5LLQA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119f variant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPFHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interdomain interactions rearrangements control the reaction steps of a thermostable DNA alkyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5llqA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 5llqA01
5FGMA 4EJWA 1CGPA 2CG4A 3SZPA 2HQNA 1SMTA 3R61A 1ON1A 3BJAA 2FBIA 3ABTA 2F5DA 2FNAA 2UZKA 1JE8A 5HLGA 1J75A 2O03A 5FFZA 2MBFA 3LA7A 5EEHA 3F23A 4A0XA 4HV6A 2ISZA 3ML6A 3K0LA 3ZP5A 2ZXJA 3I59A 4GCVA 2EFOA 1FLIA 2GQQA 3T8RA 3N4MA 2EA4A 2V1UA 4ZYEA 2XKOA 3WE2A 3B02A 3GX4X 1XMAA 1Z6RA 3F3XA 3COAC 2UWMA 3CUOA 3GWZA 2E7XA 2RQPA 3MFKA 1H0MA 4HQEA 1R58A 3RYRA 1O3RA 3DEUA 1USSA 2DPUA 1S3JA 5JI6A 3M7GA 1XCVA 2YX4A 4BYYA 3FMRA 3HOTA 2EWNA 2W57A 1KU9A 4EJUA 2L4MA 1O3TA 4HLYA 3BROA 3TOAA 1UFMA 4L9NA 4FX4A 4IXAA 4ZYDA 4JQFA 4N0BA 5DYMA 4YG2F 4WWCA 4G9YA 1ZLJA 3R0JA 1PUEE 1B59A 1ULYA 2P5LC 2R3SA 4L0YB 2H09A 5E1ZB 3CDHA 5DCFA 1FX7A 2BBYA 3DP7A 1SD4A 4Q48A 4A5NA 3VB2A 3OOPA 1ONVA 1I1GA 1JXSA 4P9UA 4RAZA 3VOEA 2VXZA 2ZNYA 3I59B 1G6NA 4I98B 2XAHA 3C18A 3VODA 2QBYA 1IUYA 3DQVC 3GLXA 4R79A 1KU3A 2COMA 3TOBA 1HW2A 5BMZA 4IRHA 3WGIA 3KZZA 5D4SA 2GIVA 3E5XA 4Y13A 5E20A 4I0AA 2Z99A 5CYVA 1K78B 2FBKA 3WTYC 4L9TA 2ETHA 1MJBA 3K1MA 4BHBA 2LDUA 2FNPA 3E6CC 2HKXA 3RYPA 2E7WA 5DD8A 2VE9A 1NHAA 2HWVA 2J5PA 1U5TC 4RAYA 2K02A 2HQRA 3CO7C 2HS5A 1QNTA 5BOXA 3F8NA 1YO5C 5FLXK 4U0WA 4LMYA 2GXGA 4EJOA 4U7DA 2G7UA 2DLLA 3K2ZA 1W7PB 2FF4A 2F2EA 2W25A 5JR3A 4ENNA 4RS8A 2RV8A 1T98A 2LNBA 3MWMA 1YG2A 3V7RA 1XDUA 1TW3A 2L01A 4EQQA 3R4KA 2YPRA 2NS0A 2VN2A 5K5OA 2CO5A 5H6QA 5CLSA 1QBJA 2Y75A 2IVMA 1Z7UA 1V4RA 3MQ0A 1LVAA 1KA8A 4A0ZA 1YW9A 1P4XA 2Q8KA 4UVCA 4IHTA 3GVAA 4L9VA 3JSPA 4A2UA 2ZNZA 1HQCA 5HS7A 3J7AO 3F21A 4NB5A 4M72A 2JTVA 4ZYGA 3KFWX 1ZGJA 4EMSA 1KU2A 1HSTA 4HW0A 1OYWA 2ACJA 2GWRA 1T2KA 2BYVE 4M74A 3JTGA 3ZMUA 1WI9A 2Y48A 1EH8A 4XLPF 4BNCA 1PP7U 4ZZDA 2VT3A 2A61A 5LGNA 1P92A 1ZH5A 3ECOA 3GZ6A 1RIOH 3ZPLA 1LQ1A 2VBWA 2HYFA 4HF0A 1P6RA 2WWYA 1LNWA 4WCGA 1J59A 5AIQA 2XRNA 3K1NA 3RTRA 4YFXF 3WTZA 2IP2A 4Y15A 2CFXA 1U6GA 3L00A 3M9AA 4MQ9F 5CJ9A 3WU0A 2FE3A 4Q4ZF 2OZ6A 1RNLA 3GFJA 4LB6B 2EV0A 2E1CA 2WTEA 1MZBA 1IN5A 5D5VB 3KEOA 5ICGA 1BIAA 4G8XA 2M45A 2JPCA 1LJ9A 1GVJA 3EQLF 3O3KA 2P5KA 4CO8A 2DTRA 2EA2A 2OAZA 1TNSA 2CWEA 1G3TA 3F8MA 4HX7A 1MGTA 4AVPA 4BHCA 1FSEA 5DDGA 5F64A 2G7HA 1MJAA 3BP8A 5FLXZ 4LB5A 5HS9A 4ZZLA 3BPXA 2JPBA 4F7ZA 1RZ4A 3R6SA 3HRTA 5LEKA 2GA1A 1W7PD 2STWA 5DD4A 2DBBA 2FOKA 3ELKA 4CDGA 2ZFWA 1FPQA 2IA0A 3BJOA 3I54A 1IN7A 2DK5A 3V4GA 2PMUA 1ZN2A 2V9VA 3RI4A 3K1PA 4MTDA 3JTHA 4LK0F 3GYHX 1UCRA 1L3LA 1EH6A 2X4HA 2VE8A 4YIFA 4RGUA 4HOBA 3SXYA 2VODA 1WQ2A 2UXNA 4HDVA 4CHUA 2EFNA 1X3UA 5JFRA 3G73A 2EB7A 4M73A 3P9KA 1YW8A 1OKRA 4B8XA 5A2QZ 3HOSA 3DPLC 5JHUA 1GXQA 2ZMEB 1U3EM 1U8RA 4EVIA 5TRDA 4ASNA 1O57A 4QWQA 1FZPB 3F6VA 3T8TA 5JVTA 2QQ9A 1OPCA 2PN6A 5CVUA 2FU4A 2CYYA 4L9JA 3F22A 2VBZA 2GAUA 1XGSA 1HKQA 2RKHA 1S7AA 1SFUA 5ICEA 1VTNC 1SFXA 1LEBA 3HSFA 5HLIA 3LA2A 3WTUC 1Z9CA 1HSJA 1R1VA 1K6OA 4KN7X 3F8CA 1D8JA 4KICA 4CGZA 1FYKA 3T1BA 5LGTA 2VC1A 3T0YA 2D1VA 4HF2A 2H6BA 4P5OA 3ZQ7A 4HX8A 1S6LA 5CVVA 4BQAA 2PJPA 3CUQB 3HRSA 4BHPA 4BH9A 3WTVC 2MLGA 1RUNA 3WGHA 1J5YA 3L09A 3WE3A 2OU2A 4QLCU 3RPQA 5ICFA 4A5MA 1E17A 2XGXA 2DW4A 4O3MA 2Y0MA 3J80Z 2O0YA 4ETSA 2P6TA 2HGCA 3GFLA 4O5VA 4WF2A 1O7FA 2KRFA 1FBUA 1R00A 2STTA 4MNUA 5L3EA 1R7JA 2R7FA 4FX0A 1IW7F 1KQ9A 5K5QA 5D5XB 2M1BA 5HDNA 5IT3A 3E5QA 2L3DA 1YW7A 4LFUA 3CUQA 3PQJA 5ILUA 1F1ZA 3ULQB 1XSXA 1ZRCA 4I09A 4HZFA 1FBSA 3TQNA 1T0FA 1U2WA 4UV8A 2EFPA 1R1UA 1BC8C 3WG9A 5J8CA 4RB3C 4NHJA 1I5ZA 2FXAA 3LA3A 1U5TB 2EJRA 3HRUA 4BAYA 2ZBKA 4LLGF 4WXHA 3SFZA 2CQKA 4HYEA 5HS8A 2L02A 4L18B 4HBLA 5CVRA 3E6DA 1L0OC 4M6XA 2Z5UA 5HVQC 3P9CA 2Q2EA 2BEOA 4A6DA 2DAOA 5TJJA 3FZVA 3KEQA 1WKMA 4L0ZB 3WTSC 1KGSA 3GFIA 2YU3A 1J2XA 1TW2A 1XGOA 1WRJA 2YSRA 4UHTA 4JK1X 2QLZA 2K27A 2YX7A 2P7CB 5E18F 5D8LB 1YLFA 4IRIA 2HZTA 1ON2A 3QPTA 3F8BA 2RC4A 5J6XA 1TQPA 3CJNA 1YQAA 1G3SA 2V1DA 3IWZA 3KP3A 1I27A 1SMYF 2QUFA 4NQWA 2KJCA 3V7CA 2BV6A 4KNYA 4R1HA 1Y0UA 1MDMB 1DPUA 4UVAA 3H92A 3LQRA 1XSDA 3HTSB 4UVBA 3GEZA 2LSOA 3KP7A 3H3UA 1R5GA 3IKTA 2DU9A 1YS7A 1ZGAA 4EJVA 3L2CA 3E3VA 2A5YB 4IJAA 1HBXG 4OIQF 3HHGA 5FD6A 3GZ5A 1PDNC 1P4WA 4UV9A 4ESFA 1UHWA 2PMHA 4EM0B 3IL2A 3KP5A 3LSTA 2HDCA 4HLXA 1G3YA 3MCZA 2MD5A 2O8XA 1TQMA 4A0YA 5F6FA 1ZLKA 4IF4A 1FWZA 3NRVA 4M71A 2IPQX 2O3FA 1R1TA 2ZMEA 3KZYA 1GXPA 3I71A 3GFMA 2AXLA 1BI2A 1FOKA 3E6MA 3RJPA 3GW2A 1U78A 3QP6A 4KFCA 4A6EA 3CLOA 4WXCA 5LHHA 1RUOA 2EFWA 5D8KB 2QQBA 2PEXA 4OOIA 4ENKA 2FBHA 2QM3A 3GUDA 3BOQA 4KMUX 3FWEA 4G7ZF 2A68F 5DEQA 1T38A 2P5VA 4KN4X 1FYMA 4XSXF 1W5SA 2RGVA 3ISPA 1AWCA 4GO1A 3I58A 1TTYA 2V6CA 3F8FA 2FEZA 3MZHA 2HR3A 5FO5A 3CTAA 4RGSA 2QBYB 2Z9OA 4AWXB 4GGGA 2HKOA 1FC3A 2UXXA 2OBPA 4N9HA 2PLYA 3KLOA 3MEXA 4MHGA 2EFQA 3HTUA 4I02A 1IAWA 4Y17A 1O3QA 3BZ6A 2XAFA 3ZMTA 2H27A 6PAXA 3SZTA 4KDPA 1KYWA 3QRFF 3K69A 1P4AA 4MQVA 3WU1B 2K7LA 3C7JA 2FA5A 3LWFA 1MDMA 1HW5A 2A3SA 3BWGA 2JSCA 3R0AA 1BM9A 2E1NA 2DQLA 2ZO4A 1R5HA 5LLQA 4LJZF 3KCCA 2JZYA 5BPIA 2DQRA 1J9IA 4IVNA 5LHIA 2PI0A 1FP1D 3IHUA 5D5UB 2XROA 5F1RA 3WODF 1MD0A 4G7OF 2MH9A 3QU6A 1S29A 1UB9A 1FSHA 4KT5C 2BGCA 3MAJA 2PBIA 5L3CA 4AIHA 3ZMVA 2CW0F 4I7HA 3JW4A 2J5OA 2Z3YA 3FM3A 2K4BA 4LD5A 4N9IA 1SD5A 3I64A 1HKSA 4EGZA 5LEJA 3T5XA 1BJAA 3HYIA 4U7BA 4OMYA 2BE5F 2WC2A 4L5JA 2LF7A 1BC7C 5L3BA 2XASA 2HEOA 4KUMA 4LG0A 1E2XA 1BN5A 4OIRF 2KIUA 1RI7A 3D0SA 2XIGA 1HXDA 3H3ZA 3U9GA 1CF7B 3W6JB 1Z91A 3DFGA 4P55A 1J0RA 3E5UA 4RGXA 3IC7A 1IN8A 1USTA 3NEUA 4CXFA 2DK8A 2F5FA 1JHFA 1ZYRF 4XLNF 4Z2YA 3EDPA 1OR7A 1HKTA 1G4DA 3JAMZ 3DV8A 3MZYA 1IN4A 1HW1A 4ESBA 3V8LA 5E1XA 5E17F 4M6YA 1OMIA 4H0EA 4HDUA 1R22A 3J80K 2DFIA 2JT1A 2ELHA 3L7WA 4LG0B 1S8NA 4EM1A 1QGPA 1EV7A 2VOOA 2IA2A 4ENJA 2FSWA 4RB1A 4KIBA 1QZZA 2HOEA 1IN6A 4OMZA 2H94A 2L54A 3ZMSA 1KU7A 3Q9VA 4A12A 2A6EF 4WX9A 4OINF 1H9TA 2O61A 1I1SA 2FMLA 2EV6A 2F5CA 2HTJA 2OZUA 3WGGA 5H20A 1TBXA 1WSUA 3TO6A 2O6GE 2P6SA 4ENMA 1KQ8A 3ZN0A 4EM2A 3NQOA 1K7AA 1BI3A 4UXNA 3ECHA 4TV7A 1B4AA 1ZREA 1QPMA 4UNOA 3U1DA 2IJLA 4IHSA 4S04A 1IXRC 3TDUC 3I0TA 1IZ1A 2PFBA 4WK8F 1JGSA 3HRMA 2ISYA 3FXQA 2A07F 1DUXC 3RKWA 2IRFG 2QWWA 5AIPA 2K86A 4CZZA 4RB0A 1MKMA 3TO9A 3WTXC 1OYIA 1SFEA 5ILSA 1ZG5A 2XHKA 4YFKF 3FMSA 4Q5SF 2H6CA 1K78A 3ZN1A 2IT0A 3TDZC 2Q0OA 4GYIA 2XKPA 5L3GA 1BIBA 3BJ6A 4JBAA 1FY7A 2GA2A 1REPC 3KP4A 3DKWA 1SAXA 5BS6A 4B09A 2FMYA 4EGYA 4EV0A 2W85A 5EEGA 4PGHA 4PCQA 2IW5A 2X0LA 2MH2A 1QQIA 1WWXA 3P7NA 1IF1A 1LDJA 4AIJA 4BXUA 2VONA 2WV0A 4HA8A 5DUIA 1OYYA 5D6EA 1YYVA 1U5TA 3GO5A 1R36A 2C6YA 2NAZA 2QVOA 1TLHB 4ZYHA 1FP2A 2RNJA 3KE2A 2XAJA 3GF2A 3OV8A 5KVRA 5D5WB 3VFZA 5CVIA 4U0VA 2MA3A 3K9TA 1IRFA 2XVCA 3ROUA 4G94A 4G6DA 2LF8A 2DI3A 1FBQA 5DCMB 1PP8F 4I0BA 3M8FA 3P9IA 4KMFA 5LGUA 2TDXA 2P4WA 5IT9Z 1B1BA 2A6HF 2ZJ2A 3QPHA 1IRGA 3IRQA 3BPVA 4FT8A 2HYGD 4LLLA 3DF8A 3EYYA 1B6AA 1STZA 3LFKA 3AAFA 3EUHA 3ZMZA 1ZRDA 4HX4A 2PQ8A 3REOA 3LQQA 5BQTA 3L9FA 2K4JA 2RDPA 3Q9SA 4LGWA 4MEYF 4I2OA 1XCBA 3R60A 3HSRA 3RKYA 1K79A 2D1HA 4IRGA 4MEXF 4RGRA 2A69F 3I53A 1ODDA 4YIIA 5ED4A 1G3WA 1XGNA 4HAMA 3RPUA 2W84A 2DO7A 3FX3A 3S2WA 4KIGA 2IA1A 5DUKA 2VOPA 3KLNA 1FNNA 2Z33A 4KIFA 2R7DA 1MJ9A 1F4KA 2OA4A 3J81K 3GXOA 3ERED 5E1WA 2P8TA 3WTTC 1R23A 1LB2A 3QU3A 1S7OA 4P9FA 1ZG1A 2KKOA 1UHMA 4OU0A 3SQNA 5D6FA 2XAQA 3RKXA 2PG4A 5ERIA 5BPDA 4HF1A 4LLNA 1T6SA 2ESHA 5E8IA 2NNNA 4HQMA 3TGNA 1BOAA 1XMKA 3ZMDA 1DDNA 2M30A 1YTYA 1LDDA 1F9NA 5K5RA 3JAMK 1J7KA 1I6XA 4U88A 4GXOA 5LRRA 3IRRA 5J8FA 1XSVA 1XD7A 2OQRA 4CYDA 1ZHFA 4EJTA 3C1DA 1QZYA 1LEAA 5A2QK 1ZARA 4D0PA 3RDIA 3WTWC 2XV4S 4MTEA 1DP7P 2CGPA 4PGGA 4L5IA 2GXBA 1JHHA 2ZKZA 3FXUA 3SHFA 4O6JA 4OIOF 4KYWA 3LAPA 2VT2A 1BI1A 3EETA 2W24A 3FHZA 4MGRA 5FD5A 5L3FA 1YS6A 1TNTA 3HUGA 2HTSA 3F6OA 3V8JA 4AD9A 4CICA 2D2WA 4U0YA 2QYOA 1D3YA 3HHHA 1H9GA 5HDGA 4M9XA 3F72A 1C0WA 1P2FA 1CF7A 2GZWA 4OIPF 3DPTA 4M9SA 1V3FA 5K1YA 3PFIA 3QAHA 1AOYA 1F5TA 5HDKA 4G7HF 4XSZF 3D5LA 4K2EA 2MLKA 1T39A 1Z6TA 2CSOA 1B9MA 3I5UA 4XBFA 2VBYA 3J81Z 2V1XA 4E70A 2JRTA 3IWFA 4RB2C 2VBXA 4I01A 3JSOA 1XGMA 4P96A 2KIFA 1B9NA 3DXJF 2HFHA 3FMQA 3TKYA 1D5VA 4ESJA 5ICCA 3HSEA 2QZ8A 4IPAA 5H6RA 1FYLA 3HIFA 3FM5A 1KQ0A 4ON0A 4ZH4F 2ADUA 2ZCWA 2OQGA 2P7VB 4R8HA 3M8EA 2M87A 3W6KB 2ESNA 5E8GA 2EK5A 3FF5A 1TQIA 3N97A 5DV5A 2NYXA 2AS5F 5KK1A 2KJBA 3M1EA 4KA4A 4PDKA 1QO0D 4XRFA 3E6BA 1D8KA 2KIMA 5DCMA 4DQ2A 1YFHA 3IKVA 5LHGA 2LKPA 5LRSA 4HV5A 4AIKA 4WXDA 5HOOA 1Z05A 3KP6A 4G6QA 1ZAOA 1A04A 3QP5A 1BI0A 1O3SA 4PZJA 5ILVA 3BY6A 4YFNF 5D4RA 2XAGA 3RIRA 5IT9K 1GHCA 3I4PA 2RVCA 2EV5A 3O2PE 2QQAA 5AONA 5FB2A 3C3WA 4S05A 3V8KA 2RN7A 2FQ3A 1YIOA 3CUQC 4Q47A 2DPDA 1SD7A 1LDKB 1IXSB 1DPRA 3B73A 5FFXA 2FRHA 4UUVA 1W5TA 3ABUA 3KETA 1ZG3A 1FT9A 1O7LA 2B0LA 3KP2A 1W7PA 2XUBA 1ZRFA 2MC3A 2M8EA 1XB4A 2L4AA 2QENA 3LAJA 3PQKA 3CO6C 2F5EA 2YR2A 1KYZA 1SD6A 3EYIA 3BDDA 3QOPA 3O6BB 3U2RA 3Q5FA 4GYGA 2V79A 2G9WA 2NNYA 1BBYA 3G3ZA 2DT5A 1W4MA 2D45A 1Z1DA 2VC0A 4DNCA 3V7SA 3VEPA 2NRAC 5CVJA 1IXCA 1EH7A 3FXRA 5L3DA 1XDSA 4LK1F 2M5WA 3E97A 5LBQA 1Q1HA 1XN7A 4FHTA 2OD5A 3TO7A 4M9ZA 5HLHA
chains in the Genus database with same CATH superfamily
1X3WB 5AASA 5FGMA 4EJWA 2B3TB 1CGPA 4BQQA 4JI5E 2LREA 2EN1A 3G1MA 2ODRC 1VQMI 2CG4A 3SZPA 2HQNA 1SMTA 2DMNA 5A6AA 3T1YE 3R61A 4AYBN 1ON1A 2EMKA 3A1YA 3BJAA 2UXCE 4B43A 3A0BC 2EE8A 2FBIA 4E7IA 3ABTA 2F5DA 3BCAA 3OOUA 2FNAA 2E71A 1PJQA 2UZKA 2EM4A 1JE8A 5HLGA 1J75A 1GQEA 2O03A 2CPNA 5FFZA 2EM3A 2MBFA 3A0HC 3LA7A 1JTYA 1B69A 1VQ6I 3LLHA 1W0TA 1AA7A 5EEHA 3F23A 3S1RJ 1YZ9A 2BW3A 4A0XA 5M3MJ 4HV6A 3S1MJ 2E5LE 2X51A 2ISZA 1X1BA 2JA7J 2M4GA 3H35A 3I4NJ 1Z67A 1NK2P 2RS7A 3ML6A 3TEDA 2KRCA 3UKGA 2MC6A 3BIDA 3K0LA 3BF2A 3THNA 3ZP5A 4DBQA 2ZXJA 4XK4A 4P7DA 3I59A 3IWCA 4GCVA 4A3MJ 2EFOA 1R5ID 1SFKA 1FLIA 4NHRA 3LSIA 1X48A 3D5SC 2GQQA 3T8RA 3N4MA 2L7FP 2EA4A 2XKOA 2YS9A 3WE2A 4ZYEA 2V1UA 3B02A 3GX4X 1XMAA 1Z6RA 3F3XA 3COAC 2UWMA 4IS1C 3CUOA 2EL4A 2JVHA 2K9LA 2DLQA 3GWZA 2R7TA 2E7XA 2CUFA 2RQPA 3MFKA 2LRDA 1R6RA 1XPXA 1H0MA 2RNGA 4HQEA 1R58A 2KZGA 2WB1N 3K7AJ 3RYRA 1O3RA 2EN4A 3DEUA 4B3AA 4N4NB 2E2IJ 4UUSB 1BL0A 3C4TA 4DV7E 1USSA 2MDGA 2KIQA 3BZKA 3HPGA 3BQZA 2DPUA 2J7JA 1S3JA 5JI6A 3M7GA 2H8RA 1XCVA 2YX4A 4BYYA 3BG5A 3I4MJ 1P9QC 2N8GA 3FMRA 3HOTA 2GM4A 2EWNA 3AL0B 2W57A 1QPIA 5IOYA 4B3TE 1KU9A 4CCOA 5FKLA 4EJUA 2L4MA 2EQ1A 1QHHD 1GTKA 1O3TA 4HLYA 3BROA 1TWCJ 3TOAA 2VE7C 2UUCE 1UFMA 3S15J 4L9NA 4ZYDA 4IXAA 4FX4A 4JQFA 4N0BA 5DYMA 4YG2F 4WWCA 1Z0XA 2MDRA 4G9YA 4OAYA 4BBYA 1X47A 1ZLJA 2W00A 5K7FA 3R0JA 2M7QA 1PUEE 1X5WA 1B59A 3DCFA 1ULYA 2P5LC 2R3SA 4L0YB 3THOB 3BT9A 2MC5A 2H09A 3DU5A 1UG0A 2Y30A 3N05A 2YPNA 3PIOF 2EMCA 2GLIA 3S14J 2I13A 5E1ZB 3CDHA 2OTLI 3K10A 5DCFA 2Z16A 1FX7A 2BBYA 2KISA 1SD4A 3DP7A 3PL8A 4MO7A 4Q48A 4A5NA 3LMLA 3I3LA 1IBLE 4X0GA 3VB2A 2DMTA 4E7LA 3OOPA 1ONVA 4IJDA 4LFCE 3S1QJ 1I1GA 1E3PA 2AXTC 4JI4E 2XF5A 2DDBA 1JXSA 3C6MA 4P9UA 4Q35B 4RAZA 1X6EA 3VOEA 3V42A 2VXZA 2EZHA 2ZNYA 3I59B 3ZQQA 1G6NA 1FJLA 2L33A 4R2QA 4MLQA 2L7MP 4I98B 4XRSG 2XAHA 1BR1A 1WJDA 2JSPA 3C18A 3IP4B 3VODA 2QBYA 4GKJE 3C2BA 2WADA 1IUYA 3DQVC 3AV0A 3GLXA 3Q0VA 4R79A 1KU3A 4XMYA 2N8XA 2COMA 2NUGA 3ZQGA 4O24A 5EG0A 1WZ2A 5TGTA 3TOBA 4AUXA 1WH5A 1HW2A 3HDDA 2LJUA 2NOGA 5BMZA 2OUMA 4IRHA 5IP9J 3KZZA 5D4SA 3WGIA 1WJBA 3CC7I 4BY1J 1T4LB 5FKMA 3O8HA 2JMWA 4OAZA 4B4CA 2IHR1 2JK3A 2LR8A 2GIVA 2BVLA 1IC8A 2HI3A 3E5XA 1S9HA 4Y13A 4NC8A 5E20A 2YSOA 1RMDA 4I0AA 1T4OA 3L2VA 1SFOJ 2Z99A 2LE2A 5CYVA 1K78B 2EIJH 2AQEA 2CV2A 2FBKA 3WTYC 1Z77A 3W3CA 2ZFUA 2WBTA 2F4VE 4L9TA 2ETHA 1MJBA 3K1MA 3DJWA 4BHBA 2LDUA 2DJIA 2FNPA 3E6CC 2HKXA 3RYPA 4CCNA 3UNGC 2E7WA 5DD8A 4D1QA 2VE9A 1NHAA 4FE4A 2HWVA 5J3LA 2JA2A 5J1RA 1TT0A 5B1AH 2J5PA 2QGUA 4KT6A 1U5TC 3CP8A 4RAYA 2V9PA 2EN6A 1A1HA 4R8OA 2CT1A 5LL6R 3TL4X 2N3GA 2VQCA 2K02A 2F6CA 2HQRA 1VZ0A 5FKNA 1KJKA 3CO7C 3OL4A 1R9TJ 2OJED 3G4SI 4IHVA 2HS5A 4UB8C 3ASNH 1QNTA 5BOXA 4M3FA 1GDTA 3CJQB 4JI1E 1WGXA 1XG1A 2L9RA 1DGRM 2LJHA 5A2QC 2E19A 3L2UA 1VQNI 3F8NA 1F2IG 1YO5C 5FLXK 4U0WA 2L3CA 1YYWA 4LMYA 3TQMA 2GXGA 3CMYA 4EJOA 1OFCX 4U7DA 1HDPA 2G7UA 2K7IA 2ICWG 2A05A 2DLLA 3K2ZA 2B9DA 1W7PB 1MH4A 3KZIC 1DGWY 2FF4A 2F2EA 2VQHA 2W25A 3H36A 2HPIA 3LL7A 5JR3A 4ABZA 3QWLA 3MD2A 4ENNA 3BTIA 4EATA 4F9AB 4RS8A 1ETWA 2M9AA 2RV8A 1T98A 2LNBA 2EOOA 2NS8A 4PFOA 4J8ZA 3MWMA 3H09A 2X6WA 2YU8A 1YG2A 3V7RA 1XDUA 1MNEA 2E1MB 1TW3A 2L01A 2HXOA 2OC6A 4EQQA 1UILA 3R4KA 2EP3A 4E4HA 2EOSA 4TUGA 1I6HJ 4F91B 2YPRA 4FE7A 2CQNA 2X1EA 4KJZA 2NS0A 1N32E 3A02A 2VN2A 1U0JA 2V8QB 4ZJZA 5K5OA 1VF9A 2L2KB 4ZYAA 1LVKA 1KONA 2CO5A 3ONQA 2LKXA 3FK7A 5H6QA 3WHCA 2ZSIB 5IYDJ 1X1CA 5CLSA 3LSJA 1QBJA 2Y75A 1HOMA 2ENCA 2IVMA 1Z7UA 1V4RA 2Y31A 3J7ZI 2QA4I 2E2JJ 3MQ0A 2L3JA 2R7VA 1LVAA 1KA8A 4A0ZA 2WBUA 1PUFA 3HC7A 4JX6A 1YW9A 4XN0A 1P4XA 2Q8KA 3Q0WA 2EM6A 2EPZA 3ZR8X 2VPLA 2LFBA 4UVCA 3TMOA 4IHTA 3UK3C 4DV2E 3GVAA 4KISA 4L9VA 3VPRA 2IGMA 5J4VA 3JSPA 4A2UA 2BY0A 4FISA 2ZNZA 1HQCA 5HS7A 3J7AO 4A3DJ 3F21A 4NB5A 3I56I 4M72A 3PO3J 2F4OB 2JTVA 3OYLA 4ZYGA 3KFWX 2IS6A 5GAGJ 3AUZA 4N4OB 1ZGJA 4EMSA 2IS1A 1KU2A 1MBGA 4GFBA 1HSTA 3IAS2 4HW0A 1OYWA 4WFTA 3OIQA 2ACJA 2GWRA 1O4XA 2XPWA 4RAGA 1T2KA 2EZLA 2BYVE 4M74A 3JTGA 3ZMUA 1WI9A 2Y48A 2LLKA 3RCOA 2PJRB 1HC8A 4NZVA 2MYSA 2R76A 1EH8A 4RM2A 1H8AC 2EN8A 4BJ5C 2KRHA 4XLPF 3AKZA 3SDGA 4BNCA 1OR7C 1PP7U 4BUPA 4ZZDA 2VT3A 1XNQE 2A61A 5LGNA 4O4KA 1P92A 1ZH5A 3ECOA 3GZ6A 3HBLA 1RIOH 3ZPLA 2CQQA 1A1JA 2EN3A 1LQ1A 2VBWA 1VQ9I 1T33A 1WVRA 2DLKA 2HYFA 4NUBA 5ADZA 5A6BD 4HF0A 1K4SA 1NCSA 3M4OJ 1P6RA 2WWYA 4BE0A 1LNWA 3GTJJ 1ZELA 4WCGA 1J59A 4L5NC 5AIQA 4XLCA 3OYFA 1WJAA 2XRNA 3IH2A 2HVSA 4ITVA 2F4MB 3K1NA 3RTRA 3B6AA 1XNRE 1TF6A 4YFXF 2YRHA 4BBSJ 3WTZA 5F0HA 3RKQA 2DJNA 2IP2A 4ZDLA 2R5YA 2HDWA 1ZQ3P 2NVXJ 4Y15A 9ANTA 2CFXA 2HPMA 1U6GA 1LFUP 2OV7A 1YJ9I 3L00A 3M9AA 4MQ9F 3C2HA 5CJ9A 1YPNA 2EMXA 1V54H 3SEZA 2M9HA 3WU0A 4RLQA 2FE3A 2HJJA 4Q4ZF 4DW6A 2OZ6A 4G6TB 1ZR9A 2LTPA 1RNLA 1X19A 3GFJA 3A01B 5F3WA 1B72A 4LB6B 2EV0A 1M1EB 2E1CA 2WTEA 1HNXE 3HOVJ 1MZBA 1IN5A 5D5VB 2I5UA 3KEOA 1RETA 2ZJRF 5ICGA 4GRIA 1X4PA 4RA2A 1VQ7I 2E72A 1IQSA 4M3DA 1BIAA 3GTOJ 4G8XA 2M45A 4PSWA 2JPCA 3IWBA 1GT0C 5FJ8J 1LJ9A 5HNFA 4DR7E 4LG3A 1GVJA 3L2QA 4F2JC 3EPJA 5LFAA 3EQLF 5CPRB 3CZ6A 1LPQA 1D0ZA 2ZXIA 4UB6C 3O3KA 2M4IA 5DTDA 2P5KA 1OCPA 4CO8A 1MBFA 2DTRA 2H1KA 4NBQA 2EM7A 4QSHA 2EA2A 5T6JA 3ADJA 2EMIA 1VQ5I 2CV0A 4WSGA 4HG2A 2OAZA 1TNSA 2KP6A 2VXDA 2ELKA 2CWEA 1G3TA 3F8MA 4YY3E 1X1AA 4HX7A 3G71I 4DV0E 1MGTA 4AVPA 4BHCA 5IY5H 4F6NA 2K9NA 4DZJA 4A3GJ 1FSEA 3KYDB 3BZCA 2G7HA 1D1CA 2LKSA 1MJAA 3BP8A 5F64A 5J1UA 5DDGA 2B7TA 5FLXZ 4LB5A 1AKHA 3TW7A 3NAUA 2M3AA 1ETOA 5HS9A 4ZZLA 2EPXA 1WH7A 2WB1A 3BPXA 1IV8A 2JPBA 1A35A 1A36A 4RAFA 4F7ZA 2QSHX 1RZ4A 3OYKA 3R6SA 2LUQA 3HRTA 5LEKA 2GA1A 1W7PD 2K9SA 2LY9A 2STWA 5DD4A 2DBBA 5IV8B 3DLLF 5FKKA 5A6JA 2YU5A 2MC4A 2FOKA 3ELKA 3OR1C 4CDGA 2ZFWA 4W97A 1D0XA 4XLAA 1FPQA 2IA0A 3BJOA 2HQ5A 2IS4A 3I54A 1IN7A 3JREA 2HC5A 3RQ4A 2DK5A 2XPVA 3V4GA 2W7NA 2GOMA 2PMUA 2EOEA 2V83A 1ZN2A 2V9VA 4V2FA 2A5WA 3RI4A 5H2FC 2ENHA 3CDIA 4FASD 5LD2C 1VQPI 2BY1A 3K1PA 4MTDA 1A1IA 3JTHA 1G2HA 1LFBA 4LK0F 1MW7A 3K2AA 4IOCF 3GYHX 1UCRA 4CSWA 1L3LA 4U87A 1D0YA 1EH6A 2X4HA 3HXLA 3CP2A 2VE8A 4YIFA 3J7AG 4RGUA 2F4IA 3Q3SA 2EIKH 4HOBA 3SXYA 1A6IA 3SEQA 2VODA 1WQ2A 1EKEA 2UXNA 4HDVA 4CHUA 2EFNA 2YTEA 1X3UA 5JFRA 3MZ8A 3VHTB 3HUGB 3G73A 1DP3A 3T1HE 4V19K 2CQXA 2EB7A 4AYBA 2CU7A 4M73A 1UAAA 1FTZA 3P9KA 1APLC 1YW8A 1OKRA 4DYRA 2ME0A 4B8XA 2HXIA 1WHQA 2DSYA 1YHQI 1E0EA 2X1DA 3M8JA 4JOMA 2MKNA 3QYFA 3LSKA 5A2QZ 4QPQA 4BDYA 3HOSA 2UUAE 3DPLC 2CFOA 1D1AA 4DR5E 1PUFB 3OMLA 5JHUA 2IBDA 4AM3A 4F54A 1GXQA 2ZMEB 1U3EM 4JI6E 1U8RA 4EVIA 5TRDA 4DMIA 4QTRA 2W4SA 4ASNA 1Y6IA 4G12A 1O57A 4QWQA 1FZPB 1IJWC 1BBGA 2YTDA 3F6VA 1S7EA 3DEWA 2XGCA 2QSFX 1GVDA 3T8TA 3KX2A 3OL3A 5JVTA 4E7KA 2QQ9A 3CJRB 1OPCA 3E7LA 2PN6A 1ZK8A 5CVUA 4C9YA 2FU4A 4Y4RA 2BB8A 2CYYA 4X65E 3BR3A 4L9JA 4Y33A 3JRBA 1IBME 2DFFA 2K85A 3IUOA 1AHDP 2M4KA 1ZU1A 2EMAA 3F22A 2VBZA 4F6MA 2GAUA 4BY7J 1XGSA 2Y0SA 1HKQA 2RKHA 4XONA 2PX9A 1S7AA 1SFUA 5ICEA 1VTNC 1SFXA 3TBIA 3HSFA 1RR8C 1LEBA 2L6MA 5HLIA 2O7OA 2CRGA 2K40A 1P47A 4HEIA 3BCBA 4XIDA 4LITA 3LA2A 3WTUC 1L4SA 2X48A 3J80C 1Z9CA 1HSJA 3A03A 1WJEA 5BNGA 2BY2A 1R1VA 4KN7X 1K6OA 1ZTRA 3F8CA 1BA5A 3S17J 4A3KJ 2AHQA 1WHUA 1D8JA 2E2HJ 4KICA 3PFYA 1FYKA 3T1BA 4CGZA 2RQLA 3MSWA 5LGTA 2VC1A 3T0YA 1DQ3A 3CCUI 2D1VA 4DGWB 4HF2A 2VJJA 2H6BA 3CC2I 2DMPA 2HVRA 4BE1A 1Z1BA 4P5OA 2WAQA 2DGCA 3ZQ7A 4HX8A 1HLVA 3HPSA 4CCJA 1S6LA 5CVVA 4BQAA 3L2WA 3CUQB 3HRSA 4KITB 2PJPA 4M0VA 3S93A 2VKVA 4BHPA 5EGOA 4BH9A 5EF6A 3WTVC 1FTTA 2MLGA 2EQRA 1LFPA 1RUNA 3WGHA 3F6GA 1J5YA 3L09A 3WE3A 1X6FA 2OU2A 4QLCU 5F1JA 5FRNA 3HOZJ 3RPQA 5ICFA 4A5MA 1U9NA 4BJTA 2XGXA 1E17A 2DW4A 4XRMA 4O3MA 2Y0MA 3J80Z 2O0YA 2P81A 3EUHC 2XSJC 4ETSA 3RMPA 4ZDOA 4BQNA 2JUGA 2P6TA 2R5YB 1NH3A 2HGCA 3GFLA 4O5VA 4WF2A 1O7FA 2KRFA 4P1WA 1FBUA 1R00A 1GV2A 5TSEA 2STTA 3FDYA 1ITYA 2O5RA 4M3EA 2NUEA 4MNUA 2EPLX 2L5QA 4X9JA 1N34E 5E3OA 1SAUA 2DA6A 5L3EA 1ZBQA 1IMUA 4R2AA 2BW3B 5IP7J 1R7JA 2R7FA 4FX0A 1KYQA 1IW7F 2LCEA 2KL4A 3K4MA 1KQ9A 5K5QA 5D5XB 4D7NA 1B72B 2HOTA 2M1BA 5HDNA 2N3HA 5IT3A 2R0QC 3E5QA 4I76A 2L3DA 1YW7A 3RPUD 3HOWJ 4LFUA 3CUQA 3PQJA 5ILUA 3EUKL 2EPOA 4XORA 1F1ZA 3HPZA 3VK6A 3ULQB 1YI2I 2QQ8A 2R92J 4MFDA 3DF6A 4BXFA 4F92B 2CQ7A 1XSXA 1ZRCA 2EQ0A 2YT4A 4I09A 1W36D 1A6QA 4HZFA 1FBSA 3TQNA 3MKZA 2JWOA 2DRPA 2EM8A 2HNHA 1T0FA 1U2WA 3AG2H 2DA4A 4UV8A 2WBSA 2EFPA 1R1UA 3OIPA 3SFIA 4CA0A 1BC8C 2ZB9A 3WG9A 2E35A 2QCOA 5J8CA 3LSRA 3DBLB 4L5EA 4RB3C 4NHJA 1I5ZA 2FXAA 5TISC 2WY8Q 3LA3A 1U5TB 2ZC2A 2KHMA 3K4KA 4RDUA 1SVLA 1X6HA 2EJRA 2YTGA 3HRUA 4HRIA 2NXNB 2HQAA 1MBJA 4BAYA 2ZBKA 4LLGF 4R03A 4DV4E 1WJFA 2L9NA 2OF7A 4Q28A 4WXHA 2LOOA 3SFZA 4E7SA 4DKKA 4OX9E 2CQKA 4HYEA 2EZKA 3M3YJ 5HS8A 1JUPA 3G1OA 3WG7H 1ZAAC 4PJNA 2L02A 2WZOA 4L8NA 1RPWA 4L18B 4ANJA 4HPQA 3L2RA 1RRJA 2K3FA 1X3ZB 4HBLA 5EGOB 3H9QA 5CVRA 3DPUA 1YRNA 3E6DA 2EWLA 1L0OC 2FD5A 2MGQA 4M6XA 2EOQA 1SANA 3OTOE 3BG6A 1YIJI 1WFXA 3F0CA 3ZQFA 2Z5UA 4JI8E 5KL6A 5HVQC 3P9CA 2Q2EA 2BEOA 4A6DA 2DAOA 2EILH 3CCSI 3EPLA 2A6TA 2IS2A 2L2NA 1TWHJ 5TJJA 1UJ8A 3JRFA 3NARA 3FZVA 1IGNA 4RLFA 3DTKA 4LFAE 4BJ6C 1VQLI 3W2AA 4N4RB 3DTEA 1TZLA 1Z21A 3KEQA 1WKMA 3CC4I 3S16J 3PNVA 1Y1WJ 3WTSC 4L0ZB 1KGSA 4A93J 5IYBJ 2YTQA 2Y69H 2UUBE 2VUMJ 3GFIA 2HZDA 5FROA 3S3OA 2YU3A 2E1MC 1VQ8I 3CF5F 2VQFE 1MIJA 1J2XA 5KAIC 1UHSA 3KYLA 4FQGA 1TW2A 5HODA 1XGOA 1WRJA 3K70C 1MMSA 1X1DA 2YSRA 2DCEA 2VPRA 4UHTA 4XLEA 4D9JA 1AU7A 3W2VA 1ACIA 3ZOQB 3HTXA 1P7JA 3C6KA 4JK1X 2QLZA 1G59A 4X1EA 2EPAA 5AE3A 2K27A 2YX7A 3CCYA 4BC9A 2P7CB 4NXNE 2YTPA 5E18F 1XS9A 2RSIA 2YTNA 5D8LB 1YLFA 1FIAA 4E7HA 4IRIA 2HZTA 1ON2A 4LF5E 4KHPE 3QPTA 1YX5A 3F8BA 4II3A 2DMIA 2RC4A 2X85A 4XRSA 1KZHA 5J6XA 5JHFA 2EPPA 1DQUA 3O8GA 1TQPA 2YTIA 3CJNA 1YQAA 3OYCA 2R93J 1G3SA 4UY8I 2WAEA 2DN0A 4LTYA 1GUUA 5FKOA 2V1DA 3IWZA 3KP3A 3P5JA 4DV1E 2EINH 1I27A 1AKHB 1SMYF 2DA7A 2MSYA 2QUFA 2DYRH 4NQWA 3FIWA 2KJCA 3DKYA 3F9KA 3V7CA 2BV6A 3HKZN 4KNYA 1RQ0A 2L8TA 4R1HA 1X2NA 1Y0UA 5B3SH 1MDMB 3VSLA 2R7OA 1DPUA 4IX7A 3I55I 1B8IA 4F55A 3K4CA 1OCCH 1OCZH 3LFUA 2QSGX 4UVAA 4JYAE 2EIMH 5GPCA 3H92A 3LQRA 4F93B 5K7HA 1XSDA 2JXPA 4FETA 3HTSB 4UVBA 3GEZA 2HGHA 5CFFE 2HU9A 2LSOA 3KP7A 3GTMJ 4F9BB 3OSFA 3H3UA 1R5GA 2QKLB 4CUGA 3IKTA 2DU9A 5C3EJ 5FLVA 3X2QH 1A5JA 1JK2A 1YS7A 1IG7A 2DB2A 2UXDE 1ZGAA 2K9MA 3OYMA 4X8WA 2KOUA 4EJVA 3L2CA 2M1SA 5EEAA 3E3VA 2A5YB 2JRMA 2XSDC 3BG9A 1OCRH 4IJAA 2UXBE 1HBXG 2DOEA 4UUTA 3OSGA 2COBA 3FBNB 2XPUA 3TW6A 3VYSB 2I9IA 3IH4A 2Z1DA 4OIQF 3CCLI 3VYXA 2EMHA 3HHGA 1UZCA 5FD6A 4M2ZA 3CCRI 4X64E 3BTLA 3GZ5A 2EPNA 1PDNC 1P4WA 3PUBA 4UV9A 1J26A 2LH9A 1JI8A 1BW5A 4ESFA 2ID6A 1UHWA 5J47A 3QYBA 2PMHA 4EM0B 3IL2A 3J7Yp 4BEHB 1ETYA 3KP5A 2ELJA 3LSTA 1VQ4I 2HDCA 4HLXA 2CV1A 1PKPA 3BBGA 1UHZA 1WJPA 1G3YA 2O8KA 3LOCA 3F6HA 3MCZA 1JT6A 1NG7A 5FLMJ 2EN2A 5CQEA 4K0KE 2HOAA 2MD5A 2PMZN 1YSAC 3JRDA 1I50J 1Y56A 1TC3C 2O8XA 4C2UA 2JVGA 3G6EI 1TQMA 3DKXA 2WY7Q 2JYAA 1SVMA 3BR1A 3GZNB 4HEA2 4PFPA 5F6FA 4A0YA 1ZLKA 1EKZA 2ZJPF 2W1OA 4DR2E 2WCC3 4IF4A 5EYRA 2Y9YA 1FWZA 3FXLA 4PSXA 1T08B 4B3SE 1JKOC 4CCMA 2RS6A 3FKJA 3J7YJ 3NRVA 1X49A 4M71A 1R4NB 2IPQX 4CYCA 2O3FA 1RKTA 2EMWA 1R1TA 2ZMEA 3KZYA 3U1KA 4B44A 1GXPA 3I71A 2ZM6E 3GFMA 2XF6A 3FXMA 2AXLA 1WJCA 1BI2A 1FOKA 3E6MA 1MH3A 3RJPA 3GW2A 3PO2J 1U78A 3QP6A 2LYCA 4KFCA 2CSHA 4GDFA 4A6EA 2HOSA 5AE1A 2VQEE 1MMNA 3CLOA 4WXCA 1E3HA 1G8XA 2EOMA 5KL4A 1N33E 1NK3P 3QYEA 5IT9C 3VDXA 5M3FJ 5LHHA 1RUOA 2EFWA 5D8KB 4Y52J 2EM9A 2QQBA 4OWRB 2PEXA 2ZSHB 1FEXA 1X1PA 4OOIA 3CCQI 3JTZA 4ENKA 3M07A 2FBHA 2QM3A 5EZGA 3GUDA 3BOQA 2E5ZA 4KMUX 2VASA 2NA2A 3FWEA 2KHXA 2K4VA 3DBRB 3ZOBA 4BGDA 3P1XA 2L2OA 4G7ZF 4Z6YA 2EMYA 5HNHA 2EOZA 2A68F 5DEQA 4LU9A 1T38A 2P5VA 2UV1A 4KN4X 1FYMA 2D9HA 1AH5A 4X62E 4HSRA 1TWGJ 2ZXHA 4XSXF 1W5SA 2RGVA 3ISPA 1AWCA 4GO1A 5A6BA 3I58A 2V87A 1TTYA 2MKDA 5A69A 2V6CA 2F48A 4IQJA 1EF4A 1HCRA 2DYSH 5K7ZA 3F8FA 2FEZA 3MZHA 2HR3A 1VQKI 5FO5A 3CTAA 1VFCA 1E3OC 4RGSA 2CW8A 2QBYB 2L0KA 2Z9OA 4AWXB 4GGGA 4RM3A 1Q1VA 3HJEA 1X58A 4JI0E 1BBOA 2R1FA 5DM6F 2AO9A 2HKOA 1FC3A 4BDZA 2UXXA 2OBPA 4N9HA 4HNTA 2WBMA 3KLOA 2PLYA 3MEXA 4MHGA 2EFQA 3HTUA 4I02A 3ZRGA 4Y17A 4HNVA 1O3QA 1IAWA 3BZ6A 5KL7A 2KDOA 2XAFA 2M0CA 2VRDA 3ZMTA 1LE8B 2JA5J 2H27A 4JI2E 6PAXA 2LTRA 3SZTA 5E3NA 3CMEI 2JA8J 2LO3A 4M6VA 3K4BA 4A3EJ 2B9SA 2LV2A 3HGGA 4KDPA 1KYWA 3QRFF 2O9LA 4CYCB 3K69A 1P4AA 4MQVA 1W0UA 3WU1B 3ABMH 2K7LA 2Z2SB 2K9QA 3C7JA 5C4JJ 1Z7LA 2FA5A 4DZPA 3BR0A 3LWFA 3OYIA 1MDMA 2DXIA 1HW5A 1V5FA 2A3SA 2V4JC 4XM3A 4DR4E 3BWGA 1UG2A 2JSCA 1RC7A 5E3MA 2H1LA 3H1CA 3R0AA 2DT7B 1BM9A 2E1NA 1T56A 2DQLA 4A3FJ 2ZO4A 2PJRA 1R5HA 5LLQA 2FV4B 4ZTJA 2H36X 2L7ZA 3G2BA 2YTFA 1R71A 4LJZF 2PRTA 4JI7E 3KCCA 2F8BA 1MBHA 2JZYA 2JPAA 2IGKA 5BPIA 2DT6A 1WI3A 5KL3A 2DQRA 2LBFB 5KNLA 3BQYA 1J9IA 2DA5A 3E1SA 4IVNA 5LHIA 2PI0A 5F08A 5M5YJ 2Q1ZB 3MN2A 1FP1D 3IHUA 3JRAA 2G0EA 1LE8A 3DU6A 5D5UB 2XROA 5F1RA 3MHSC 3WODF 2BZTA 2W82A 1MD0A 5E3LA 4G7OF 1TF3A 2MH9A 2WAFA 3QU6A 1S29A 1OCOH 1UB9A 2YUSA 4HNUA 1FSHA 4KT5C 2V9KA 2BGCA 3MAJA 5B5EC 2PBIA 5L3CA 1Y0NA 4AIHA 3I9V2 1ZBTA 4KWYA 2ENAA 3ZMVA 2CW0F 4I7HA 3JW4A 3CCVI 1A1LA 2HHHE 4AVZA 2J5OA 2Z3YA 1JTXA 3FM3A 2K4BA 1A1FA 4LD5A 1QHGA 4N9IA 1XMXA 1SD5A 3I64A 1HKSA 2FX0A 4EGZA 4ZTFA 1DU6A 5B66C 5LEJA 1J09A 2HYJA 2IXSA 3T5XA 1P7IA 1BJAA 3HYIA 4U7BA 2R7XA 2A25A 4OMYA 2BE5F 2WC2A 1FMWA 4L5JA 5HLTA 2LF7A 1BC7C 4D5FA 2EOIA 5L3BA 2Q8UA 2XASA 2HEOA 4KUMA 4DUZE 2CS3A 4LG0A 2YU9J 5IXMB 1E2XA 1BN5A 4OIRF 2KIUA 1RI7A 2ECCA 3D0SA 4YIRX 2XIGA 1HXDA 3H3ZA 2ADRA 1T4NA 3U9GA 4S0HB 2LK2A 3OMYA 1CF7B 3W6JB 1Z91A 1RKWA 2NUFA 3DFGA 4P55A 1J0RA 3E5UA 4RGXA 3H5RA 3IC7A 1IN8A 4NC6A 1USTA 3NEUA 4CXFA 2DK8A 1V55H 2F5FA 1JHFA 1ZYRF 4BEHA 4CZCA 2FQ4A 4XLNF 4Z2YA 1UBDC 3EDPA 4X6AJ 2RPCA 1OR7A 1HKTA 1V5EA 1G4DA 3SJMA 1YE9A 3JAMZ 3DV8A 3MZYA 3SZGA 1IN4A 1HW1A 4ESBA 3V8LA 5E1XA 5E17F 3JU0A 2XRLA 2AQFA 4M6YA 1OMIA 4H0EA 4HDUA 1I3AA 1R22A 3J80K 4AU7A 1STUA 2DFIA 2P0WA 2JT1A 2LMZA 2ELHA 3HKZA 2VJIA 2MFZA 1MMDA 5DS9A 3L7WA 4LG0B 2MD0A 2NS7A 4JX5A 1S8NA 4EM1A 1IDZA 1QGPA 2F5VA 4X66E 2FTXB 1EV7A 2VOOA 3K6GA 2IA2A 1OLTA 4ENJA 2FSWA 4RB1A 5M5WJ 3CMMA 2ID3A 3FK6A 5LMUE 4KIBA 1QZZA 2HOEA 4A69C 4ZC3A 1IN6A 1N36E 4OMZA 1NG6A 2H94A 2L54A 3FIGA 1ORKA 3ZMSA 1KU7A 4WSPA 2ME6A 3Q9VA 1ZR4A 4DV6E 4LIUA 4A12A 2JOXA 2B63J 1K4TA 4RH8A 4LF7E 2A6EF 1BJZA 4A3BJ 4WX9A 4OINF 2DOAA 1N77A 1H9TA 4NNJA 2O61A 1H89C 2BBGA 3AG4H 4V2GA 4B48A 2R5ZA 1ZGWA 3ASOH 1I1SA 4LF9E 2EM0A 4JP0A 2FMLA 2D5VA 2EV6A 3C2GA 1HNWE 1PDAA 2F5CA 1OJLA 5DNYA 2HTJA 1OCTC 2K3PA 2OZUA 3WGGA 2EZ6A 5H20A 1TBXA 1WSUA 2V1NA 3TO6A 4PJLA 3MKYB 2FUG2 3OYDA 2O6GE 2XB0X 2VB6A 2P6SA 4B1RA 1ZKGA 3QQAA 4F52A 4ENMA 3FXKA 1KQ8A 3ESWB 3VYTB 2EN7A 3ZN0A 4EM2A 3NQOA 2DTZA 1K7AA 1BI3A 4UXNA 2EH3A 4LOCA 5CQGA 3ECHA 4TV7A 2EJ4A 1B4AA 2LMDA 2LG4A 1ZREA 3EPKA 5F27A 4RHBB 1D5YA 1QPMA 3OY9A 4UNOA 3CLQA 1UELB 3U1DA 1EJ9A 2IJLA 4NXME 4IHSA 5B1BH 2EPRA 4YEJA 4S04A 5M5XJ 5GAEJ 2EPKX 4MLOA 1IXRC 3TDUC 3I0TA 1WPKA 2XGDA 1IZ1A 2PFBA 4WK8F 1JGSA 3HRMA 2DFEA 2UUZA 1T95A 1T8IA 2KFDA 1BW6A 2ISYA 3FXQA 1S72I 2V85A 4FK5C 4BACA 2A07F 1DUXC 4PJJA 3M1CA 4XLFA 3RKWA 2CJJA 3AL0C 2H8WA 3RQIA 2JA6J 2QWWA 2IRFG 2EOYA 4XKCA 1QVTA 4B47A 1W1WE 5AIPA 4A3LJ 2K86A 4CZZA 5E79C 3IAM2 4RB0A 1MKMA 3TO9A 3K4JA 3JRIA 3WTXC 1OYIA 4JV5E 1SFEA 5ILSA 2EOFA 2BVMA 1ZG5A 2XHKA 3W6VA 1OQYA 4YFKF 4XICA 5AC5A 4DR1E 4IHXA 3FMSA 1N75A 3K4LA 4Q5SF 3BGHA 4Y7NJ 2BY3A 2IAIA 2H6CA 1QA6A 1PVEA 1JUMA 1XTAA 1K78A 3ZN1A 4LFBE 2IT0A 3TDZC 2EMZA 1UMQA 2Q0OA 2CTDA 1VI0A 1XMQE 4GYIA 2XKPA 5L3GA 3C4BA 1BIBA 3BJ6A 4JBAA 5EZHA 1FY7A 1U9OA 2EZIA 2GA2A 1REPC 4IKFA 3KP4A 3DKWA 3BLYA 4DYQA 1SAXA 1SEUA 4IOAF 1HA8A 5BS6A 4B09A 2FMYA 3GLLA 4EGYA 2VF1A 4EV0A 2W85A 5EEGA 4D5CA 4WPYA 4MIMA 3E0JB 4PGHA 4PCQA 2IW5A 2X0LA 3K4NA 1PJTA 3ECRA 3RZDJ 2MH2A 1YX3A 1QQIA 1CQTA 1WWXA 3P7NA 4C3HJ 2DMYA 1IF1A 1LDJA 1RESA 2LC2A 2XAUA 4BKXA 4NQWB 4YRVA 4AIJA 4C30A 2I10A 3AG3H 4BXUA 3RZOJ 2L2MA 4BL0B 2VONA 4R2EA 2WV0A 3SDBA 4C2TA 2K5CA 2EL6A 4HA8A 5DUIA 2GBYA 1OYYA 2VI6A 2XB5A 1YYVA 5D6EA 1U5TA 4HSTA 4XKWA 3S3MA 3GO5A 1R36A 4GEQB 2C6YA 4XNFA 2NAZA 1QU6A 2LD5A 2QVOA 1TLHB 1ETQA 3LMMA 2EPFA 2KLOA 1ENHA 4ZYHA 4R2RA 5GTHC 3U21A 1FP2A 5GAHJ 2RNJA 4M3BA 1POGA 3KE2A 3H5NA 1LLMC 2XAJA 1YUIA 1QU3A 2BXZA 2IGOA 2KQRA 3GF2A 3OV8A 1TN9A 5KVRA 1YRNB 3VWBA 1UN6B 2M8GX 4I8OA 5D5WB 4QIWN 3B6CA 3VFZA 5CVIA 4U0VA 3CF2A 4IO9F 2MA3A 4PJMA 1WXRA 3K9TA 1IRFA 1YJWI 2R7QA 2CUZA 2EOHA 2DDAA 5FRMA 1ETVA 2X6YA 2XVCA 3ROUA 4G94A 4G6DA 4F3QA 2Y0SN 1LUJB 4GZNC 1MNDA 2LF8A 4PUSA 2DI3A 1FBQA 3BC8A 2B7VA 2V7FA 1DU0A 3KIOA 5DCMB 1PP8F 2IEKA 4I0BA 2HVQA 3M8FA 3P9IA 2EL5A 4KMFA 3ZQCA 5LGUA 5LMNE 2TDXA 2P4WA 5IT9Z 1FJGE 1GLNA 3MKWB 1B1BA 2A6HF 2ZJ2A 2R7UA 2VJ4A 2MABA 2TCTA 3QPHA 1AAYA 1IRGA 3IRQA 3BPVA 4FT8A 3CMAI 2HYGD 4LLLA 1GV5A 3H5AA 2DIXA 2EMFA 4F9CB 3DF8A 3EYYA 1IQOA 1B6AA 2L7KA 2XC7A 3HGYA 2DFHA 3DWLE 1STZA 3CDLA 3LFKA 4W1UA 3VSKA 2ZXWH 1FMVA 3AAFA 3ZQIA 3EUHA 3ZMZA 1ZRDA 4HX4A 4II2A 4O5GA 3AG1H 2PQ8A 3LQQA 4XLHA 3REOA 2R7SA 5BQTA 4B3XA 1IRZA 3BR2A 1K6YA 2VQGA 3L9FA 1TL8A 2K4JA 5KL5A 3FKIJ 1MSEC 1VQOI 2RDPA 2JUCA 3Q9SA 1A1GA 4ZDPA 3OYJA 4LGWA 4MEYF 4M3GA 2BXYA 4I2OA 1XCBA 3H0GJ 3R60A 4CH7A 3HSRA 3OR2C 3RKYA 1NTCA 1K79A 2EOJA 2D1HA 2NVQJ 2DMQA 2BHYA 2VJ5A 2NOJB 3CCMI 1QVUA 3HB9A 4PJ0C 4IRGA 5IPAA 4MEXF 2RTXA 4RGRA 2A69F 3I53A 2YRMA 1TP4A 3PUFA 3OYGA 1ODDA 5GPAA 4YIIA 3M99B 2KT0A 2B7EA 2L9SA 3ABLH 1JT0A 1YJNI 2YRKA 4P78A 3PNYA 1X3CA 1MEYC 1SC7A 5GP9A 1F43A 4OOGC 2FJ1A 2X6OA 2Y2ZA 4BMJA 3BG7A 5J1YA 2M0MA 3OYHA 3Q0UA 2LRSA 5ED4A 3OIOA 3WU2C 4BU2A 1G3WA 1XGNA 4HAMA 1N25A 4D7MA 1MNMC 3RPUA 2W84A 2M34A 2FGGA 1Y1VJ 2KZVA 2DO7A 1TT5B 3PIPF 2ODRD 4RBOA 2YTJA 3FX3A 3S2WA 4UUSA 5J40A 3BR6A 4XQFA 4NDLA 2CMPA 4KIGA 4HTGA 3HM5A 2OCCH 2IA1A 3GMEA 2X6XA 5DUKA 1JKPC 3FBIB 2VOPA 3KLNA 1ETKA 2CW7A 1FNNA 3D5RC 4A3CJ 2EQ3A 4BCAA 2Z33A 4KIFA 3HPHA 1D1BA 3ADIA 1BR2A 2R7DA 2XF7A 1MJ9A 5GADJ 3NWSA 1F4KA 5C4XJ 2FOWA 2OA4A 3H0DA 3J81K 5C44J 3GXOA 3ERED 5E1WA 2R7ZJ 2P8TA 3KPHA 3ZXSA 3WTTC 1R23A 3QPSA 3GTPJ 3G1LA 2E34A 2DA2A 1LB2A 3QU3A 2RAEA 1ERDA 5DM7F 1S7OA 4P9FA 2VIXA 3ADLA 4R2PA 4LIVA 4JI3E 1ZG1A 1OISA 2KKOA 2L92A 1UHMA 4YHHE 3HOUJ 3LSPA 4E7ZA 4OU0A 3HL2A 3SQNA 2MW8A 1G2DC 2LVSA 5D6FA 4C3IJ 2L9VA 1I39A 2XAQA 1YOVB 3RKXA 2E1MA 4AQYE 5JVGF 2Y9ZA 2PG4A 5ERIA 1IRXA 3A2KA 3OS2A 5J4YA 3OYAA 4LF6E 5BPDA 4HF1A 4LLNA 1T6SA 2GXAA 2PMZA 2ESHA 3JRGA 3GTQJ 4AC0A 2M7AA 1ZR2A 3VYUB 3QPLA 2NNNA 2NVYJ 4HQMA 5E8IA 3TGNA 1BOAA 2KONA 1XMKA 3ZMDA 2MG4A 2M30A 2V26A 3JRCA 1LDDA 1F9NA 1YTYA 1DDNA 3IWDA 5K5RA 2RSMA 2BOLA 1IO2A 3A4CA 4BBRJ 1SR9A 2JN6A 3JAMK 3ZQHA 1J7KA 1PYVA 1I6XA 3S3NA 1S5LC 4J00A 3EPZA 5IOZA 2JR1A 1R4MB 1TWFJ 2TRTA 1JJ8C 5F04A 4U88A 4GXOA 5LRRA 3IRRA 4FCYA 5J8FA 2OTJI 1XSVA 1I94E 1XD7A 2KMUA 2LP0A 3PNTA 3H3VK 2OQRA 1O0WA 4CYDA 1ZHFA 3OS0A 2UU9E 4EJTA 2LTSA 3ZQLA 3C1DA 4DIQA 3FISA 3LNQA 1QZYA 1LEAA 3DBHB 5A2QK 4B3ME 1ZARA 4D0PA 3RDIA 2QKMB 3WTWC 2XV4S 5F0FA 3GBGA 4MTEA 1DP7P 2CGPA 2E5NA 4PGGA 3QG5C 4TUIA 4L5IA 1WHNA 2GXBA 2GIZA 3TP0A 1JHHA 2ZKZA 3FXUA 3SHFA 2V6EA 2DA3A 4XL9A 2QF7A 3CJTB 2EM2A 4O6JA 1Y39A 5EDNA 1F36A 4OIOF 4I99C 1HR0E 4XKBA 3L1PA 4KYWA 3EPHA 3LAPA 2ECBA 4XOTA 5F0CA 4A3JJ 2VT2A 3HEFA 4R2SA 1BI1A 1BR4A 2E36A 3PJRA 3EETA 2W24A 3FHZA 4MGRA 4XOPA 2EPUA 5FD5A 4LF8E 1EA3A 5L3FA 3KYCB 1PJSA 3BG3A 1YS6A 1TNTA 5IWAE 3HUGA 2XGEA 3AFHA 1YUJA 2NVTJ 2I8DA 2R4GA 1IBKE 1XMOE 3BTJA 3CCEI 2HTSA 3F6OA 3V8JA 4IQ4A 4AD9A 2E60A 4CICA 2D2WA 4U0YA 3H9JA 2M7BA 3HHHA 2QYOA 1D3YA 3S2DJ 4IEJA 3EQ1A 2JJ7A 3TP3A 5CKTA 1DGCA 3FHNA 1H9GA 5HDGA 3MMYB 4M9XA 3F72A 1C0WA 3BTCA 1P2FA 3DLAA 5JLXA 1CF7A 2GZWA 4OIPF 4MLVA 3DPTA 1W5CC 3GCMA 4M9SA 2JQ7A 1V3FA 5K1YA 3QODA 2DOFA 2EMGA 3PFIA 4XR6A 3CCJI 4Y3OA 2RREA 3QAHA 3LSMA 2JVAA 3WHBA 5KAFC 2V88A 5EJCA 1AOYA 1FKAE 3W2WA 1QRYA 5HDKA 1F5TA 4G7HF 4IHYA 4XSZF 3VYYA 3D5LA 4K2EA 1DI2A 2MLKA 3JR9A 1Z6TA 4FTHA 2CSOA 1T39A 1B9MA 3I5UA 4XBFA 1HF0A 2VKEA 4CCKA 2VKHA 2RQQA 2VBYA 3FXOA 3J81Z 2V1XA 5BR8E 2LBSB 2LT7A 4E70A 2JRTA 3IWFA 4RB2C 2VBXA 5GTIC 4I01A 3JSOA 2Q2EB 1MBEA 2KPMA 1MBKA 1MMAA 1XGMA 1JUSA 1JKQC 3GTGJ 3HOYJ 2GPIA 2IGNA 4P96A 2KIFA 3IH3A 4J01A 1B9NA 2R7RA 3DXJF 3OYBA 1HNZE 1VNDA 2EBIA 2HFHA 3OWTA 4IZZA 2EOXA 1LKXA 4E7JA 3FMQA 3TKYA 2ZMEC 2EMLA 1D5VA 2ELZA 3PSFA 3ADGA 3JRHA 5AE2A 4ESJA 4PK4A 1FOYA 5ICCA 1BB8A 4J19A 2EM5A 3HSEA 2EPMX 2YWQA 2QZ8A 3OYEA 2OCEA 5AC4A 2LUPB 1ETXA 4IPAA 5A6KA 3MVPA 5H6RA 2YSPA 1FYLA 2M2EA 4BQOA 1W36C 3HIFA 2JWTA 3FM5A 3S1NJ 1KQ0A 4AIDA 4ON0A 4ZH4F 2ADUA 3PSIA 2ZCWA 1R49A 2R7WA 2OQGA 2P7VB 4R8HA 1JJ6C 1HDDC 2X1CA 3GTKJ 3HOXJ 1K61A 4M30A 2VQLA 3M8EA 3UR3C 1JK1A 2M87A 3W6KB 3H9GA 1QZEA 4NC7A 2ESNA 4IHWA 1RC9A 1K83J 5E8GA 3D1NI 2EK5A 3FF5A 4DYCA 1TQIA 3N97A 5DV5A 1YITI 4R2CA 2NYXA 2AS5F 1GZ6A 4BXXJ 5KK1A 2KJBA 3M1EA 4KA4A 4PDKA 1QO0D 1JKRC 2JP9A 1TWAJ 4XRFA 3E6BA 1D8KA 2KIMA 4BE2A 5DCMA 4DOZA 4LF4E 3S32A 2GLOA 4DQ2A 1N78A 2DODA 1IV6A 1YYKA 1YFHA 3CQZJ 3OS1A 3IKVA 1Z3XA 4DBRA 3J81C 5LHGA 2LKPA 5LRSA 4HV5A 1X2MA 3PM1A 4AIKA 4WXDA 5HOOA 3IV5A 1MSFC 1Z05A 3KP6A 4G6QA 2ELYA 1IUFA 1ZAOA 1A04A 3QP5A 1XX5A 1YYOA 1BI0A 1O3SA 4PZJA 1Z3YA 5ILVA 3KWRA 3HZJA 5KHDA 3BY6A 4YFNF 4XKVA 5D4RA 1V5GA 1B8IB 2YZTA 2VLAA 2XAGA 3JCUC 4DR3E 1Y8QB 3RIRA 5IT9K 3VYRB 4XN3A 1I3QJ 3OYNA 4DV3E 3CESA 1GHCA 3DEEA 3ERMA 3I4PA 3QOEA 4JX4A 3CD6I 2RVCA 2EV5A 3KEYA 2CUJA 3O2PE 1FOWA 2QQAA 5AONA 2JY9A 1X4OA 2XDVA 5FB2A 3C3WA 3ZGKA 2NABA 3NWTA 4S05A 1A31A 4E6KG 1WJ5A 3V8KA 4DJAA 3GTLJ 1IDYA 4KZSA 2RN7A 2EORA 5JLWA 3MHHC 2FQ3A 1YIOA 3CUQC 2V89A 4Q47A 3RSNA 2DPDA 3JAMC 1SD7A 1LDKB 4B3RE 2GHFA 1IXSB 1DPRA 3ZCOA 3HG9A 1G2FC 3B73A 5FFXA 2FRHA 4UUVA 1W5TA 3ABUA 3BR5A 3KETA 1ZG3A 2LVHA 1BOBA 1FT9A 1MMGA 3SYTA 1O7LA 2B0LA 3KP2A 1W7PA 2XUBA 3MKLA 1ZRFA 1T0FC 5FLXC 2WAQN 2MC3A 4CCLA 2M8EA 2YTOA 3K6QA 1XB4A 2L4AA 3S2HJ 2QENA 3LAJA 3PQKA 2CUEA 3K70D 3CO6C 4O43A 1N3GA 2F5EA 2YR2A 1A1KA 2X9DA 4BC7A 4JYKA 3A01A 4A3IJ 1KYZA 3DTIA 2QEXI 4GKKE 2VKDA 1SD6A 2WA0A 3EYIA 1WCMJ 3BDDA 3QOPA 3O6BB 2HDDA 4EEFG 2KDZA 5KL2A 3U2RA 3Q5FA 1SVOA 4QPOA 2V86A 5IP6A 3EUAA 4GYGA 2V79A 2G9WA 1JGGA 2NNYA 3J7AY 1BBYA 4DR6E 1RR7A 1FIPA 4C2MJ 2W48A 5IYCJ 1J5EE 3G3ZA 5EG0B 2DT5A 2CH0A 5KCMA 1W4MA 1FOXA 1PJRA 4BS9A 4R2DA 1H88C 2VL8A 3LSHA 4H4KC 2BHZA 2D45A 2NVUB 1Y8RB 1Z1DA 2GOXB 2VC0A 4DNCA 2ZJQF 3HQ1A 2LY2A 2LY1A 3V7SA 3VEPA 3LSGA 4WYQB 2NRAC 5CVJA 1IXCA 1EH7A 2EMBA 2JOBA 3FXRA 5L3DA 1XDSA 4C3JJ 4M9VC 3FXJA 3S8PA 2OPTA 3ABKH 4IL6C 2DA1A 4YELA 4LK1F 2M5WA 4DUYE 4DV5E 3E97A 5LBQA 1Q1HA 1XN7A 2DMUA 2LBFA 4FHTA 4MFEA 1XC5A 4RMNA 2R5ZB 2OD5A 3TO7A 4M9ZA 2EPCA 5HLHA 1U8BA 2WV1A 1NEIA 4I6ZA 2E1OA
chains in the Genus database with same CATH topology
5FGMA 4EJWA 1CGPA 2CG4A 3SZPA 2HQNA 1SMTA 3R61A 1ON1A 3BJAA 2FBIA 3ABTA 2F5DA 2FNAA 2UZKA 1JE8A 5HLGA 1J75A 2O03A 5FFZA 2MBFA 3LA7A 5EEHA 3F23A 4A0XA 4HV6A 2ISZA 3ML6A 3K0LA 3ZP5A 2ZXJA 3I59A 4GCVA 2EFOA 1FLIA 2GQQA 3T8RA 3N4MA 2EA4A 2V1UA 4ZYEA 2XKOA 3WE2A 3B02A 3GX4X 1XMAA 1Z6RA 3F3XA 3COAC 2UWMA 3CUOA 3GWZA 2E7XA 2RQPA 3MFKA 1H0MA 4HQEA 1R58A 3RYRA 1O3RA 3DEUA 1USSA 2DPUA 1S3JA 5JI6A 3M7GA 1XCVA 2YX4A 4BYYA 3FMRA 3HOTA 2EWNA 2W57A 1KU9A 4EJUA 2L4MA 1O3TA 4HLYA 3BROA 3TOAA 1UFMA 4L9NA 4FX4A 4IXAA 4ZYDA 4JQFA 4N0BA 5DYMA 4YG2F 4WWCA 4G9YA 1ZLJA 3R0JA 1PUEE 1B59A 1ULYA 2P5LC 2R3SA 4L0YB 2H09A 5E1ZB 3CDHA 5DCFA 1FX7A 2BBYA 3DP7A 1SD4A 4Q48A 4A5NA 3VB2A 3OOPA 1ONVA 1I1GA 1JXSA 4P9UA 4RAZA 3VOEA 2VXZA 2ZNYA 3I59B 1G6NA 4I98B 2XAHA 3C18A 3VODA 2QBYA 1IUYA 3DQVC 3GLXA 4R79A 1KU3A 2COMA 3TOBA 1HW2A 5BMZA 4IRHA 3WGIA 3KZZA 5D4SA 2GIVA 3E5XA 4Y13A 5E20A 4I0AA 2Z99A 5CYVA 1K78B 2FBKA 3WTYC 4L9TA 2ETHA 1MJBA 3K1MA 4BHBA 2LDUA 2FNPA 3E6CC 2HKXA 3RYPA 2E7WA 5DD8A 2VE9A 1NHAA 2HWVA 2J5PA 1U5TC 4RAYA 2K02A 2HQRA 3CO7C 2HS5A 1QNTA 5BOXA 3F8NA 1YO5C 5FLXK 4U0WA 4LMYA 2GXGA 4EJOA 4U7DA 2G7UA 2DLLA 3K2ZA 1W7PB 2FF4A 2F2EA 2W25A 5JR3A 4ENNA 4RS8A 2RV8A 1T98A 2LNBA 3MWMA 1YG2A 3V7RA 1XDUA 1TW3A 2L01A 4EQQA 3R4KA 2YPRA 2NS0A 2VN2A 5K5OA 2CO5A 5H6QA 5CLSA 1QBJA 2Y75A 2IVMA 1Z7UA 1V4RA 3MQ0A 1LVAA 1KA8A 4A0ZA 1YW9A 1P4XA 2Q8KA 4UVCA 4IHTA 3GVAA 4L9VA 3JSPA 4A2UA 2ZNZA 1HQCA 5HS7A 3J7AO 3F21A 4NB5A 4M72A 2JTVA 4ZYGA 3KFWX 1ZGJA 4EMSA 1KU2A 1HSTA 4HW0A 1OYWA 2ACJA 2GWRA 1T2KA 2BYVE 4M74A 3JTGA 3ZMUA 1WI9A 2Y48A 1EH8A 4XLPF 4BNCA 1PP7U 4ZZDA 2VT3A 2A61A 5LGNA 1P92A 1ZH5A 3ECOA 3GZ6A 1RIOH 3ZPLA 1LQ1A 2VBWA 2HYFA 4HF0A 1P6RA 2WWYA 1LNWA 4WCGA 1J59A 5AIQA 2XRNA 3K1NA 3RTRA 4YFXF 3WTZA 2IP2A 4Y15A 2CFXA 1U6GA 3L00A 3M9AA 4MQ9F 5CJ9A 3WU0A 2FE3A 4Q4ZF 2OZ6A 1RNLA 3GFJA 4LB6B 2EV0A 2E1CA 2WTEA 1MZBA 1IN5A 5D5VB 3KEOA 5ICGA 1BIAA 4G8XA 2M45A 2JPCA 1LJ9A 1GVJA 3EQLF 3O3KA 2P5KA 4CO8A 2DTRA 2EA2A 2OAZA 1TNSA 2CWEA 1G3TA 3F8MA 4HX7A 1MGTA 4AVPA 4BHCA 1FSEA 5DDGA 5F64A 2G7HA 1MJAA 3BP8A 5FLXZ 4LB5A 5HS9A 4ZZLA 3BPXA 2JPBA 4F7ZA 1RZ4A 3R6SA 3HRTA 5LEKA 2GA1A 1W7PD 2STWA 5DD4A 2DBBA 2FOKA 3ELKA 4CDGA 2ZFWA 1FPQA 2IA0A 3BJOA 3I54A 1IN7A 2DK5A 3V4GA 2PMUA 1ZN2A 2V9VA 3RI4A 3K1PA 4MTDA 3JTHA 4LK0F 3GYHX 1UCRA 1L3LA 1EH6A 2X4HA 2VE8A 4YIFA 4RGUA 4HOBA 3SXYA 2VODA 1WQ2A 2UXNA 4HDVA 4CHUA 2EFNA 1X3UA 5JFRA 3G73A 2EB7A 4M73A 3P9KA 1YW8A 1OKRA 4B8XA 5A2QZ 3HOSA 3DPLC 5JHUA 1GXQA 2ZMEB 1U3EM 1U8RA 4EVIA 5TRDA 4ASNA 1O57A 4QWQA 1FZPB 3F6VA 3T8TA 5JVTA 2QQ9A 1OPCA 2PN6A 5CVUA 2FU4A 2CYYA 4L9JA 3F22A 2VBZA 2GAUA 1XGSA 1HKQA 2RKHA 1S7AA 1SFUA 5ICEA 1VTNC 1SFXA 1LEBA 3HSFA 5HLIA 3LA2A 3WTUC 1Z9CA 1HSJA 1R1VA 1K6OA 4KN7X 3F8CA 1D8JA 4KICA 4CGZA 1FYKA 3T1BA 5LGTA 2VC1A 3T0YA 2D1VA 4HF2A 2H6BA 4P5OA 3ZQ7A 4HX8A 1S6LA 5CVVA 4BQAA 2PJPA 3CUQB 3HRSA 4BHPA 4BH9A 3WTVC 2MLGA 1RUNA 3WGHA 1J5YA 3L09A 3WE3A 2OU2A 4QLCU 3RPQA 5ICFA 4A5MA 1E17A 2XGXA 2DW4A 4O3MA 2Y0MA 3J80Z 2O0YA 4ETSA 2P6TA 2HGCA 3GFLA 4O5VA 4WF2A 1O7FA 2KRFA 1FBUA 1R00A 2STTA 4MNUA 5L3EA 1R7JA 2R7FA 4FX0A 1IW7F 1KQ9A 5K5QA 5D5XB 2M1BA 5HDNA 5IT3A 3E5QA 2L3DA 1YW7A 4LFUA 3CUQA 3PQJA 5ILUA 1F1ZA 3ULQB 1XSXA 1ZRCA 4I09A 4HZFA 1FBSA 3TQNA 1T0FA 1U2WA 4UV8A 2EFPA 1R1UA 1BC8C 3WG9A 5J8CA 4RB3C 4NHJA 1I5ZA 2FXAA 3LA3A 1U5TB 2EJRA 3HRUA 4BAYA 2ZBKA 4LLGF 4WXHA 3SFZA 2CQKA 4HYEA 5HS8A 2L02A 4L18B 4HBLA 5CVRA 3E6DA 1L0OC 4M6XA 2Z5UA 5HVQC 3P9CA 2Q2EA 2BEOA 4A6DA 2DAOA 5TJJA 3FZVA 3KEQA 1WKMA 4L0ZB 3WTSC 1KGSA 3GFIA 2YU3A 1J2XA 1TW2A 1XGOA 1WRJA 2YSRA 4UHTA 4JK1X 2QLZA 2K27A 2YX7A 2P7CB 5E18F 5D8LB 1YLFA 4IRIA 2HZTA 1ON2A 3QPTA 3F8BA 2RC4A 5J6XA 1TQPA 3CJNA 1YQAA 1G3SA 2V1DA 3IWZA 3KP3A 1I27A 1SMYF 2QUFA 4NQWA 2KJCA 3V7CA 2BV6A 4KNYA 4R1HA 1Y0UA 1MDMB 1DPUA 4UVAA 3H92A 3LQRA 1XSDA 3HTSB 4UVBA 3GEZA 2LSOA 3KP7A 3H3UA 1R5GA 3IKTA 2DU9A 1YS7A 1ZGAA 4EJVA 3L2CA 3E3VA 2A5YB 4IJAA 1HBXG 4OIQF 3HHGA 5FD6A 3GZ5A 1PDNC 1P4WA 4UV9A 4ESFA 1UHWA 2PMHA 4EM0B 3IL2A 3KP5A 3LSTA 2HDCA 4HLXA 1G3YA 3MCZA 2MD5A 2O8XA 1TQMA 4A0YA 5F6FA 1ZLKA 4IF4A 1FWZA 3NRVA 4M71A 2IPQX 2O3FA 1R1TA 2ZMEA 3KZYA 1GXPA 3I71A 3GFMA 2AXLA 1BI2A 1FOKA 3E6MA 3RJPA 3GW2A 1U78A 3QP6A 4KFCA 4A6EA 3CLOA 4WXCA 5LHHA 1RUOA 2EFWA 5D8KB 2QQBA 2PEXA 4OOIA 4ENKA 2FBHA 2QM3A 3GUDA 3BOQA 4KMUX 3FWEA 4G7ZF 2A68F 5DEQA 1T38A 2P5VA 4KN4X 1FYMA 4XSXF 1W5SA 2RGVA 3ISPA 1AWCA 4GO1A 3I58A 1TTYA 2V6CA 3F8FA 2FEZA 3MZHA 2HR3A 5FO5A 3CTAA 4RGSA 2QBYB 2Z9OA 4AWXB 4GGGA 2HKOA 1FC3A 2UXXA 2OBPA 4N9HA 2PLYA 3KLOA 3MEXA 4MHGA 2EFQA 3HTUA 4I02A 1IAWA 4Y17A 1O3QA 3BZ6A 2XAFA 3ZMTA 2H27A 6PAXA 3SZTA 4KDPA 1KYWA 3QRFF 3K69A 1P4AA 4MQVA 3WU1B 2K7LA 3C7JA 2FA5A 3LWFA 1MDMA 1HW5A 2A3SA 3BWGA 2JSCA 3R0AA 1BM9A 2E1NA 2DQLA 2ZO4A 1R5HA 5LLQA 4LJZF 3KCCA 2JZYA 5BPIA 2DQRA 1J9IA 4IVNA 5LHIA 2PI0A 1FP1D 3IHUA 5D5UB 2XROA 5F1RA 3WODF 1MD0A 4G7OF 2MH9A 3QU6A 1S29A 1UB9A 1FSHA 4KT5C 2BGCA 3MAJA 2PBIA 5L3CA 4AIHA 3ZMVA 2CW0F 4I7HA 3JW4A 2J5OA 2Z3YA 3FM3A 2K4BA 4LD5A 4N9IA 1SD5A 3I64A 1HKSA 4EGZA 5LEJA 3T5XA 1BJAA 3HYIA 4U7BA 4OMYA 2BE5F 2WC2A 4L5JA 2LF7A 1BC7C 5L3BA 2XASA 2HEOA 4KUMA 4LG0A 1E2XA 1BN5A 4OIRF 2KIUA 1RI7A 3D0SA 2XIGA 1HXDA 3H3ZA 3U9GA 1CF7B 3W6JB 1Z91A 3DFGA 4P55A 1J0RA 3E5UA 4RGXA 3IC7A 1IN8A 1USTA 3NEUA 4CXFA 2DK8A 2F5FA 1JHFA 1ZYRF 4XLNF 4Z2YA 3EDPA 1OR7A 1HKTA 1G4DA 3JAMZ 3DV8A 3MZYA 1IN4A 1HW1A 4ESBA 3V8LA 5E1XA 5E17F 4M6YA 1OMIA 4H0EA 4HDUA 1R22A 3J80K 2DFIA 2JT1A 2ELHA 3L7WA 4LG0B 1S8NA 4EM1A 1QGPA 1EV7A 2VOOA 2IA2A 4ENJA 2FSWA 4RB1A 4KIBA 1QZZA 2HOEA 1IN6A 4OMZA 2H94A 2L54A 3ZMSA 1KU7A 3Q9VA 4A12A 2A6EF 4WX9A 4OINF 1H9TA 2O61A 1I1SA 2FMLA 2EV6A 2F5CA 2HTJA 2OZUA 3WGGA 5H20A 1TBXA 1WSUA 3TO6A 2O6GE 2P6SA 4ENMA 1KQ8A 3ZN0A 4EM2A 3NQOA 1K7AA 1BI3A 4UXNA 3ECHA 4TV7A 1B4AA 1ZREA 1QPMA 4UNOA 3U1DA 2IJLA 4IHSA 4S04A 1IXRC 3TDUC 3I0TA 1IZ1A 2PFBA 4WK8F 1JGSA 3HRMA 2ISYA 3FXQA 2A07F 1DUXC 3RKWA 2IRFG 2QWWA 5AIPA 2K86A 4CZZA 4RB0A 1MKMA 3TO9A 3WTXC 1OYIA 1SFEA 5ILSA 1ZG5A 2XHKA 4YFKF 3FMSA 4Q5SF 2H6CA 1K78A 3ZN1A 2IT0A 3TDZC 2Q0OA 4GYIA 2XKPA 5L3GA 1BIBA 3BJ6A 4JBAA 1FY7A 2GA2A 1REPC 3KP4A 3DKWA 1SAXA 5BS6A 4B09A 2FMYA 4EGYA 4EV0A 2W85A 5EEGA 4PGHA 4PCQA 2IW5A 2X0LA 2MH2A 1QQIA 1WWXA 3P7NA 1IF1A 1LDJA 4AIJA 4BXUA 2VONA 2WV0A 4HA8A 5DUIA 1OYYA 5D6EA 1YYVA 1U5TA 3GO5A 1R36A 2C6YA 2NAZA 2QVOA 1TLHB 4ZYHA 1FP2A 2RNJA 3KE2A 2XAJA 3GF2A 3OV8A 5KVRA 5D5WB 3VFZA 5CVIA 4U0VA 2MA3A 3K9TA 1IRFA 2XVCA 3ROUA 4G94A 4G6DA 2LF8A 2DI3A 1FBQA 5DCMB 1PP8F 4I0BA 3M8FA 3P9IA 4KMFA 5LGUA 2TDXA 2P4WA 5IT9Z 1B1BA 2A6HF 2ZJ2A 3QPHA 1IRGA 3IRQA 3BPVA 4FT8A 2HYGD 4LLLA 3DF8A 3EYYA 1B6AA 1STZA 3LFKA 3AAFA 3EUHA 3ZMZA 1ZRDA 4HX4A 2PQ8A 3REOA 3LQQA 5BQTA 3L9FA 2K4JA 2RDPA 3Q9SA 4LGWA 4MEYF 4I2OA 1XCBA 3R60A 3HSRA 3RKYA 1K79A 2D1HA 4IRGA 4MEXF 4RGRA 2A69F 3I53A 1ODDA 4YIIA 5ED4A 1G3WA 1XGNA 4HAMA 3RPUA 2W84A 2DO7A 3FX3A 3S2WA 4KIGA 2IA1A 5DUKA 2VOPA 3KLNA 1FNNA 2Z33A 4KIFA 2R7DA 1MJ9A 1F4KA 2OA4A 3J81K 3GXOA 3ERED 5E1WA 2P8TA 3WTTC 1R23A 1LB2A 3QU3A 1S7OA 4P9FA 1ZG1A 2KKOA 1UHMA 4OU0A 3SQNA 5D6FA 2XAQA 3RKXA 2PG4A 5ERIA 5BPDA 4HF1A 4LLNA 1T6SA 2ESHA 5E8IA 2NNNA 4HQMA 3TGNA 1BOAA 1XMKA 3ZMDA 1DDNA 2M30A 1YTYA 1LDDA 1F9NA 5K5RA 3JAMK 1J7KA 1I6XA 4U88A 4GXOA 5LRRA 3IRRA 5J8FA 1XSVA 1XD7A 2OQRA 4CYDA 1ZHFA 4EJTA 3C1DA 1QZYA 1LEAA 5A2QK 1ZARA 4D0PA 3RDIA 3WTWC 2XV4S 4MTEA 1DP7P 2CGPA 4PGGA 4L5IA 2GXBA 1JHHA 2ZKZA 3FXUA 3SHFA 4O6JA 4OIOF 4KYWA 3LAPA 2VT2A 1BI1A 3EETA 2W24A 3FHZA 4MGRA 5FD5A 5L3FA 1YS6A 1TNTA 3HUGA 2HTSA 3F6OA 3V8JA 4AD9A 4CICA 2D2WA 4U0YA 2QYOA 1D3YA 3HHHA 1H9GA 5HDGA 4M9XA 3F72A 1C0WA 1P2FA 1CF7A 2GZWA 4OIPF 3DPTA 4M9SA 1V3FA 5K1YA 3PFIA 3QAHA 1AOYA 1F5TA 5HDKA 4G7HF 4XSZF 3D5LA 4K2EA 2MLKA 1T39A 1Z6TA 2CSOA 1B9MA 3I5UA 4XBFA 2VBYA 3J81Z 2V1XA 4E70A 2JRTA 3IWFA 4RB2C 2VBXA 4I01A 3JSOA 1XGMA 4P96A 2KIFA 1B9NA 3DXJF 2HFHA 3FMQA 3TKYA 1D5VA 4ESJA 5ICCA 3HSEA 2QZ8A 4IPAA 5H6RA 1FYLA 3HIFA 3FM5A 1KQ0A 4ON0A 4ZH4F 2ADUA 2ZCWA 2OQGA 2P7VB 4R8HA 3M8EA 2M87A 3W6KB 2ESNA 5E8GA 2EK5A 3FF5A 1TQIA 3N97A 5DV5A 2NYXA 2AS5F 5KK1A 2KJBA 3M1EA 4KA4A 4PDKA 1QO0D 4XRFA 3E6BA 1D8KA 2KIMA 5DCMA 4DQ2A 1YFHA 3IKVA 5LHGA 2LKPA 5LRSA 4HV5A 4AIKA 4WXDA 5HOOA 1Z05A 3KP6A 4G6QA 1ZAOA 1A04A 3QP5A 1BI0A 1O3SA 4PZJA 5ILVA 3BY6A 4YFNF 5D4RA 2XAGA 3RIRA 5IT9K 1GHCA 3I4PA 2RVCA 2EV5A 3O2PE 2QQAA 5AONA 5FB2A 3C3WA 4S05A 3V8KA 2RN7A 2FQ3A 1YIOA 3CUQC 4Q47A 2DPDA 1SD7A 1LDKB 1IXSB 1DPRA 3B73A 5FFXA 2FRHA 4UUVA 1W5TA 3ABUA 3KETA 1ZG3A 1FT9A 1O7LA 2B0LA 3KP2A 1W7PA 2XUBA 1ZRFA 2MC3A 2M8EA 1XB4A 2L4AA 2QENA