 3BR3A 5IP7J 2K3PA 1JJ8C 2YSOA 1X1DA 5J1RA 3E1SA 4OIOF 4O5VA 1N3GA 1EJ9A 1WH5A 1X1PA 3BIDA 2H09A 3C1DA 3HOXJ 3LMMA 2DSYA 2V86A 2FUG2 2HVSA 4BQOA 3ZQCA 2CTDA 3RCOA 3RIRA 3RPQA 5DM6F 3GFJA 4DYRA 1T95A 4CXFA 2LBSB 2JPCA 3J80Z 3SJMA 4IQJA 2F5EA 2ENHA 2IP2A 3RJPA 4DV0E 4HTGA 3ZXSA 4CO8A 2L2MA 3NWSA 1ZAAC 1BJZA 3F6GA 2JVHA 4WSPA 1FYMA 2QUFA 1BI2A 2HYFA 2EFOA 3HHGA 2K7IA 1AHDP 2PMHA 2KIFA 4GRIA 1E17A 4XOTA 1PJTA 5A2QK 3W6VA 2HHHE 1XCBA 3P5JA 4UXNA 4F52A 1N34E 2VBZA 2CFOA 2LV2A 4C2UA 1XMKA 1V55H 1TLHB 3MZYA 2EP3A 2VQLA 2EIKH 2NS8A 5B1BH 1A1KA 1PUFB 2KJCA 2UUZA 3F0CA 2YX4A 3WE3A 1YYVA 2N3HA 5IP6A 2R7ZJ 3DLLF 3FWEA 1IZ1A 2GLOA 4Q35B 3KP4A 4KMUX 1UAAA 3S14J 2X48A 4TUIA 3GBGA 2YZTA 2DQRA 3HPSA 2K9QA 4RGSA 1MBKA 2L9NA 3GZNB 4M3DA 1MMAA 4IEJA 3WU1B 1IQOA 3GTOJ 4XKBA 1LDKB 1LDDA 2ZMEC 1W7PD 2MH2A 2R0QC 2DLKA 1IMUA 2EWLA 1J2XA 3KZZA 3VYSB 4CGZA 4A2UA 1BBGA 4R2QA 1W5TA 4PJJA 4F55A 1L0OC 2NUEA 4G94A 3SXYA 4LB5A 2DMTA 3S1NJ 2RQQA 3H5RA 3BG6A 1YITI 4WXCA 2EFWA 1PP7U 2TDXA 2CG4A 3GMEA 2JOBA 4KDPA 4AC0A 2CQKA 2GQQA 2CU7A 4JX5A 5A6JA 4I09A 2EV6A 4ZTJA 1YJ9I 2WAQA 3G2BA 4Q28A 1FKAE 5TISC 1XN7A 2OBPA 3HB9A 2EZ6A 1TWGJ 4BH9A 2IS6A 4KT5C 2JA8J 4CSWA 4DV7E 4U7BA 3KE2A 3I71A 2UUBE 3J80K 3RTRA 4D7MA 1HA8A 2YRKA 2MH9A 3DEUA 5DCMA 1TWHJ 4B09A 2L7ZA 4EEFG 1G2FC 1E0EA 1BR1A 3G1OA 3I59B 3GEZA 1A1GA 2B7VA 1HOMA 2J7JA 1P7JA 4XONA 2EILH 5J8CA 5FB2A 1TBXA 2RREA 4DV4E 2JPBA 4B1RA 3ZQHA 2Y0MA 2NS0A 1WHNA 1GLNA 3JU0A 3T5XA 5FKNA 2DPUA 4RH8A 1TTYA 4A0XA 2HQ5A 3CCEI 1XCVA 5EEAA 4UNOA 1W7PA 2HZTA 2O61A 2OJED 2HXOA 1IXCA 1SD6A 4FETA 5JI6A 4R03A 4MHGA 2JA6J 1WJFA 4RAFA 5EZGA 2QSFX 3CCQI 2HDDA 2EH3A 3WHCA 2V9VA 1KU3A 3B6AA 1R6RA 2Y0SN 3PNYA 2B7TA 3NRVA 3J7AY 4M3FA 4R2AA 2FV4B 3LSMA 3P1XA 3I55I 4P78A 2WBTA 3SQNA 5HDNA 2O5RA 2KKOA 1GQEA 4X6AJ 4YEJA 4UUTA 1TL8A 2DLLA 4NXNE 5F04A 4V19K 3ADGA 1TWCJ 3E6MA 3NEUA 5AC4A 4G6DA 5TRDA 1UG0A 4CDGA 4PFPA 2Q8KA 1DDNA 2MGQA 1A1IA 3ADIA 1KQ0A 2ETHA 3GTQJ 3T1HE 2OU2A 2FQ4A 1I3AA 5TJJA 4J19A 5J1UA 3GO5A 2FNPA 1Y8RB 2AXLA 3SEQA 2QF7A 1R9TJ 2EZIA 2YTFA 3HOSA 2LNBA 1HQCA 1VZ0A 2GPIA 4N4RB 2QEXI 3FHZA 1RUNA 4GDFA 4HF1A 3I54A 1ZARA 1B8IA 2CQXA 2CW0F 3DPUA 5ADZA 1BW5A 1J26A 3HJEA 1EV7A 3A03A 3ZR8X 3NARA 3OWTA 3ROUA 4XLHA 2JA7J 3TBIA 2IHR1 4BHPA 3IWDA 1MEYC 1AU7A 4LD5A 4A3JJ 1JGGA 3HG9A 3F6OA 2J5OA 4DR6E 1OR7C 2AQEA 3ABTA 1B69A 3DBRB 3GUDA 1A35A 3H3VK 1X2MA 4JI5E 4AIHA 3IRRA 1O7LA 1P4WA 1JHFA 4HG2A 1P92A 1IC8A 2D2WA 1X3ZB 3F21A 4JI6E 4HLXA 3DLAA 2KRCA 2FX0A 3ERMA 4DBQA 2YWQA 3HUGA 1LDJA 3AV0A 3WTZA 2XVCA 1T2KA 1VQ7I 3LLHA 1RR7A 1FJLA 2E71A 4BGDA 2LRSA 5FLXC 5J40A 1MSEC 1TQPA 4NQWB 5GTHC 1ENHA 4JQFA 2DA3A 1Y1VJ 5LGUA 2K9MA 2EPXA 2DRPA 2XDVA 1HW5A 5JVTA 1LJ9A 2EMYA 2XAGA 3VDXA 5LEKA 3K4LA 2OAZA 4B3ME 4I7HA 2GWRA 1MBEA 4PSXA 3COAC 4P96A 2Y75A 3S2WA 4XLFA 1TF3A 1KYWA 1PDAA 4X8WA 4CCMA 1UHZA 3T8TA 1F5TA 2VUMJ 1N78A 3VWBA 4ASNA 2DTRA 2JYAA 3OYCA 1I39A 3L2UA 4LJZF 2WA0A 2ZJPF 1ZGWA 2BE5F 3JAMC 2AQFA 2VBWA 4X65E 1VQMI 3K1PA 3ZN1A 2PJRB 1N33E 4KIBA 2E1MB 1VQ5I 3MD2A 1RKTA 3WHBA 3OYHA 1TQIA 4FT8A 1W0UA 2F48A 2R5ZB 5K1YA 2Y31A 3DF8A 2R7TA 1YX5A 5DUIA 3ZPLA 2CQ7A 1STUA 2GIZA 2BXYA 1T39A 2CO5A 4HPQA 4FX4A 2MD0A 1X2NA 2EMWA 3W6JB 3MZHA 4WWCA 4PSWA 1GDTA 1YUJA 4YFXF 3L1PA 2EPOA 3FMQA 3S3MA 3RYRA 3CCRI 3MN2A 1P4AA 2LUPB 1LE8B 4ANJA 5JR3A 2ZJRF 4HA8A 4G12A 2GHFA 3KYLA 4HZFA 3RI4A 3PO3J 4KJZA 1OCCH 2YU3A 3HM5A 3CCMI 1U3EM 3E97A 4O6JA 1X58A 5F0CA 4WXDA 2YTJA 1Y0NA 3BGHA 4AM3A 4IJDA 4C2MJ 1WGXA 1ZG3A 2EM6A 2EOXA 4LFAE 1IW7F 1ETXA 4TV7A 3FIWA 4XLCA 1SEUA 2VT3A 2ZSHB 2MYSA 4C3HJ 3F8FA 2RDPA 3VODA 1KJKA 4A3CJ 4Q47A 4ZYEA 1KONA 1Y6IA 2Y9ZA 2C6YA 2B7EA 2A05A 4C2TA 3CF2A 3S1RJ 1FZPB 2XAQA 2Q8UA 3KCCA 2F5FA 3W2WA 3VYXA 4DR2E 3GZ6A 5BPDA 3ZOQB 2LCEA 1X6FA 4KN7X 2XGEA 5E79C 3CJQB 2LK2A 1OCTC 3B73A 1WJPA 3ZN0A 2HPMA 2EIMH 2DOEA 3N4MA 3DU5A 3ZMZA 4BAYA 3BG7A 3C2HA 3RYPA 4R8HA 3I3LA 1MNDA 5L3EA 3EPLA 2EMAA 3PQKA 4BEHA 2HGHA 4WK8F 2M2EA 5EEGA 3IP4B 3SFIA 3LSKA 2JA5J 3BPVA 4OIPF 2KDZA 2O6GE 1U9NA 2LMDA 3OIPA 1ETKA 2YTNA 2JVAA 1I27A 1U8RA 5DDGA 1DGWY 5B3SH 4UY8I 5D8LB 2VODA 1FOKA 3CMEI 1R36A 2IA0A 3K6GA 3JSPA 4DR1E 3BJAA 2OCCH 3C2GA 2M3AA 3HHHA 4E70A 3IKVA 2BB8A 3F8CA 5IPAA 5K7HA 1U8BA 1VQ6I 2AXTC 4E7HA 2FF4A 3GLLA 4BMJA 4DV1E 4LMYA 2GIVA 3EPZA 5FD5A 1R5ID 5A2QC 3IWZA 2XV4S 2MC6A 1HSTA 2L9RA 2NOGA 1GXQA 3R4KA 2VPLA 2KMUA 3ABLH 4XM3A 3HPZA 1GUUA 1X4OA 3M9AA 3ZQGA 3A1YA 1IAWA 3QPHA 4BUPA 1JKOC 2NVTJ 5CPRB 1AH5A 1QNTA 1DI2A 4F6NA 3SZPA 1XX5A 4G7ZF 4ZDLA 3S1MJ 1IDZA 4DV3E 2EPKX 2FRHA 2R93J 2DFIA 3BQZA 4M9ZA 3M3YJ 2ACJA 1C0WA 3RQIA 1QQIA 2ZJQF 2BVMA 2XAFA 4LB6B 2WWYA 1USSA 2HKXA 2QQBA 3DU6A 4B8XA 1G59A 3DWLE 3FXKA 2K9SA 2Y69H 1ZBQA 4JOMA 3KYCB 2JUCA 4YIRX 1E3HA 3V7RA 4L5IA 4IJAA 2O9LA 3L2RA 1WCMJ 4C30A 3CMYA 3VYTB 4KT6A 3OS1A 2ZB9A 4WSGA 1GV2A 2EMFA 1WJDA 1R71A 4RB1A 1ETWA 2CJJA 4XN0A 1ZN2A 2UXXA 4A3MJ 5H2FC 4E7SA 1WJCA 1ODDA 3HRMA 2ESHA 2AS5F 2E1NA 3LSTA 2JSPA 3FXJA 5CVUA 2ZM6E 1FOXA 1T4LB 5CKTA 2M45A 4U88A 5BOXA 4BXXJ 3M8FA 5DEQA 4IX7A 4ZH4F 1F36A 1FWZA 5FFZA 3E5UA 2RNGA 2Z5UA 2F4OB 1IRZA 1GHCA 5J8FA 4IHXA 2PEXA 2XSJC 2KFDA 3OY9A 3J80C 2I13A 1VQ9I 2NXNB 2W00A 1S7EA 2ELKA 3HKZN 2OD5A 3G4SI 1BW6A 2RNJA 4C3IJ 2EMXA 2JXPA 2F5VA 2JP9A 2L3DA 3WTWC 1XSDA 4BBSJ 4FE4A 3SZGA 5E18F 3P9IA 4L5EA 5KL5A 5A6BA 1QU3A 2O3FA 3CP2A 2DT6A 2FEZA 2HR3A 3E6DA 2KHXA 2K02A 3ADLA 4E7JA 1UELB 3BCAA 3IUOA 2JZYA 1X1AA 5F1JA 2IT0A 2JWOA 3QQAA 1QVUA 3RKWA 2QKLB 5DS9A 5FO5A 3TL4X 5D4RA 4BACA 4ZYHA 3K4MA 4IKFA 3KZYA 4YRVA 3LNQA 3OMYA 1FPQA 3R61A 2YX7A 5IY5H 1B4AA 1FNNA 2EM0A 1K6YA 2V6CA 3GZ5A 2EE8A 3Q0UA 2WTEA 3C4BA 4F92B 3IC7A 2VT2A 1O0WA 2L01A 4OIQF 1HW1A 3F8BA 1OCRH 3PL8A 5IYDJ 2JRMA 2L3CA 4LF5E 3BR0A 3FXRA 5L3FA 2UUAE 1YSAC 1BI1A 2VPRA 4H4KC 4CHUA 2L4AA 3J7AO 4OU0A 4R2PA 2PMZN 1NEIA 2DK5A 4LF8E 1YG2A 3LA2A 2E72A 2JQ7A 3RMPA 1R4NB 1CF7A 5M5XJ 1IJWC 1Z1DA 3ZQ7A 2DAOA 2DT5A 2D1HA 3QYBA 3HQ1A 4AU7A 4EVIA 2EOEA 1Z3XA 1QVTA 2FE3A 3QU3A 1BBOA 3GFIA 4Y33A 1ZR9A 1W1WE 2CV1A 3DTEA 1EKZA 2JT1A 4CZZA 2H6CA 4PUSA 2YU5A 2W82A 2IW5A 5JLWA 3K4BA 4V2GA 1ZRFA 4WF2A 2XGDA 4RHBB 1P47A 1KQ9A 4EM1A 4J01A 1I6HJ 2LUQA 1B9NA 3QOPA 2GA1A 5GAHJ 2ZNZA 5GTIC 1R23A 4IHTA 1JK2A 1W4MA 1U5TA 3LA7A 2E1MA 2NVQJ 2E60A 4IPAA 1HKQA 2QYOA 4XBFA 3FMRA 1BOBA 2K27A 4DNCA 5IV8B 4CCLA 3FKJA 4IF4A 1WHUA 1UCRA 1J75A 4KHPE 3BT9A 5GP9A 1UJ8A 2IVMA 2KZGA 4B4CA 2NNNA 3S8PA 1U0JA 2EOYA 3VPRA 2B63J 4F93B 4ZZLA 2M8EA 1EH7A 2RKHA 3OOPA 2XC7A 1NHAA 5KHDA 1TWAJ 1YJNI 2ZNYA 2VKDA 4EJOA 3ZQIA 3HOVJ 2EM2A 5AE3A 3O8HA 4DMIA 4DJAA 5FD6A 1LE8A 5KL7A 3CJNA 1IUFA 3QG5C 1IBLE 4NC6A 1YLFA 1Z05A 4BC7A 2GA2A 4XSZF 1NK3P 1IN4A 2CUEA 1U2WA 2KQRA 1XMQE 5DYMA 4QTRA 4XRFA 1KYQA 1FBSA 1HSJA 1MZBA 2M4GA 1LUJB 3MAJA 1OJLA 1YI2I 2AO9A 3AL0B 2JA2A 4L8NA 2CV2A 1I1SA 3V8LA 1OMIA 1UHWA 1JK1A 2EOQA 2V89A 3HL2A 3CUQA 4F9AB 3VYYA 2DO7A 4J00A 4BJ5C 4FASD 2NA2A 3KPHA 2EFQA 3WTYC 2IGOA 4XLNF 2MG4A 3HUGB 4P9UA 3LFKA 3FXMA 5L3CA 3R6SA 3OIQA 4O43A 3FM5A 2V9PA 1OCZH 3OSGA 2ODRD 4KZSA 2HQRA 4A69C 2EPLX 5KL2A 1UN6B 3GVAA 2LRDA 3M07A 3JSOA 2JJ7A 1XSVA 4LF7E 5M5WJ 2XASA 4D9JA 4I2OA 2HPIA 4BQNA 5D6FA 3A01A 1LQ1A 1J7KA 2HGCA 3BPXA 1IXRC 1QGPA 3KP2A 2BY3A 4KICA 5M3MJ 1VQLI 2QSGX 1RIOH 2HU9A 5AIQA 3LSIA 2DA1A 2HKOA 3ABKH 5LD2C 4JX4A 1ZK8A 1IF1A 1ZGJA 2DB2A 2R76A 4AQYE 4OINF 1SANA 1F2IG 4RA2A 1ETVA 1TW3A 1WKMA 3EPKA 3REOA 2X1DA 2NVUB 5LLQA 1OPCA 4ENKA 3QAHA 3AG3H 4BQAA 2XRNA 3RKYA 3ZMDA 4RLFA 4MTEA 2V4JC 1SFUA 2V83A 4X66E 2EL6A 3IWCA 4Y17A 2F8BA 3S3OA 1WH7A 4IRIA 2VOPA 1XGNA 2BW3B 2V1DA 4Y3OA 3VSLA 2DLQA 2KONA 1ZTRA 2XB5A 1TP4A 4MTDA 3IAM2 2YSPA 1I50J 2RN7A 2ZXHA 1BIBA 1D8KA 4L5NC 2M1BA 5C3EJ 4B43A 2EN8A 2UWMA 4CYCA 4KYWA 1Z21A 3F8NA 3E6CC 4HSTA 2H1KA 4JI8E 4KITB 1R1UA 2CW8A 3QOEA 1J59A 4KIFA 2EPFA 3SEZA 2EQRA 3TOAA 2GXGA 1SMTA 2KL4A 2VOOA 3ZOBA 1HBXG 3SFZA 2EN6A 2R1FA 4IO9F 4JI2E 3D5SC 1LFPA 3HPGA 2QCOA 5EG0B 1VFCA 1BA5A 2FBKA 2OF7A 1JKRC 2EV5A 1IV8A 1FTTA 3IH2A 2DMUA 3CLQA 3H0GJ 2LO3A 2YU9J 3LSJA 3TW7A 4AIDA 3MKLA 4DUYE 2VQEE 2H27A 4NC7A 2VASA 1W0TA 1QZZA 1EA3A 2W1OA 2E19A 1G2HA 3FBNB 5FFXA 2IGMA 2EBIA 4XSXF 2VE8A 5H20A 2DOFA 2H8WA 3W2VA 1WZ2A 2Y9YA 4M30A 2VBYA 2KIMA 3FX3A 2IRFG 1B59A 4A3GJ 5GAEJ 2HQNA 2KP6A 5EGOB 1IG7A 1WWXA 5LRSA 2L4MA 3DEEA 4DW6A 2I9IA 1REPC 3HBLA 5FKKA 4JI7E 3DPLC 3LFUA 3M1EA 1H88C 1EF4A 1T4NA 4HEIA 3HPHA 4DR3E 4LF4E 1OFCX 3WG9A 4BEHB 1X6EA 5IT9Z 4XORA 2QSHX 3CDLA 4EQQA 3Q9VA 2E1OA 1K79A 2BZTA 2EZHA 3S1QJ 4MQ9F 5J6XA 4L18B 4BS9A 4M74A 3FK7A 2DTZA 4PFOA 1HNZE 3JRBA 2NYXA 4LG0A 2XGCA 1DUXC 4IQ4A 1YIJI 1RNLA 3K4KA 2ELZA 1YYOA 2UXBE 1POGA 4ZJZA 1IXSB 2BY0A 2R7UA 3QWLA 4DYCA 3RPUA 2NABA 3BTCA 3V7CA 2KDOA 3BR5A 4M9SA 4HSRA 4MLVA 4O24A 3DXJF 2PFBA 2JVGA 1QO0D 2DJIA 4EJUA 3OS2A 2ZO4A 1TNSA 1QBJA 2CS3A 4DOZA 3A2KA 1JUSA 2ZFWA 2VJIA 2BY2A 4L5JA 4D7NA 3OR2C 3JRAA 4UB8C 2MDGA 4UVAA 1SR9A 2LKPA 1SFOJ 4P1WA 2FA5A 2IAIA 2R7RA 1D5YA 2V87A 3CLOA 4NXME 1PDNC 2EOOA 4L0ZB 3GTPJ 1H9GA 3AUZA 1V5GA 4PGGA 4LFUA 3O2PE 4WX9A 3BBGA 4H0EA 4QPOA 3W3CA 1QU6A 2EPMX 1V54H 3EDPA 1TQMA 3WTUC 4Z6YA 4LLLA 2K85A 5F0HA 2R5YA 4BC9A 4F6MA 2L9VA 3ADJA 3JCUC 4M3GA 4XNFA 2EINH 2FOKA 2R7DA 2WZOA 1A6QA 2A6TA 5KL4A 2G7HA 2R3SA 4LLNA 1F9NA 1R58A 2L2NA 3QPLA 4I0AA 2MD5A 1BI3A 1P4XA 1R5HA 5BPIA 1XPXA 3HOZJ 1GXPA 3OIOA 2EOMA 2F5DA 2DCEA 5K5OA 4B3RE 5GADJ 5IT9K 1O7FA 2YPRA 2YRMA 4J8ZA 1SC7A 4N4OB 4RAGA 3DEWA 2CW7A 4ENJA 1UBDC 2EOFA 4NUBA 2NVYJ 2LVHA 4PJMA 4UV8A 1QZEA 2HOEA 3H3UA 1VTNC 2X51A 3ELKA 1UHMA 3CMMA 2LVSA 2MLGA 2YTGA 3VSKA 2Q2EB 2GXBA 4DV6E 2ELJA 2DPDA 5KAIC 1XG1A 3I56I 5CVVA 2GM4A 2FTXB 3ISPA 5ILUA 1WRJA 4C9YA 3K70D 4I76A 4A3IJ 2CGPA 3FIGA 1BR4A 2I8DA 5EYRA 3DBHB 3S15J 5IOZA 1WJ5A 2FD5A 1KA8A 2M9AA 2ZC2A 1LVAA 2EORA 2LTSA 1IGNA 2L7FP 1X6HA 2QENA 1QPIA 2VN2A 3F6VA 4IOAF 2JWTA 2EB7A 2P7VB 1G2DC 3F8MA 1IBKE 3TMOA 3F23A 1YFHA 4M6XA 2X9DA 3EYIA 2VXDA 4G7OF 1G3SA 2E34A 4CICA 1D3YA 4E7KA 3THNA 2G9WA 4CUGA 1GTKA 2WY8Q 3HSFA 1GT0C 2BV6A 3J7YJ 1R49A 1Z3YA 1K4TA 1DPRA 4JI3E 4JV5E 3L9FA 2L3JA 4G9YA 1T98A 2QQAA 3FBIB 4R1HA 1BL0A 4XLAA 2HOTA 3T1YE 2L54A 5EEHA 4G6QA 2H94A 1XMXA 2MABA 4UHTA 1KU2A 4QIWN 3CDIA 3H09A 1NTCA 1XDSA 4GGGA 2O0YA 1I3QJ 4W1UA 5ED4A 1CF7B 3ML6A 4Y4RA 1Y1WJ 2CV0A 2XIGA 3FISA 4IHYA 1SVMA 3GW2A 2P6SA 4M6VA 4BKXA 1TC3C 2F4IA 1X47A 2EMLA 1E3PA 4BE1A 3U1DA 3BZ6A 1FTZA 1MNEA 2R7OA 3OYJA 3K4CA 5FLMJ 4XLEA 2F5CA 3P7NA 3PIOF 3VK6A 4DZJA 4LF6E 2K4JA 4LU9A 4X62E 4HX7A 1YYKA 1MBHA 1T8IA 2B3TB 2DA5A 3THOB 3WGHA 2Y0SA 4B3TE 3M1CA 2DMNA 1R1TA 4KISA 1XGMA 5DD4A 2OPTA 4LLGF 5D5UB 2M0CA 2RGVA 1MMSA 4GKJE 3HZJA 1Q1HA 3CTAA 2DA7A 4BHBA 1U5TB 1LEAA 1IO2A 4N9HA 2LDUA 4A3BJ 4A3KJ 2EOIA 4R2RA 1K7AA 4FQGA 2HTSA 3WODF 4I6ZA 3C4TA 3M8EA 4Q5SF 1KGSA 4S0HB 1KU7A 4CCKA 1T38A 4WYQB 1QZYA 2BW3A 3QRFF 1L3LA 1V3FA 1A36A 2E35A 1MBGA 2WADA 5JVGF 2IPQX 2UXNA 4KUMA 3T8RA 4XKCA 5KCMA 3AG4H 3BOQA 2E2HJ 3FMSA 1LVKA 1D5VA 2L5QA 2ECBA 3N05A 4II3A 5BNGA 2R7FA 5LGNA 1O3SA 4ZZDA 5IYBJ 3I4MJ 2X6XA 2ZXIA 4D5CA 4YIFA 3IH3A 1XMAA 2BEOA 4XMYA 4E6KG 1F4KA 2Y48A 3S2DJ 2ZKZA 5LRRA 5HLHA 3CP8A 2DFHA 4AWXB 2V8QB 5EG0A 1ZLJA 2CPNA 4EM2A 4LTYA 3HOYJ 1JGSA 4YY3E 4EJWA 2OQGA 2EM7A 3DPTA 1X3UA 2ID3A 4R2EA 2R7QA 2DQLA 4AUXA 3L09A 2OQRA 3R60A 2ZXJA 3BWGA 3HEFA 2LY9A 2ISYA 4MIMA 4GZNC 2EMHA 2WCC3 4LF9E 2ELHA 3I5UA 1PP8F 3CUQB 1QPMA 4CYDA 4YFKF 3WGIA 1S3JA 5F64A 1OYYA 4PDKA 2OC6A 3EUHA 2XAHA 3LOCA 3B6CA 1CGPA 3W6KB 2COBA 3FXQA 5LFAA 2A68F 4GEQB 1J09A 4L9JA 5EGOA 3L00A 4ESFA 4R2SA 2P5KA 2W4SA 5CQEA 3CC4I 5HLIA 4A3DJ 2EZLA 3PUFA 3A01B 1DQUA 2DN0A 3BG9A 1YRNB 1MJ9A 3A0BC 1JKPC 2EPZA 1ERDA 5IXMB 3DTIA 1LKXA 3TP0A 5JFRA 4RB3C 2E5ZA 2PJPA 5DNYA 4K0KE 1ZLKA 3KEOA 1UHSA 2UXDE 4LIVA 2N8GA 3HSRA 3S93A 3K9TA 3L2VA 2MC3A 1DPUA 2DJNA 5FKLA 1X3CA 2EMZA 4O5GA 3KP7A 2VIXA 1Z91A 3FHNA 2NRAC 1RR8C 1IBME 4BXFA 2Q1ZB 2EJRA 1SFEA 4CCNA 3MFKA 3K0LA 4RDUA 2NOJB 3EUKL 3VOEA 4N0BA 3HGYA 1T0FA 3KETA 4IHVA 3C2BA 5HNHA 3E3VA 4A12A 3GF2A 3TW6A 2VRDA 4UVBA 1SAXA 3QYEA 2MKDA 2L02A 1A5JA 1FT9A 4E7ZA 1S8NA 4LG3A 5EZHA 2KISA 3BTLA 3CC2I 3E5XA 3EQLF 3IAS2 5BS6A 1WVRA 2L8TA 1MBFA 2F4VE 1OCOH 4CYCB 2CH0A 4LFBE 2A25A 2JY9A 1FP1D 4UV9A 4AIJA 5HS8A 5A6BD 4BXUA 1LPQA 5A6AA 5CJ9A 1S7AA 2CUJA 4RGXA 1FMWA 4HV6A 4CCOA 3MCZA 3KP6A 4FCYA 5L3DA 4IS1C 1FOWA 3A4CA 1H9TA 2V1NA 3A02A 4DR7E 2N3GA 3RSNA 3AG2H 2NUGA 4F54A 3LSPA 1Z77A 3TQNA 1XC5A 4NZVA 2HXIA 3H9QA 1W36D 2GOXB 1G3TA 1Z67A 3OYFA 2GZWA 3PNTA 4XOPA 2QA4I 3M4OJ 1ZU1A 2EPUA 2BBGA 4NBQA 1RI7A 5AONA 1I6XA 3TP3A 4XKVA 5B66C 3P9CA 3OYAA 2P5LC 2AHQA 1BR2A 2K40A 2RAEA 5BMZA 4HNTA 5B1AH 1MDMB 4KA4A 2W24A 1FX7A 1Z0XA 1L4SA 2YTEA 3PSIA 4IOCF 1SFXA 3L7WA 2HQAA 5T6JA 5LGTA 1T6SA 3WTXC 4A93J 2EN7A 1Y56A 1T08B 1KYZA 4GCVA 4D0PA 2DT7B 4D1QA 1YZ9A 5HVQC 5TGTA 2DW4A 2STTA 2EMCA 2ZMEB 3DF6A 1Z6TA 1X5WA 2YUSA 2YTQA 3NWTA 3SDBA 3UNGC 2WAFA 2Q2EA 2W85A 2M4KA 1IRFA 5K5RA 4ZYGA 1DGRM 1MBJA 1FY7A 2JN6A 1U78A 2G0EA 4CH7A 3CZ6A 2XF5A 3H92A 2EWNA 1MMNA 2BGCA 1LFBA 3LWFA 1DP7P 3MHSC 3PO2J 3BG5A 2JK3A 3ZP5A 1OISA 3D0SA 2LD5A 9ANTA 1ZAOA 4LG0B 1A1LA 1HKSA 2JMWA 1WPKA 2HEOA 1LB2A 3K1MA 2W48A 1G3WA 4M73A 1VQNI 3E6BA 2P6TA 3PNVA 4FISA 2NVXJ 1PUEE 1YHQI 4P7DA 1GVJA 1N75A 4XICA 1HKTA 1NK2P 2KIQA 3O6BB 4JYKA 2W25A 1WJAA 4A5NA 3WTVC 5LMUE 2ZCWA 1AKHB 5FKOA 5C4XJ 5GPCA 1HCRA 3GTJJ 3HTUA 1USTA 2EMKA 4LOCA 5KVRA 1E3OC 4PJNA 3K1NA 3FK6A 3A0HC 1O3RA 2G7UA 1ON2A 1OCPA 5E8IA 3C6MA 2CT1A 3C3WA 2LOOA 1XMOE 5IT9C 3JAMZ 3BTIA 5EF6A 3UK3C 4RAYA 4AYBN 5E3MA 1ITYA 5CVIA 3EQ1A 3VB2A 1F1ZA 2K86A 1FIPA 2F4MB 3DBLB 4BYYA 2DU9A 3D5RC 3ULQB 2R5YB 1N77A 2K9NA 3KLNA 4DV5E 4XL9A 4L9VA 5KNLA 1V5FA 2L7MP 2LLKA 4I0BA 4MQVA 4QLCU 2V88A 4LFCE 3K2ZA 3JRGA 4BDZA 2EN4A 2LBFB 3WE2A 3LQRA 2V6EA 2X1CA 4ZDPA 4M71A 4IL6C 4NNJA 3BDDA 2V1XA 2DXIA 3RKQA 5AE2A 3D5LA 2EMBA 3G71I 1FEXA 3KEYA 1G4DA 2ZFUA 5IWAE 1YE9A 3CUOA 3V42A 2JSCA 2ZBKA 1RUOA 3OV8A 3IWFA 1JUPA 1S9HA 2M9HA 1BB8A 5E20A 3HKZA 3U9GA 2DK8A 4I8OA 3MHHC 4L9TA 1D0XA 3S16J 1D0ZA 2E1MC 3MEXA 3OYMA 1HC8A 2WB1N 3EPHA 2D45A 2QKMB 1G6NA 2VBXA 4D5FA 5D5VB 5EDNA 3TDUC 2L0KA 4XRSA 4HRIA 3OSFA 4HBLA 3C6KA 3O3KA 2FJ1A 2FMLA 2IS4A 1SAUA 4JX6A 1M1EB 1PVEA 3G3ZA 3HRSA 5D8KB 2BHZA 2W7NA 1DU0A 2RQPA 3CMAI 1Z1BA 2WV0A 5D5WB 1XDUA 2GLIA 2D1VA 3ECOA 2MW8A 3QPSA 3OMLA 2ZSIB 3KLOA 2R7XA 2VI6A 1YYWA 4NHJA 2PLYA 1X1CA 4HV5A 2IA2A 5E8GA 1AWCA 1P6RA 4IVNA 2R7WA 5TSEA 4BY1J 4BCAA 4DKKA 4IHWA 5IOYA 2ME0A 2IJLA 1VQ4I 3IKTA 2PN6A 3T0YA 5FJ8J 2V9KA 4XN3A 4YG2F 4Q48A 1KQ8A 2PMZA 4A0ZA 2DMPA 2KIUA 3BLYA 4UUSB 2XPUA 4U7DA 5M3FJ 4MO7A 1P7IA 4A6EA 2XSDC 1RC7A 1DGCA 1EH6A 3HRUA 5C44J 1B6AA 1ETYA 1P2FA 1MJBA 4X1EA 1ULYA 1X48A 4AYBA 2HWVA 2CUZA 4L0YB 2EOJA 3GX4X 3ABMH 3UKGA 1ZG5A 2RV8A 1YRNA 3CUQC 3OS0A 4RGUA 2VE7C 1T33A 1NH3A 1S72I 4HF0A 1TN9A 2VQCA 3H35A 2EIJH 3BR1A 4ZC3A 2YR2A 4UVCA 4BDYA 5E3NA 1FBUA 3G6EI 1ZELA 4YIIA 3NQOA 3BG3A 1A31A 3OYDA 1YW9A 3BP8A 2H8RA 2V79A 1A1HA 2KJBA 3KYDB 2O7OA 1MMGA 2N8XA 3QU6A 5F3WA 1Q1VA 2DODA 1XS9A 2ISZA 4BQQA 5FLVA 2P0WA 3OYGA 3J7Yp 3H5NA 1T56A 1X19A 4NB5A 3I4PA 2VJ5A 5AC5A 2OZ6A 2OZUA 2LJHA 3AAFA 2Y2ZA 2OA4A 3ECHA 1G8XA 1PJRA 3K10A 4LK1F 2CQQA 1JE8A 1MIJA 4OIRF 1YPNA 4Y52J 2K4BA 2V26A 5F08A 4HQEA 2V85A 2P8TA 1BC8C 2QBYB 3HTSB 2M30A 3RZDJ 2UUCE 2ADRA 3TOBA 3J81Z 3PIPF 5FRMA 1UB9A 2V7FA 2LE2A 4PCQA 2E2IJ 2LKXA 3JRDA 1LNWA 4RS8A 3ZCOA 3FXUA 4HLYA 1YO5C 4MEXF 1KU9A 1WI3A 2KRFA 4ENMA 1ETOA 3RPUD 2XAUA 4JBAA 1XD7A 3CO6C 3PSFA 5DCFA 2ODRC 2LP0A 3V7SA 2X4HA 1GVDA 2E36A 2O8KA 2M4IA 3DTKA 3WU2C 2HDCA 4GXOA 1QHHD 3WTTC 2Z99A 3BQYA 2P7CB 5FRNA 2RTXA 2M7AA 2A6HF 4P55A 2EOHA 4A3LJ 2L2KB 2Q0OA 1X1BA 1MDMA 3JW4A 3OL4A 4HF2A 4HNUA 3TKYA 2YSRA 2HJJA 4X0GA 3G1LA 4GO1A 4MEYF 2M1SA 4JI1E 2LSOA 1N36E 5LHGA 2FOWA 3WG7H 3T1BA 1EKEA 2XPWA 2ZMEA 1ZG1A 1IDYA 3OTOE 1QHGA 4OX9E 3S17J 4O3MA 2OTJI 3W2AA 3OYNA 3MVPA 3DCFA 2BHYA 3DKWA 2HC5A 1RKWA 4FK5C 4IRHA 4A0YA 1MNMC 2VC1A 3HIFA 2D9HA 1PYVA 5LHHA 2FMYA 1K78A 2LR8A 4N4NB 4PJLA 1APLC 1ZRCA 3SZTA 4M9VC 3KFWX 3FDYA 3CC7I 1WJEA 3AFHA 3ASOH 1ZQ3P 2VC0A 3CCLI 1J9IA 1J0RA 4QSHA 2R7SA 2DI3A 2E5NA 3K4NA 2GXAA 1UG2A 3ZGKA 2M7QA 3M7GA 4HDUA 3N97A 4KIGA 4PJ0C 1IUYA 4TUGA 2QWWA 1ZBTA 1TT0A 1LEBA 4XK4A 3X2QH 1I5ZA 1FMVA 2DFFA 3SDGA 2Z2SB 1IN5A 4FHTA 3J81K 1AKHA 4P9FA 2LREA 3CDHA 5FGMA 1S7OA 3H3ZA 3O8GA 1K6OA 3GWZA 2QQ9A 4EGZA 1E2XA 3F9KA 3M99B 2RS6A 2WBSA 4NDLA 4BJ6C 1Z7UA 3OYKA 4RLQA 3TEDA 1BIAA 4A6DA 3P9KA 5LHIA 1MH3A 1R7JA 3HOTA 3CQZJ 2HNHA 2GOMA 3E0JB 3Q0WA 1JTYA 2Z1DA 1WFXA 2DIXA 2VB6A 1W5CC 2V1UA 2XB0X 4M9XA 2EPAA 2PX9A 5LL6R 3V4GA 4R2DA 4ENNA 2FSWA 2D5VA 3LMLA 5H6RA 2P5VA 2WAEA 1JT6A 2CQNA 5IT3A 4N9IA 1XNQE 3LSGA 2PQ8A 2LBFA 2FBIA 1D8JA 2H1LA 2EM9A 1YX3A 4Y7NJ 5H6QA 4LK0F 4DQ2A 4UUVA 4F9CB 3LAPA 2WC2A 3ONQA 3L2CA 2LYCA 2RSMA 1EH8A 2VONA 2ICWG 2LJUA 3BC8A 4E7IA 1B72B 1SVOA 2Z3YA 3BJ6A 2R7VA 4DR5E 3HTXA 4XRSG 3D1NI 2QVOA 3UR3C 1HNXE 1A04A 2MSYA 4U0YA 3NAUA 1MKMA 2DFEA 1A6IA 3R0AA 1QRYA 2J5PA 2M5WA 3E7LA 4OMZA 3K7AJ 2OV7A 3K69A 1U9OA 4WFTA 1A1FA 4AVPA 1T4OA 1X49A 2Y30A 1HDDC 1NG6A 5E1WA 4B44A 2EJ4A 1UMQA 4I98B 1WI9A 5D5XB 2ENAA 4P5OA 2HOSA 2IEKA 4R2CA 1JHHA 1YW8A 2VJ4A 1TT5B 2EM5A 1G3YA 4OWRB 3CCVI 2K9LA 5BQTA 1K61A 3CF5F 2EQ0A 5AASA 4ZDOA 1OLTA 3DKXA 2QLZA 3GLXA 1ZR4A 3PQJA 4UB6C 3E5QA 2O03A 4A3EJ 2EA4A 1TW2A 1OR7A 2XAJA 1W5SA 3IH4A 5JHUA 4JI4E 3S3NA 3PFIA 3G1MA 5D4SA 4KFCA 2EV0A 1MGTA 2VKHA 3ECRA 2HI3A 2MLKA 4WCGA 4KWYA 3JRIA 2EPCA 5E3LA 4OAZA 3ZQQA 3Q3SA 1DU6A 1BN5A 4E4HA 4DR4E 3FZVA 4UUSA 4I99C 4G6TB 4HAMA 2EOZA 2L7KA 4M2ZA 3IL2A 1YTYA 4II2A 4BHCA 2PRTA 4R79A 2EQ3A 4JYAE 5GPAA 3AL0C 3R0JA 2VJJA 1H0MA 2HDWA 3B02A 4DZPA 4RAZA 1D1AA 5ERIA 3MKZA 2ECCA 2NS7A 3PUBA 5KAFC 2E1CA 2VE9A 2VKEA 1YOVB 2FBHA 1YS7A 3CCSI 6PAXA 5KK1A 5B5EC 2ADUA 4HOBA 4B3AA 4PK4A 3OOUA 3HDDA 3F3XA 2HFHA 1KZHA 3KEQA 1XGSA 2DBBA 4Y13A 3H9GA 4XKWA 3BF2A 4G8XA 4DBRA 3V8KA 3VFZA 2XPVA 3WTSC 2CMPA 4KMFA 3QP6A 2LTPA 4CZCA 3JRCA 1D0YA 4FX0A 2CWEA 3G73A 1ZHFA 1XB4A 3QP5A 5DUKA 2KZVA 2IS1A 3MKYB 1ZGAA 2DA6A 3JTGA 3HOWJ 4IRGA 2ESNA 3RZOJ 3K70C 1ZR2A 1FOYA 3ABUA 2VQHA 4BJTA 3PJRA 5LEJA 3ZQLA 4ZTFA 4CA0A 1Z7LA 4ON0A 5E1ZB 1HDPA 2CSOA 1FP2A 1SD7A 1X4PA 2BXZA 2X85A 4RM3A 3MSWA 1JJ6C 1BBYA 1Y0UA 2VXZA 1FJGE 2L6MA 2QBYA 1R00A 3M8JA 1O4XA 2LT7A 1JI8A 3SHFA 2VLAA 2LMZA 2A3SA 2VKVA 4PZJA 2B9DA 3FKIJ 5IP9J 3MKWB 1D1BA 1IRGA 3EUAA 3WU0A 5M5YJ 2IA1A 4X64E 2VF1A 4MLOA 2XUBA 3HXLA 3JRFA 3CCJI 3H0DA 3AG1H 2X0LA 3Q9SA 2KHMA 3JR9A 4GFBA 4GKKE 1O3QA 1NCSA 1YUIA 2JPAA 2LF8A 1S5LC 2EN1A 1NG7A 2FGGA 5J4VA 3EYYA 3JTZA 4EV0A 3U1KA 4M6YA 1HR0E 1D1CA 4YELA 2Z33A 4BY7J 4I01A 4A5MA 1TF6A 1JKQC 2CRGA 2MKNA 4EM0B 4W97A 1XGOA 2BYVE 2EK5A 1Z6RA 5E17F 1VQ8I 1UFMA 2EPNA 2L9SA 3BTJA 2A5WA 3I53A 5HDGA 4RMNA 4S05A 5HNFA 3L2QA 5HS7A 2WV1A 3GTGJ 2KRHA 3BR2A 2MC4A 2EFPA 3OYBA 3CO7C 2FQ3A 2OUMA 5JHFA 4HX4A 1MD0A 2ENCA 2PBIA 2YU8A 3MZ8A 2BBYA 2MBFA 1HLVA 2GAUA 2HTJA 1ON1A 3MWMA 1PUFA 2Z16A 4HW0A 3L2WA 2EM8A 3EUHC 4U87A 1VQKI 4XRMA 4JI0E 3MMYB 4ESJA 1I1GA 2B0LA 2WBUA 3AKZA 3VYRB 4B3XA 4U0VA 2YTDA 1FYLA 2XHKA 2H6BA 1I94E 2LY1A 1R1VA 5GAGJ 1B9MA 4R8OA 1OYIA 2CSHA 3J7AG 2XRLA 4B47A 2RVCA 2HYGD 3H36A 2IGNA 2DYRH 4BU2A 1JXSA 2DA4A 1PJSA 3QPTA 3ZQFA 2WY7Q 4HX8A 2EFNA 3QODA 1MH4A 1H8AC 3I58A 5F1RA 2Z9OA 5HS9A 5ILVA 3RQ4A 4XLPF 2NUFA 1RPWA 1VI0A 4MFDA 3LA3A 1V5EA 2FU4A 4DUZE 4QWQA 5J3LA 3KX2A 1IV6A 5F27A 5FKMA 4HEA2 3MQ0A 2A69F 4M0VA 2TCTA 2P4WA 3BROA 3JRHA 2HYJA 5ICFA 1T0FC 2HVRA 3GTLJ 2UXCE 2E7XA 5CVRA 2QM3A 2F2EA 2EPPA 3H5AA 3I4NJ 3CJTB 2JRTA 5CQGA 3ZMVA 3ZMSA 2E2JJ 3HOUJ 1HF0A 4A3FJ 2UV1A 1UZCA 3I59A 4WPYA 2EZKA 4RGRA 2EM3A 1MSFC 2X6WA 3Q0VA 1GZ6A 5E3OA 2EMGA 1IRXA 2M34A 1ONVA 1VF9A 4LGWA 2A61A 3DKYA 1J5EE 1IN7A 4K2EA 5EJCA 3BZCA 4EGYA 4F3QA 3HYIA 1FLIA 1ACIA 1V4RA 4F2JC 1QA6A 4LITA 4U0WA 3ERED 5DD8A 1ZH5A 2MC5A 2DOAA 3LAJA 1LLMC 5L3GA 2X6YA 5CVJA 2L2OA 2EL5A 1ZKGA 1B72A 2ZJ2A 2CYYA 4GYIA 2RQLA 4B48A 4HNVA 3S2HJ 2MDRA 5D6EA 3OYLA 4ETSA 4AVZA 1FIAA 5LBQA 2STWA 3I64A 2KPMA 2EPRA 4KN4X 3U21A 2WBMA 5K7FA 3ZRGA 2ZXWH 3CD6I 2W84A 3IWBA 4MFEA 1H89C 1WHQA 3J81C 2HZDA 2DGCA 1GV5A 4OOGC 2LF7A 2LY2A 1K83J 5HLGA 5ICEA 4CCJA 2QZ8A 4XR6A 4HDVA 2RS7A 2OTLI 2KT0A 3TO6A 3HRTA 5DV5A 5ILSA 1S6LA 3KZIC 4B3SE 2QQ8A 4F9BB 5K7ZA 2MFZA 1K78B 2YT4A 2YTIA 4BNCA 3WGGA 3OYEA 5LMNE 4ESBA 4ZYDA 2E5LE 3JREA 4E7LA 2JTVA 3I9V2 1YS6A 2K3FA 5FLXZ 1JUMA 3RDIA
chains in the Genus database with same CATH topology
3EETA 1O3TA 2UZKA 1BJAA 3ZMUA 4EMSA 3F22A 3GYHX 3KP3A 2PMUA 1IN8A 4S04A 4I02A 1XSXA 3IHUA 4YFNF 2CFXA 5DCMB 4MGRA 2MA3A 4KNYA 1MJAA 3DV8A 1BI0A 3F72A 5ICCA 2XROA 1BC7C 4HYEA 3DFGA 4NQWA 2W57A 1ZREA 4L9NA 3VEPA 1ZRDA 1OYWA 2FXAA 3RKXA 1W7PB 4RB0A 4Y15A 5CLSA 1SD4A 5AIPA 2COMA 4JK1X 1WSUA 3ZMTA 2PG4A 1U5TC 3Q5FA 3I0TA 4F7ZA 4OOIA 5FLXK 3U2RA 1S29A 5HDKA 2RC4A 2M87A 4HQMA 2EA2A 1IN6A 4Q4ZF 2XGXA 1RZ4A 2O8XA 1U6GA 3GFMA 3TO7A 3LQQA 4G7HF 3GXOA 5K5QA 1B1BA 1BOAA 4PGHA 4IHSA 1HXDA 3HSEA 2PI0A 3JAMK 4OMYA 1STZA 3V8JA 2HS5A 2XKPA 1R5GA 3TO9A 1AOYA 4EJTA 4IXAA 3TDZC 3DQVC 3TGNA 1YIOA 1ZYRF 2A6EF 2A07F 1FSHA 4AIKA 2K7LA 5HOOA 5A2QZ 3GFLA 1BM9A 1FSEA 4GYGA 1O57A 2FNAA 4MNUA 1FYKA 4M72A 5CYVA 1OKRA 3FF5A 3BJOA 5F6FA 4Z2YA 4EJVA 1WQ2A 3DP7A 2A5YB 3C7JA 2NNYA 5E1XA 1R22A 1TNTA 4AD9A 1SD5A 1J5YA 1FC3A 1SMYF 1FBQA 2NAZA 3BY6A 4WXHA 1HW2A 4RB2C 3JTHA 1Z9CA 3KP5A 3IRQA 2E7WA 1YW7A 2XKOA 1YQAA 3FM3A 5ICGA 3C18A 5L3BA 4OIOF 4O5VA 2H09A 3C1DA 3RIRA 3RPQA 3GFJA 4CXFA 2JPCA 3J80Z 2F5EA 2IP2A 3RJPA 4CO8A 1FYMA 2QUFA 1BI2A 2HYFA 2EFOA 3HHGA 2PMHA 2KIFA 1E17A 5A2QK 1XCBA 4UXNA 2VBZA 1XMKA 3MZYA 1TLHB 2KJCA 2YX4A 3WE3A 1YYVA 3FWEA 1IZ1A 3KP4A 4KMUX 2DQRA 4RGSA 3WU1B 1LDKB 1LDDA 1W7PD 2MH2A 1J2XA 3KZZA 4CGZA 4A2UA 1W5TA 1L0OC 4G94A 3SXYA 4LB5A 4WXCA 2EFWA 1PP7U 2TDXA 2CG4A 4KDPA 2CQKA 2GQQA 4I09A 2EV6A 1XN7A 2OBPA 4BH9A 4KT5C 4U7BA 3KE2A 3I71A 3J80K 3RTRA 2MH9A 3DEUA 5DCMA 4B09A 3I59B 3GEZA 5J8CA 5FB2A 1TBXA 2JPBA 2Y0MA 2NS0A 3T5XA 2DPUA 1TTYA 4A0XA 1XCVA 4UNOA 1W7PA 2HZTA 2O61A 1IXCA 1SD6A 5JI6A 4MHGA 2V9VA 1KU3A 3NRVA 3SQNA 5HDNA 2KKOA 2DLLA 3E6MA 3NEUA 4G6DA 5TRDA 4CDGA 2Q8KA 1DDNA 1KQ0A 2ETHA 2OU2A 5TJJA 3GO5A 2FNPA 2AXLA 3HOSA 2LNBA 1HQCA 3FHZA 1RUNA 4HF1A 3I54A 1ZARA 2CW0F 1EV7A 3ROUA 4BHPA 4LD5A 3F6OA 2J5OA 3ABTA 3GUDA 4AIHA 3IRRA 1O7LA 1P4WA 1JHFA 1P92A 2D2WA 3F21A 4HLXA 3HUGA 1LDJA 3WTZA 2XVCA 1T2KA 1TQPA 4JQFA 5LGUA 1HW5A 5JVTA 1LJ9A 2XAGA 5LEKA 2OAZA 4I7HA 2GWRA 3COAC 4P96A 2Y75A 3S2WA 1KYWA 3T8TA 1F5TA 4ASNA 2DTRA 4LJZF 2BE5F 2VBWA 3K1PA 3ZN1A 4KIBA 1TQIA 4FT8A 5K1YA 3DF8A 5DUIA 3ZPLA 1T39A 2CO5A 4FX4A 3W6JB 3MZHA 4WWCA 4YFXF 3FMQA 3RYRA 1P4AA 5JR3A 4HA8A 4HZFA 3RI4A 2YU3A 1U3EM 3E97A 4O6JA 4WXDA 1ZG3A 1IW7F 4TV7A 2VT3A 3F8FA 2RDPA 3VODA 4Q47A 4ZYEA 2C6YA 1FZPB 2XAQA 3KCCA 2F5FA 3GZ6A 5BPDA 4KN7X 3B73A 3ZN0A 3N4MA 3ZMZA 4BAYA 3RYPA 4R8HA 5L3EA 3PQKA 4WK8F 5EEGA 3BPVA 4OIPF 2O6GE 1I27A 1U8RA 5DDGA 5D8LB 2VODA 1FOKA 1R36A 2IA0A 3JSPA 3BJAA 3HHHA 4E70A 3IKVA 3F8CA 2FF4A 4LMYA 2GIVA 5FD5A 3IWZA 2XV4S 1HSTA 1GXQA 3R4KA 3M9AA 1IAWA 3QPHA 1QNTA 3SZPA 4G7ZF 2FRHA 2DFIA 4M9ZA 2ACJA 1C0WA 1QQIA 2XAFA 4LB6B 2WWYA 1USSA 2HKXA 2QQBA 4B8XA 3V7RA 4L5IA 4IJAA 4RB1A 1ZN2A 2UXXA 1ODDA 3HRMA 2ESHA 2AS5F 2E1NA 3LSTA 5CVUA 2M45A 4U88A 5BOXA 3M8FA 5DEQA 4ZH4F 1FWZA 5FFZA 3E5UA 2Z5UA 1GHCA 5J8FA 2PEXA 2OD5A 2RNJA 2L3DA 3WTWC 1XSDA 5E18F 3P9IA 2O3FA 2FEZA 2HR3A 3E6DA 2K02A 2JZYA 2IT0A 3RKWA 5FO5A 5D4RA 4ZYHA 3KZYA 3R61A 1FPQA 2YX7A 1FNNA 1B4AA 3GZ5A 2V6CA 2WTEA 3IC7A 2VT2A 2L01A 4OIQF 1HW1A 3F8BA 3FXRA 5L3FA 1BI1A 4CHUA 2L4AA 3J7AO 4OU0A 2DK5A 1YG2A 3LA2A 1CF7A 1Z1DA 3ZQ7A 2DAOA 2DT5A 2D1HA 4EVIA 2FE3A 3QU3A 3GFIA 2JT1A 4CZZA 2H6CA 2IW5A 1ZRFA 4WF2A 1KQ9A 4EM1A 1B9NA 3QOPA 2GA1A 2ZNZA 1R23A 4IHTA 1W4MA 1U5TA 3LA7A 4IPAA 1HKQA 2QYOA 4XBFA 3FMRA 2K27A 4DNCA 4IF4A 1UCRA 1J75A 2IVMA 2NNNA 4ZZLA 2M8EA 1EH7A 2RKHA 3OOPA 1NHAA 2ZNYA 4EJOA 5FD6A 3CJNA 1YLFA 1Z05A 2GA2A 4XSZF 1IN4A 1U2WA 5DYMA 4XRFA 1FBSA 1HSJA 1MZBA 3MAJA 1I1SA 3V8LA 1OMIA 1UHWA 3CUQA 2DO7A 2EFQA 3WTYC 4XLNF 4P9UA 3LFKA 5L3CA 3R6SA 3FM5A 2HQRA 3GVAA 3JSOA 1XSVA 2XASA 4I2OA 5D6FA 1LQ1A 1J7KA 2HGCA 3BPXA 1IXRC 1QGPA 3KP2A 4KICA 1RIOH 5AIQA 2HKOA 1IF1A 1ZGJA 4OINF 1TW3A 1WKMA 3REOA 5LLQA 1OPCA 4ENKA 3QAHA 4BQAA 2XRNA 3RKYA 3ZMDA 4MTEA 1SFUA 4Y17A 4IRIA 2VOPA 1XGNA 2V1DA 4MTDA 2RN7A 1BIBA 1D8KA 2M1BA 2UWMA 4KYWA 3F8NA 3E6CC 1R1UA 1J59A 4KIFA 3TOAA 2VOOA 2GXGA 1SMTA 1HBXG 3SFZA 2FBKA 2EV5A 2H27A 1QZZA 5FFXA 4XSXF 2VE8A 5H20A 2VBYA 2KIMA 3FX3A 2IRFG 1B59A 2HQNA 1WWXA 5LRSA 2L4MA 1REPC 3DPLC 3M1EA 3WG9A 5IT9Z 4EQQA 3Q9VA 1K79A 4MQ9F 5J6XA 4L18B 4M74A 2NYXA 4LG0A 1DUXC 1RNLA 1IXSB 3RPUA 3V7CA 4M9SA 3DXJF 2PFBA 1QO0D 4EJUA 2ZO4A 1TNSA 1QBJA 2ZFWA 4L5JA 4UVAA 2LKPA 2FA5A 3CLOA 1PDNC 4L0ZB 1H9GA 4PGGA 4LFUA 3O2PE 4WX9A 4H0EA 3EDPA 1TQMA 3WTUC 4LLLA 2FOKA 2R7DA 2G7HA 2R3SA 4LLNA 1F9NA 1R58A 4I0AA 2MD5A 1BI3A 1P4XA 1R5HA 5BPIA 1GXPA 2F5DA 5K5OA 5IT9K 1O7FA 2YPRA 4ENJA 4UV8A 2HOEA 3H3UA 1VTNC 3ELKA 1UHMA 2MLGA 2GXBA 2DPDA 5CVVA 3ISPA 5ILUA 1WRJA 2CGPA 1KA8A 1LVAA 2QENA 2VN2A 3F6VA 2EB7A 2P7VB 3F8MA 3F23A 1YFHA 4M6XA 3EYIA 4G7OF 1G3SA 4CICA 1D3YA 2G9WA 3HSFA 2BV6A 1DPRA 3L9FA 4G9YA 1T98A 2QQAA 4R1HA 2L54A 5EEHA 4G6QA 2H94A 4UHTA 1KU2A 1XDSA 4GGGA 1CF7B 2O0YA 5ED4A 3ML6A 2XIGA 3GW2A 2P6SA 3U1DA 3BZ6A 2F5CA 3P7NA 2K4JA 4HX7A 3WGHA 1R1TA 1XGMA 5DD4A 4LLGF 5D5UB 2RGVA 1Q1HA 3CTAA 4BHBA 1U5TB 1LEAA 4N9HA 2LDUA 1K7AA 2HTSA 3WODF 3M8EA 4Q5SF 1KGSA 1KU7A 1T38A 1QZYA 3QRFF 1L3LA 1V3FA 2IPQX 2UXNA 4KUMA 3T8RA 3BOQA 3FMSA 1D5VA 2R7FA 5LGNA 1O3SA 4ZZDA 4YIFA 1F4KA 1XMAA 2BEOA 2Y48A 2ZKZA 5LRRA 5HLHA 4AWXB 1ZLJA 4EM2A 1JGSA 4EJWA 2OQGA 3DPTA 1X3UA 2DQLA 3L09A 2OQRA 3R60A 2ZXJA 3BWGA 2ISYA 2ELHA 3I5UA 1PP8F 3CUQB 1QPMA 4CYDA 4YFKF 3WGIA 1S3JA 5F64A 1OYYA 4PDKA 3EUHA 2XAHA 1CGPA 3W6KB 3FXQA 2A68F 4L9JA 3L00A 4ESFA 2P5KA 5HLIA 1MJ9A 5JFRA 4RB3C 2PJPA 1ZLKA 3KEOA 3HSRA 3K9TA 2MC3A 1DPUA 3KP7A 1Z91A 2NRAC 2EJRA 1SFEA 3MFKA 3K0LA 3VOEA 4N0BA 3KETA 1T0FA 3E3VA 4A12A 3GF2A 4UVBA 1SAXA 2L02A 1FT9A 1S8NA 3E5XA 3EQLF 5BS6A 1FP1D 4UV9A 4AIJA 5HS8A 4BXUA 5CJ9A 1S7AA 4RGXA 4HV6A 3MCZA 3KP6A 5L3DA 1H9TA 3TQNA 1G3TA 2GZWA 1RI7A 5AONA 1I6XA 3P9CA 2P5LC 5BMZA 1MDMB 4KA4A 2W24A 1FX7A 1SFXA 3L7WA 5LGTA 1T6SA 3WTXC 1KYZA 4GCVA 4D0PA 5HVQC 2STTA 2DW4A 2ZMEB 1Z6TA 2Q2EA 2W85A 1IRFA 5K5RA 4ZYGA 1FY7A 1U78A 3H92A 2EWNA 2BGCA 3LWFA 1DP7P 3ZP5A 3D0SA 1ZAOA 4LG0B 1HKSA 2HEOA 1LB2A 3K1MA 1G3WA 4M73A 3E6BA 2P6TA 1PUEE 1GVJA 1HKTA 3O6BB 2W25A 4A5NA 3WTVC 2ZCWA 3HTUA 1USTA 5KVRA 3K1NA 1O3RA 2G7UA 1ON2A 5E8IA 3C3WA 3JAMZ 4RAYA 5CVIA 3VB2A 1F1ZA 2K86A 4BYYA 2DU9A 3ULQB 3KLNA 4L9VA 4I0BA 4QLCU 4MQVA 3K2ZA 3WE2A 3LQRA 4M71A 3BDDA 2V1XA 3D5LA 1G4DA 3CUOA 2JSCA 2ZBKA 1RUOA 3OV8A 3IWFA 5E20A 3U9GA 2DK8A 4L9TA 3MEXA 2D45A 1G6NA 2VBXA 5D5VB 3TDUC 4HBLA 3O3KA 2FMLA 3HRSA 3G3ZA 5D8KB 2RQPA 2WV0A 5D5WB 1XDUA 2D1VA 3ECOA 3KLOA 4NHJA 2PLYA 4HV5A 2IA2A 5E8GA 1AWCA 1P6RA 4IVNA 2IJLA 3IKTA 2PN6A 3T0YA 4YG2F 4Q48A 1KQ8A 4A0ZA 4U7DA 2KIUA 4A6EA 1EH6A 3HRUA 1B6AA 1P2FA 1MJBA 1ULYA 2HWVA 4L0YB 3GX4X 1ZG5A 2RV8A 3CUQC 4RGUA 4HF0A 2YR2A 4UVCA 1FBUA 4YIIA 3NQOA 1YW9A 3BP8A 2V79A 2KJBA 3QU6A 2ISZA 4NB5A 3I4PA 2OZ6A 2OZUA 3AAFA 2OA4A 3ECHA 4LK1F 1JE8A 4OIRF 2K4BA 4HQEA 2P8TA 1BC8C 2QBYB 3HTSB 2M30A 3TOBA 3J81Z 1UB9A 4PCQA 1LNWA 4RS8A 3FXUA 4HLYA 1YO5C 4MEXF 1KU9A 2KRFA 4ENMA 4JBAA 1XD7A 3CO6C 5DCFA 3V7SA 2X4HA 2HDCA 4GXOA 3WTTC 2Z99A 2P7CB 2A6HF 4P55A 2Q0OA 1MDMA 3JW4A 4HF2A 3TKYA 2YSRA 4GO1A 4MEYF 2LSOA 5LHGA 3T1BA 2ZMEA 1ZG1A 4O3MA 3DKWA 4IRHA 4A0YA 2VC1A 3HIFA 5LHHA 2FMYA 1K78A 1ZRCA 3SZTA 3KFWX 2VC0A 1J9IA 1J0RA 2DI3A 3M7GA 4HDUA 3N97A 4KIGA 1IUYA 2QWWA 1LEBA 1I5ZA 3J81K 4FHTA 1IN5A 4P9FA 3CDHA 5FGMA 1S7OA 3H3ZA 1K6OA 3GWZA 2QQ9A 4EGZA 1E2XA 1Z7UA 1BIAA 4A6DA 3P9KA 5LHIA 3HOTA 1R7JA 2V1UA 4M9XA 3V4GA 4ENNA 2FSWA 5H6RA 2P5VA 5IT3A 4N9IA 2PQ8A 1D8JA 2FBIA 5H6QA 4LK0F 4DQ2A 4UUVA 3LAPA 2WC2A 3L2CA 1EH8A 2VONA 2Z3YA 3BJ6A 2QVOA 1A04A 4U0YA 1MKMA 3R0AA 2J5PA 2M5WA 4OMZA 3K69A 4AVPA 5E1WA 5D5XB 4I98B 1WI9A 4P5OA 1JHHA 1YW8A 1G3YA 5BQTA 2QLZA 3GLXA 3PQJA 3E5QA 2O03A 2EA4A 1TW2A 1OR7A 2XAJA 1W5SA 5JHUA 3PFIA 5D4SA 4KFCA 2EV0A 1MGTA 2MLKA 4WCGA 1BN5A 3FZVA 4HAMA 3IL2A 1YTYA 4BHCA 4R79A 3R0JA 1H0MA 3B02A 4RAZA 5ERIA 2E1CA 2VE9A 2FBHA 1YS7A 6PAXA 5KK1A 2ADUA 4HOBA 3F3XA 2HFHA 3KEQA 1XGSA 2DBBA 4Y13A 4G8XA 3WTSC 3V8KA 3VFZA 4KMFA 3QP6A 4FX0A 2CWEA 3G73A 1ZHFA 1XB4A 3QP5A 5DUKA 1ZGAA 3JTGA 4IRGA 2ESNA 3ABUA 5LEJA 4ON0A 5E1ZB 2CSOA 1FP2A 1SD7A 1BBYA 1Y0UA 2VXZA 2QBYA 1R00A 3SHFA 2A3SA 4PZJA 1IRGA 3WU0A 2IA1A 2XUBA 2X0LA 3Q9SA 1O3QA 2LF8A 3EYYA 4EV0A 4M6YA 2Z33A 4I01A 4A5MA 4EM0B 1XGOA 2BYVE 2EK5A 1Z6RA 5E17F 1UFMA 3I53A 5HDGA 4S05A 5HS7A 2EFPA 3CO7C 2FQ3A 4HX4A 1MD0A 2PBIA 2BBYA 2MBFA 2GAUA 2HTJA 1ON1A 3MWMA 4HW0A 4ESJA 1I1GA 2B0LA 4U0VA 1FYLA 2XHKA 2H6BA 1R1VA 1B9MA 1OYIA 2RVCA 2HYGD 1JXSA 3QPTA 4HX8A 2EFNA 3I58A 5F1RA 2Z9OA 5HS9A 5ILVA 4XLPF 3LA3A 2FU4A 4QWQA 3MQ0A 2A69F 2P4WA 3BROA 5ICFA 2E7XA 5CVRA 2QM3A 2F2EA 2JRTA 3ZMVA 3ZMSA 3I59A 4RGRA <