5LLQA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119f variant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPFHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interdomain interactions rearrangements control the reaction steps of a thermostable DNA alkyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5llqA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 5llqA01
3DPTA 5LHGA 4EGYA 4UVAA 1SAXA 4ENKA 1O3RA 3LA2A 5JR3A 4HA8A 3GXOA 2FU4A 3B02A 4KDPA 3QP6A 3J80K 3P7NA 4ESBA 5JVTA 3WTWC 3U1DA 3MEXA 3CO7C 2FOKA 5LGTA 5E18F 5DUIA 4AIJA 1USSA 1T98A 3I64A 2RQPA 2ISZA 3J7AO 1IRGA 2P6TA 3TQNA 3HIFA 3F72A 3RKYA 1XGSA 1R36A 3DXJF 5DCMB 1FX7A 2KJCA 5LBQA 5TJJA 1HXDA 4EM2A 1LJ9A 4UVCA 1OYIA 3WTTC 1XB4A 4I02A 5K1YA 2O6GE 1I27A 3WODF 2VOOA 4YG2F 2IA0A 1XGNA 3KLOA 1HQCA 4ZYEA 1XGOA 3E6CC 3KLNA 2Z5UA 2CYYA 5ICCA 3R4KA 4R8HA 1FYLA 4XSZF 1LEBA 1ONVA 1W7PB 1V3FA 4NQWA 4O3MA 1Y0UA 2P5VA 4XRFA 1J59A 3CLOA 3IL2A 1LVAA 3T0YA 5CVIA 2FEZA 2K4BA 2L3DA 3ROUA 4WXDA 2M8EA 2Z33A 1U3EM 3GUDA 2O61A 3ZMSA 3PQJA 1D3YA 4M71A 2UZKA 3GFLA 3FM5A 3RI4A 2A3SA 3QAHA 2MBFA 4GXOA 2RC4A 2AS5F 3LA7A 2CW0F 4ASNA 4I09A 1HW1A 1DPUA 3IKTA 3GWZA 1JHHA 3ZN0A 3K9TA 4KUMA 1HW2A 2KIUA 1S6LA 1CF7B 4UNOA 4UV8A 4LK1F 4ENJA 1FP2A 2MLGA 3QPTA 3IHUA 2BV6A 1RUNA 2TDXA 2FMYA 3FXUA 4Q47A 2FXAA 1J5YA 1FSEA 3RJPA 2XGXA 3K0LA 3F21A 1R1UA 2VONA 2XHKA 1HKSA 2O03A 2G9WA 3EQLF 3ECOA 1Z6TA 5F64A 2IW5A 2M5WA 1VTNC 5JHUA 1HKTA 5L3GA 4HF0A 3F23A 3ERED 4OMZA 3SFZA 5J8FA 5F6FA 3I59B 3E5UA 2XAGA 5JI6A 1SD5A 4Z2YA 4QWQA 2RKHA 5LEKA 1S7OA 3HSEA 2QWWA 2E1NA 3HTSB 2ELHA 4A6DA 4HX4A 4EJTA 2EK5A 4KIGA 1W5SA 2FSWA 1R00A 2DI3A 4AIKA 4HQMA 4BHCA 3BWGA 5D5UB 4N0BA 1YO5C 4LG0A 1MJAA 2L4AA 2NAZA 4UXNA 2GA2A 5FD6A 1UHWA 1YLFA 2Y0MA 2ESNA 4L18B 1ZARA 4HV5A 4UV9A 4WXCA 1LQ1A 2FMLA 3TO6A 5BPDA 2HDCA 2QBYB 1I1SA 5FB2A 4A5MA 1O3SA 1UHMA 3TKYA 3L09A 4HDVA 3LA3A 1D8JA 1DP7P 2ZMEA 5HOOA 5JFRA 2FNAA 1LDKB 3F6VA 2OAZA 4OIPF 4BNCA 1FBQA 5EEGA 1FBSA 4TV7A 4B8XA 3E5QA 1ZHFA 3CTAA 3DEUA 3DP7A 5IT3A 5AONA 4ZZLA 4RGSA 2D1VA 1YW7A 3T8RA 5CVJA 4PZJA 4Y13A 2IT0A 5ILSA 3ZN1A 1WI9A 1YIOA 3VODA 1EV7A 1H0MA 2JSCA 3QOPA 2H6CA 5K5QA 1FT9A 2FBKA 3HRUA 2L4MA 2V79A 1YYVA 1W4MA 3REOA 2LF7A 3SZTA 2H94A 2QUFA 1G4DA 5HDGA 1IF1A 3WGHA 2K02A 2VBYA 1FZPB 4BXUA 1IXRC 3HRMA 3RPQA 5BPIA 3FX3A 1HKQA 3N97A 1BM9A 2Y48A 2M87A 5LHHA 1WSUA 3L7WA 2H6BA 2Q0OA 5HLGA 2GZWA 4ETSA 4Q48A 5FLXK 1BI0A 1GXPA 2XAHA 1UCRA 4MGRA 2XASA 1FP1D 4MTEA 4A12A 4S04A 5DCFA 3RDIA 3V7RA 1QPMA 4HX7A 2W57A 5F1RA 2EB7A 4MEYF 2HKXA 2WC2A 4PCQA 2P4WA 4EJWA 3CUQA 1MDMA 1FBUA 2P6SA 3I5UA 4L0YB 3HTUA 3ZMZA 1FNNA 1XGMA 1B9MA 4IHTA 4HQEA 2FE3A 3ISPA 3P9KA 4LGWA 3JAMZ 3GFIA 1H9GA 3QU6A 3F8FA 3IC7A 1PP8F 3SQNA 2ZNYA 1QQIA 5BMZA 1E2XA 1ZLJA 1WRJA 2W84A 1IZ1A 3FZVA 1SFXA 1RNLA 3MFKA 1ON1A 1YW8A 5ICGA 1ZG3A 2J5OA 3PFIA 4NHJA 3GFMA 5CYVA 2FRHA 1G3TA 4OIOF 2EFQA 3P9IA 4EM0B 3C7JA 2R3SA 1K78A 1IN7A 2ZFWA 3F3XA 4BHBA 5IT9Z 3ABTA 4A0ZA 1TBXA 3F8NA 1FYKA 4EMSA 2MD5A 1XMAA 3KZZA 5EEHA 2BEOA 1P2FA 2EFOA 1UB9A 1O3QA 3H3UA 1U5TB 1ZG1A 5KVRA 4IRIA 4BH9A 5FGMA 4M6YA 2DPDA 1JXSA 1USTA 2ZJ2A 1LEAA 4KN4X 4XLNF 1K78B 4ZZDA 4KT5C 3DF8A 2VT3A 4OOIA 5FFXA 4M6XA 2ZKZA 5DUKA 3TDZC 2CO5A 3BJ6A 4D0PA 5ERIA 1U6GA 3ZMVA 5D5VB 5HVQC 4RB0A 3BDDA 2VXZA 1ZG5A 3F22A 4LLNA 2J5PA 1Z7UA 3HHGA 2QBYA 1I6XA 4CO8A 4EQQA 1KQ8A 3ZMUA 4GGGA 3BOQA 1BI3A 1IXCA 2VBXA 4CZZA 3G73A 4H0EA 4I7HA 1ZRDA 2PJPA 1S3JA 3MWMA 1Z9CA 2QQBA 2QVOA 4P55A 3MZHA 2IPQX 3TO7A 1Z1DA 4LLGF 3C1DA 2STWA 5DV5A 4CHUA 1WKMA 4G9YA 3CJNA 1BI2A 3BJAA 1PP7U 1JHFA 3F8MA 1HSJA 2LSOA 2YPRA 4N9HA 2A5YB 5L3BA 4U7BA 2PFBA 1BI1A 3LQRA 5DEQA 3WU1B 3AAFA 4F7ZA 4G6QA 4PGHA 3QRFF 4CYDA 3BJOA 3ZPLA 5E1XA 4RGXA 1OMIA 4KIBA 1PDNC 3K69A 6PAXA 4RB3C 2V6CA 4FT8A 3GO5A 1F9NA 1REPC 4RGRA 4JBAA 1FPQA 3M1EA 3IWZA 1RUOA 3JTHA 1Z05A 2A6HF 3SHFA 5HDKA 1EH8A 2OU2A 3JTGA 3R0AA 1YQAA 4M9SA 1R22A 4RAZA 1R1TA 1BJAA 2LF8A 2DAOA 2EV0A 2LKPA 3I54A 1MJBA 2CGPA 3V7SA 1IW7F 2G7UA 2IA1A 2A07F 4O6JA 2Q2EA 3KFWX 2EFPA 2DO7A 3LAPA 2DK5A 4XBFA 4EJVA 5J8CA 2V1DA 3JSPA 4YFNF 2STTA 2DQLA 3KP4A 5HS7A 2XAFA 1YG2A 1BC8C 3WGIA 1ZRFA 1ZN2A 4WCGA 1Q1HA 1TTYA 2UXNA 1W7PA 5DD4A 1MZBA 2M1BA 4IHSA 3QP5A 5AIPA 4P96A 3OOPA 3M8EA 1KU9A 2H09A 5HS8A 1SD4A 2HKOA 2R7FA 3TGNA 3WTYC 2HFHA 4YFXF 4CICA 4HZFA 4ON0A 1XMKA 2GA1A 1HSTA 3H3ZA 5HLIA 3DQVC 3FXQA 1MGTA 2OZ6A 2R7DA 3GEZA 5LLQA 3KZYA 3HSFA 3RYPA 2CFXA 4U0WA 5CVRA 2HZTA 3MCZA 1NHAA 2UWMA 3GZ5A 1GXQA 4XLPF 1STZA 2EV5A 3LFKA 2XIGA 3IRRA 1YW9A 3PQKA 2XV4S 1HW5A 5L3CA 4IJAA 2DTRA 4LLLA 1YFHA 4EV0A 3L00A 2DPUA 2OBPA 1KA8A 5FO5A 1PUEE 5H6QA 1ZYRF 2JTVA 5D8KB 1ODDA 3GZ6A 4M73A 1Z91A 2ISYA 4YFKF 1FY7A 2COMA 2ZCWA 2HQRA 2G7HA 1IXSB 1Z6RA 3I59A 3JAMK 1IRFA 5LGNA 1SFUA 2ZO4A 3RKWA 2CSOA 1LB2A 3HOTA 1HBXG 3HOSA 1J0RA 3GYHX 5LGUA 1K6OA 2V1UA 4DNCA 1LDDA 3FMRA 4L9NA 2XROA 3C3WA 4HW0A 1J2XA 1T38A 3MAJA 4G7ZF 1J75A 2CQKA 4CGZA 3F8CA 1SD7A 2X4HA 2EA2A 1G3WA 1FSHA 1SD6A 4N9IA 2EFWA 2EJRA 2XVCA 1XSXA 3WTSC 4E70A 4IRHA 5H20A 4KNYA 3ZMTA 1KU2A 1TLHB 3I53A 4R1HA 3ECHA 3E6DA 2XRNA 2VE8A 1U8RA 3CUQB 1ZGJA 4K2EA 2AXLA 1KQ0A 4U0YA 2PBIA 4LD5A 2UXXA 4L5JA 2KKOA 5H6RA 1KYZA 1P92A 3Q9SA 5IT9K 5J6XA 3KP2A 4A2UA 3HSRA 1F1ZA 2FBHA 4ZYHA 1B59A 3VB2A 2FBIA 2V9VA 4DQ2A 3ZP5A 2VOPA 1T39A 1TNSA 1P4AA 5HLHA 4GO1A 2A6EF 2D2WA 2EV6A 1IN5A 4HBLA 3ML6A 3RYRA 2W24A 4LG0B 2RVCA 1R58A 4L9TA 2PMHA 2GWRA 5TRDA 4WXHA 4EVIA 2P5LC 4B09A 5LHIA 3M7GA 3HRSA 3COAC 2C6YA 4G7OF 2F5FA 1R23A 5DYMA 2DT5A 4KA4A 1RZ4A 4MHGA 4UHTA 1T0FA 1C0WA 5D4SA 3FMSA 2ETHA 2P8TA 5L3DA 5D8LB 3VEPA 3D0SA 1B1BA 4CDGA 2DK8A 1GHCA 2ESHA 3KP3A 2DLLA 3RPUA 2ACJA 4RS8A 4EJOA 2VODA 3QU3A 1K7AA 4EM1A 4MQ9F 4KFCA 5ED4A 2GIVA 3N4MA 4FX4A 3C18A 2RNJA 2L01A 3E3VA 4FHTA 1EH6A 3Q5FA 1QNTA 1RIOH 4OINF 4RGUA 3IRQA 1BIAA 1XN7A 4I0AA 3HYIA 1ZH5A 4ESFA 1SMTA 2OQRA 4HLYA 1W7PD 3WTZA 3T8TA 1XDSA 2XKPA 3I0TA 1V4RA 2W85A 1D5VA 4ENNA 4P5OA 5BOXA 4RB2C 1FLIA 2WTEA 3K1MA 1X3UA 3GVAA 4A5NA 2A61A 1R5GA 5D5XB 4HX8A 5CLSA 2ADUA 1CF7A 3KE2A 4M74A 1U78A 2PI0A 2JPCA 3Q9VA 2JT1A 4ZYGA 3KEQA 2CG4A 2KIFA 3WTXC 4HOBA 2H27A 2LDUA 3E6MA 4EJUA 2QQAA 2NNNA 4AD9A 2HYFA 4P9FA 1IN4A 2LNBA 3VOEA 3V8JA 2A68F 5LRRA 2FNPA 2HWVA 3KP5A 3LWFA 3H92A 4IVNA 1O7FA 1OYWA 1R5HA 3GF2A 1BC7C 2XAQA 3IWFA 5E20A 2D1HA 1J7KA 4XSXF 2JRTA 2MC3A 3TOBA 3T5XA 3EUHA 2Z3YA 2VC0A 1F4KA 1R7JA 3WTVC 2K4JA 3MQ0A 1IN6A 3FM3A 2PG4A 4GYIA 3W6KB 1D8KA 4ZH4F 3ULQB 4BAYA 1O7LA 2PLYA 2EA4A 5DCMA 4QLCU 1SFEA 5LRSA 4MTDA 4BYYA 4G6DA 2DQRA 1RI7A 2ZNZA 3O3KA 5ICEA 1BN5A 2OQGA 1SMYF 3DV8A 2DFIA 4MNUA 2FA5A 4Q4ZF 1F5TA 1H9TA 1FC3A 2HQNA 4OIRF 3V4GA 4MEXF 1P4WA 2HYGD 5K5RA 1CGPA 1MKMA 1QBJA 3I58A 1QZYA 3ABUA 2HOEA 1OR7A 4YIFA 4L5IA 2E1CA 1KU3A 2HTJA 3V8LA 1TW3A 3F8BA 4G8XA 3NQOA 3WE3A 1XSDA 3R0JA 3BP8A 1B6AA 2K7LA 2BGCA 1TW2A 4Y17A 4AIHA 2Q8KA 2VBZA 2O8XA 1MDMB 2Z9OA 4HF1A 1OKRA 2IJLA 3R6SA 4IPAA 4Y15A 2XKOA 3E5XA 4A0XA 2DU9A 2PEXA 2GXGA 3WTUC 1ZGAA 3DKWA 3G3ZA 4PGGA 1W5TA 4O5VA 4KICA 1WQ2A 2JPBA 3CUOA 4NB5A 2VT2A 2MLKA 1MD0A 3RTRA 1DPRA 2QQ9A 1WWXA 2W25A 3O6BB 4OIQF 5HDNA 3GLXA 3JSOA 1ULYA 4HAMA 3SXYA 4S05A 2VE9A 1L3LA 5KK1A 5FFZA 2QZ8A 1DDNA 5E8IA 3V7CA 3BY6A 2HR3A 2VN2A 3V8KA 1XDUA 2L54A 3U9GA 5DD8A 1KGSA 2X0LA 1G3SA 1S7AA 4PDKA 2MA3A 2BBYA 2E7XA 2E7WA 2MH2A 1BBYA 2GQQA 5CVVA 3K1NA 4UVBA 1OPCA 4OU0A 2EFNA 3WGGA 1GVJA 3M8FA 2IA2A 1XCVA 2NYXA 4GCVA 1ON2A 3KP6A 2YR2A 2QLZA 4YIIA 3M9AA 5E1ZB 1FOKA 3MZYA 3KCCA 4I01A 1ZRCA 3CDHA 4A0YA 3L2CA 2NRAC 2NNYA 4HV6A 4LB5A 5D6FA 1I5ZA 1R1VA 1K79A 4U7DA 4CXFA 4HF2A 3L9FA 1EH7A 2DBBA 3BROA 5LEJA 1FYMA 3LSTA 2KJBA 1A04A 1G3YA 2ZBKA 4HLXA 2PQ8A 5A2QZ 4AWXB 3P9CA 4LJZF 2YX4A 4WWCA 3WU0A 3CUQC 1O57A 2RGVA 4A6EA 5ILVA 3R60A 4IXAA 1FWZA 1QZZA 5CVUA 2NS0A 3HHHA 3RIRA 3VFZA 1JGSA 1YS7A 2Z99A 4U0VA 2WWYA 1OYYA 1AOYA 1G6NA 3F6OA 3BPXA 4MQVA 4KYWA 4I2OA 1IUYA 2MH9A 3EDPA 1YTYA 1TQMA 1DUXC 4KN7X 5D5WB 1P4XA 1TQPA 1J9IA 3ZQ7A 1UFMA 2QENA 2FF4A 2EWNA 3TO9A 3BZ6A 4GYGA 1ZREA 3E6BA 3NRVA 2P5KA 4LFUA 2F5EA 4I0BA 2YU3A 3CO6C 4ENMA 4BQAA 2O0YA 1U2WA 4M9XA 1P6RA 3GX4X 1KYWA 3HRTA 1IN8A 2F5CA 2XAJA 1LDJA 2VBWA 4L0ZB 5A2QK 2F2EA 4FX0A 3KP7A 2DW4A 5FLXZ 4LK0F 4RAYA 3LAJA 3OV8A 2F5DA 2P7CB 3HUGA 3E97A 5E1WA 3ELKA 2PN6A 1KQ9A 1O3TA 5E8GA 2XUBA 5L3EA 1BIBA 1TNTA 1ZAOA 3W6JB 4IF4A 3EYIA 3WG9A 3LQQA 4LMYA 5ILUA 4RB1A 2L02A 5DDGA 2K27A 5AIQA 4JQFA 2YSRA 1JE8A 4L9VA 1XCBA 2WV0A 1U5TA 5ICFA 1L0OC 1B4AA 4M9ZA 5D6EA 2ZMEB 2M45A 4R79A 5D4RA 3K2ZA 4ZYDA 2HEOA 2RV8A 4L9JA 4U88A 1S8NA 2IVMA 2VC1A 2FQ3A 1AWCA 3I71A 4KIFA 2D45A 3FXRA 4I98B 3B73A 4HDUA 3JW4A 3FWEA 5K5OA 1E17A 3KEOA 3J80Z 4P9UA 5E17F 1T2KA 1I1GA 2HGCA 5CJ9A 4ESJA 3RKXA 4WF2A 3O2PE 2QYOA 4G7HF 2IRFG 2QM3A 1IAWA 2ZXJA 3U2RA 4JK1X 2OD5A 1YS6A 3K1PA 3TDUC 4G94A 1T6SA 2Y75A 3KETA 3GFJA 1U5TC 4EGZA 2V1XA 5L3FA 4LB6B 3WE2A 1QO0D 4Q5SF 3J81Z 4OMYA 2OZUA 3D5LA 3ZMDA 2GXBA 3EETA 2KRFA 5BS6A 1XD7A 3T1BA 3NEUA 2HTSA 3TOAA 2YX7A 2CWEA 5FD5A 3QPHA 2HS5A 1S29A 4BHPA 2M30A 5HS9A 1LNWA 4AVPA 3I4PA 3S2WA 2RDPA 1XSVA 3FHZA 2O3FA 4HYEA 2A69F 3EYYA 2B0LA 3DFGA 2BE5F 2RN7A 2BYVE 1MJ9A 3DPLC 3FF5A 2KIMA 1TQIA 3GW2A 3R61A 4IRGA 2JZYA 2GAUA 2K86A 4UUVA 3BPVA 2PMUA 4KMUX 3FMQA 4M72A 1BOAA 2OA4A 1QGPA 4WK8F 1B9NA 3IKVA 2P7VB 3J81K 1ZLKA 2IP2A 3SZPA 4WX9A 1KU7A 4KMFA 5BQTA
chains in the Genus database with same CATH superfamily
3HG9A 2EL5A 1V54H 3C4TA 3DPTA 2XB0X 5LHGA 3JRGA 4EGYA 3IWDA 2L3CA 4JYAE 1IDYA 1K4TA 4UVAA 4KITB 1SAXA 1DGRM 2R7TA 4IOAF 3PFYA 3HQ1A 4NC6A 3L2WA 2EOOA 4HTGA 4ENKA 1O3RA 3LA2A 3JRCA 1VZ0A 1SEUA 4LF4E 5JR3A 1N75A 2Y0SN 4HA8A 2XPVA 1B8IB 3GXOA 2FU4A 4BE1A 3B02A 2CV0A 2RS6A 2K7IA 2CQXA 3HPSA 3HOUJ 3K4CA 1TWCJ 4KDPA 3QP6A 3J80K 3P7NA 3ZQIA 4ESBA 3O8HA 5JVTA 1IC8A 2QQ8A 3VHTB 3WTWC 3U1DA 2EP3A 3MEXA 2EN7A 3CO7C 2N8XA 2EIKH 2VQLA 1NG6A 2HVRA 2AQFA 2FOKA 4N4RB 5A6AA 1UILA 5LGTA 5E18F 3B6CA 5DUIA 2AQEA 4RM3A 2ZXWH 4AIJA 1USSA 1T98A 3DTKA 2K9QA 2ELYA 3I64A 2RQPA 2ISZA 3J7AO 1IRGA 2EZKA 2P6TA 4CH7A 1X3CA 1Y6IA 2X1EA 3TQNA 4QIWN 3HIFA 1F36A 2CTDA 3F72A 3OSFA 4UB8C 3RKYA 2XPWA 1XGSA 2WBSA 1R36A 3DXJF 5DCMB 5E3LA 1FX7A 2KJCA 5LBQA 1D0YA 5GAEJ 2L7ZA 5TJJA 1HXDA 1DU6A 3OYIA 2L9VA 4EM2A 1LJ9A 2R76A 4R2DA 4UVCA 1OYIA 3WTTC 1XB4A 1SVOA 3DKXA 2Y9ZA 4I02A 2LP0A 4BDYA 2H8RA 2LC2A 2UUZA 2ME0A 3PO3J 5K1YA 2L8TA 1SC7A 2O6GE 3EPKA 1I27A 4FETA 3WODF 2R7VA 4F6MA 1KONA 1ZKGA 2LRSA 3AG1H 5DS9A 4XMYA 1ETQA 2WBMA 4YRVA 1T95A 2VOOA 4PFPA 4YG2F 2IA0A 3OYFA 2MKNA 4B3TE 1XGNA 4MLQA 2EOMA 2EJ4A 3KLOA 2XDVA 1HQCA 4ZYEA 4LTYA 1XGOA 3CCJI 3ONQA 3E6CC 2NUFA 3KLNA 2Z5UA 3ZQFA 4P1WA 2CYYA 2EQRA 5ICCA 1WJBA 3R4KA 3HBLA 4R8HA 1FYLA 1BR1A 4XSZF 4HNVA 1LEBA 3M07A 2EMWA 5BR8E 4X8WA 1ONVA 1W7PB 1DU0A 3M1CA 1V3FA 3S14J 4NQWA 3IH3A 2R1FA 4O3MA 1Y0UA 2P5VA 4XRFA 1J59A 3CLOA 3THNA 5E3NA 3IL2A 2CW8A 1E3PA 3CCEI 3CESA 4B48A 3PIOF 5M5XJ 3RZDJ 1LVAA 1UG0A 3S1NJ 3T0YA 5CVIA 2FEZA 1MMNA 2K4BA 3AG4H 2L3DA 3ROUA 4WXDA 2DYRH 2H1KA 2R0QC 2M8EA 3RPUD 3ABKH 4JP0A 3HXLA 4JI3E 3ADGA 2Z33A 1U3EM 3GUDA 4E7LA 2O61A 3ZMSA 2GLIA 1MNDA 3PQJA 5FLMJ 4PUSA 3KX2A 1D3YA 4M71A 2UZKA 2JUCA 1Y39A 1JI8A 1ITYA 3A03A 3DEEA 3GFLA 3FM5A 3RI4A 3DBRB 2A3SA 3CMMA 2YRHA 2DSYA 5IXMB 5EEAA 4LITA 1WH7A 3QAHA 2MBFA 4GXOA 1UMQA 2RC4A 1VQNI 2AS5F 3LA7A 2CW0F 2EL4A 3OYMA 4ASNA 2BB8A 2DA6A 1HW1A 2JN6A 4I09A 1DPUA 3IKTA 1HA8A 1VQMI 4F9CB 3GWZA 4X1EA 3CCRI 4XOTA 1JHHA 3ZN0A 3QG5C 3K9TA 3TP3A 3T1HE 2XPUA 4KUMA 1HW2A 2KIUA 4AU7A 3MKWB 1S6LA 1CF7B 4UNOA 3BTLA 3LMLA 3VK6A 4E6KG 3H36A 1CQTA 4UV8A 4LK1F 1WZ2A 4DKKA 1FJGE 4ENJA 2EPKX 2Q2EB 3CMAI 3QWLA 1FP2A 3KEYA 2MLGA 2FD5A 2X1DA 2Y0SA 4YY3E 1X2MA 5BNGA 5FLXC 1FTZA 2O5RA 2ZXHA 3QPTA 4BEHA 1G59A 1I39A 2RAEA 2IGKA 1T4LB 3BIDA 1RKWA 3IHUA 2BV6A 1RUNA 3V42A 4DV5E 2QKLB 2DA7A 2TDXA 4JI5E 4XLFA 1MBFA 3C2BA 2FMYA 2EOYA 3FXUA 1Z3YA 4Q47A 2EZLA 3DJWA 1VQ5I 2FXAA 1J5YA 1FSEA 3KYDB 2XGXA 3K0LA 3RJPA 4B3AA 3F21A 1IV8A 2DT6A 1R1UA 4XL9A 2VONA 3G4SI 2XHKA 1HKSA 3KIOA 4C30A 2O03A 5FKKA 3IH4A 2G9WA 3F6GA 2HNHA 3S2HJ 3EQLF 3ECOA 1Z6TA 1SFKA 5F64A 1RETA 2IW5A 4DYRA 2M5WA 1VTNC 5JHUA 5F0CA 2VJ5A 1TT5B 1H88C 4XLEA 5L3GA 1HKTA 3E0JB 3LSJA 4HF0A 3F23A 5EGOB 3ERED 2LMZA 2OV7A 4IX7A 4OMZA 1OCTC 3SFZA 3OS1A 2L2MA 5J8FA 2CMPA 5F6FA 3I59B 2L33A 3E5UA 2P81A 4DV1E 2WY8Q 4IKFA 3K6QA 2ID6A 4YHHE 1JUMA 2OPTA 3FXOA 2DFFA 2XAGA 1SAUA 2R7RA 2COBA 2NOGA 4LFBE 2YTEA 5JI6A 2KISA 5IYBJ 3GCMA 1SD5A 2M8GX 4Z2YA 2ODRD 4CUGA 4QWQA 2RKHA 5LEKA 1S7OA 3HSEA 4BS9A 2EMIA 1X58A 2QWWA 2E1NA 2MC4A 3HTSB 2ELHA 3G1OA 4A6DA 2M9AA 1IDZA 3IP4B 4HX4A 4EJTA 5FJ8J 2EK5A 2MC6A 3S93A 2HDDA 4A3BJ 2CUEA 1VQPI 5KL5A 2M2EA 1W5SA 4KIGA 3JU0A 3OR1C 3E1SA 2HPMA 5EGOA 1N3GA 4DJAA 2FSWA 1R00A 2DI3A 4AIKA 3CJTB 4HQMA 4BHCA 4BGDA 3S3OA 3BWGA 3OIOA 5D5UB 1XC5A 4N0BA 1JKPC 2EPPA 1YO5C 2IBDA 2V85A 1BR2A 4LG0A 1MJAA 2L4AA 2NAZA 1ZGWA 4UXNA 2EMGA 2EOSA 3AL0C 2GA2A 1YHQI 3HGGA 3BC8A 3GTQJ 5FD6A 4D5FA 4RHBB 1UHWA 1H8AC 2YSOA 3NAUA 5C4JJ 1YLFA 3SYTA 2FGGA 2Y0MA 5E3MA 4CA0A 2F5VA 2ESNA 1DGCA 3F6HA 3H0DA 1U8BA 4L18B 2R7UA 1HR0E 5LD2C 4OWRB 3HB9A 1ZARA 4HV5A 1ZR2A 4UV9A 3JR9A 4WXCA 1LQ1A 1A1HA 2FMLA 4LF7E 1OCRH 3TO6A 5C44J 2XF7A 5BPDA 3C4BA 2MYSA 2MKDA 3HZJA 2HDCA 2QBYB 1I1SA 3DCFA 5FB2A 3PIPF 2HQ5A 2X6WA 1FTTA 4A5MA 3L2UA 2JYAA 4WYQB 2IGMA 5J1RA 3ZOQB 1K83J 1O3SA 4RM2A 1UHMA 3TKYA 2RSIA 1YUJA 2CS3A 3L09A 4HDVA 3LA3A 1D8JA 1DP7P 1JUSA 3LFUA 2ZMEA 4GRIA 3KWRA 4K0KE 5HOOA 2LK2A 5JFRA 2FNAA 3JRBA 2JOXA 1LDKB 3CC2I 2KZGA 3F6VA 4A3MJ 2OAZA 3ZOBA 2AHQA 4A3CJ 4OIPF 4BNCA 3OYAA 3JTZA 1FBQA 1D0ZA 1Y0NA 5EEGA 1FBSA 2B7EA 4TV7A 2DODA 2OF7A 4EATA 4B8XA 2DMTA 1ZK8A 2E72A 3E5QA 3NARA 2XAUA 3G2BA 1ZHFA 3VSLA 1OCOH 2LTPA 3CTAA 3DEUA 2EMFA 3DP7A 2EMLA 5IT3A 5AONA 1BOBA 4ZZLA 4RGSA 2D1VA 2DMUA 2HXIA 1YZ9A 5FKNA 2EM6A 1YW7A 3KPHA 3T8RA 5CVJA 4PZJA 1W0UA 4Y13A 4JI1E 2IT0A 5ILSA 3ZN1A 4BJ6C 3OYBA 2L0KA 2V7FA 5C3EJ 4HRIA 2I8DA 1WI9A 1YIOA 2HDWA 3VODA 1UBDC 4IEJA 3GZNB 1EV7A 3ZXSA 3JCUC 1H0MA 2JSCA 2W1OA 3QOPA 2H6CA 5K5QA 1FT9A 2FBKA 3LNQA 2ODRC 3HRUA 1PYVA 2L4MA 2VQCA 4XQFA 2W4SA 4CCMA 4X0GA 2V79A 1YYVA 2HOSA 2K5CA 1W4MA 3D5RC 3REOA 3ZQCA 2LF7A 3SZTA 2H94A 2HJJA 2QUFA 4ZTJA 1G4DA 2MABA 5HDGA 4A3EJ 2E34A 3WGHA 3HL2A 1IF1A 2E2JJ 2JWOA 2EPNA 2UXDE 2K02A 3BR3A 1FOYA 2MDGA 2DT7B 2EZ6A 3K70D 1G2FC 2VBYA 3MHHC 4CCNA 4BXUA 1IXRC 1FZPB 1N36E 3HRMA 3RPQA 5BPIA 2R7WA 3FX3A 2B9SA 1HKQA 1RKTA 1BM9A 3N97A 2Y48A 1IV6A 1V5EA 2M87A 5LHHA 1WSUA 5AC5A 3L7WA 2LR8A 4KZSA 1IBME 2H6BA 1YYOA 1IMUA 1A36A 2EPLX 1K61A 2Q0OA 5F08A 5HLGA 3OOUA 2GZWA 2YTFA 1WCMJ 3Q0UA 3ZQLA 2QSGX 4BC9A 1FIPA 4ETSA 1YJWI 4RH8A 3K6GA 4D5CA 3LMMA 3S3MA 1W1WE 2DFEA 2OTJI 3JRAA 2MG4A 3OMLA 1D5YA 2M1SA 3OYLA 4Q48A 1IRXA 2OCEA 5FLXK 1DI2A 1BI0A 1EJ9A 1GXPA 2XAHA 1UCRA 4MGRA 1UHZA 2YTDA 1JK2A 1QVUA 2EBIA 2JPAA 1X3ZB 1Y8RB 2XASA 1VQLI 3THOB 2NXNB 2WBUA 2X1CA 1FP1D 4MTEA 4A12A 4F2JC 4RAFA 4S04A 2BXZA 3ABLH 5DCFA 4MLOA 3RDIA 4UUTA 4DZJA 3V7RA 2JJ7A 1PJRA 1JJ8C 4PFOA 1QPMA 5AE2A 5A6JA 4HX7A 4YIRX 1ZAAC 3HPGA 1R4NB 2W57A 5F1RA 2EB7A 4MEYF 1P7JA 1W5CC 1W36D 2HKXA 3GTLJ 4ANJA 2WC2A 2VJIA 4PCQA 3OYJA 2P4WA 4EJWA 3UNGC 4E7IA 3CUQA 5EZHA 4IQ4A 5F0HA 1MDMA 3EUKL 1FBUA 2P6SA 3I5UA 4L0YB 1X1BA 3HTUA 4CCOA 5J1UA 2HVSA 3ZMZA 5EDNA 2LMDA 2Q1ZB 4PJMA 1QHGA 1NK3P 1T08B 1FNNA 2Y30A 1XGMA 3PNVA 2LY2A 3OTOE 1GVDA 1B9MA 2JK3A 4IHTA 4HQEA 3OYCA 1YX3A 4CCKA 4UUSB 3QYEA 4LIUA 2FE3A 2L7FP 2EOQA 3ISPA 3P9KA 4LGWA 3JAMZ 3OS2A 3GFIA 1YJNI 4ZDOA 1MMDA 1A1JA 2UU9E 1H9GA 3QU6A 4LF6E 3F8FA 1YYWA 2LG4A 3IC7A 5FKMA 3P1XA 5T6JA 2VE7C 1O0WA 4PK4A 5JHFA 1PP8F 1GT0C 3AL0B 3SQNA 2ZNYA 1QQIA 5BMZA 1BJZA 2RNGA 4KWYA 1XG1A 1E2XA 5M5WJ 5GTHC 5HNFA 3H5NA 4IS1C 1ZLJA 1WRJA 2L2OA 2W84A 3A01A 4L5NC 4F54A 4A69C 1IZ1A 2KP6A 3FZVA 3MKZA 2K85A 5M5YJ 1DGWY 1SFXA 1RNLA 2K9MA 3FBIB 3MFKA 1ON1A 1YW8A 5ICGA 2EN2A 1ZG3A 2J5OA 4XOPA 3FKJA 5F04A 4AVZA 3KYLA 1XMXA 3PFIA 4NHJA 1WJCA 3GFMA 3VDXA 5CYVA 2FRHA 1G3TA 1Z0XA 4OIOF 3I9V2 3KZIC 4XRMA 2EFQA 3P9IA 4Y33A 4EM0B 5IV8B 3VYXA 3C7JA 1KYQA 2R3SA 1K78A 4BQQA 5CKTA 1JUPA 5CQGA 1IN7A 2YU5A 2A05A 3PO2J 4XRSG 2V86A 2ZFWA 3F3XA 4BHBA 2DMYA 5IT9Z 3ABTA 4A0ZA 1TBXA 1TF6A 3F8NA 2CJJA 3BZCA 4DV6E 4CYCB 1FYKA 2Q8UA 2OCCH 1WVRA 5B66C 2HGHA 2KHXA 2EPCA 3H5AA 1A31A 4IHXA 3L2VA 2NOJB 2MD5A 4EMSA 2EN4A 3H35A 3BQZA 1XMAA 3KZZA 5EEHA 2BEOA 3TP0A 4BQOA 1P2FA 2EFOA 1UB9A 5IYDJ 4WPYA 1O3QA 2Z16A 2ME6A 2RTXA 3MMYB 3H3UA 3SEQA 1U5TB 5IP6A 2CUJA 1ZG1A 1QVTA 5KVRA 4IRIA 3PSFA 4BH9A 5FGMA 4M6YA 2DPDA 1JXSA 1USTA 2L5QA 2ZJ2A 2KZVA 1LEAA 2ELZA 4KN4X 4XKBA 4XLNF 1Q1VA 1K78B 4V19K 1RC7A 4OAYA 4ZZDA 4KT5C 4IHWA 3DF8A 2VT3A 3S32A 1MNEA 5EJCA 1G8XA 4OOIA 5FFXA 1W0TA 3QOEA 4I99C 4DUZE 4M6XA 2ZKZA 5DUKA 3TDZC 2CO5A 1A35A 3BJ6A 4D0PA 1Z7LA 2VF1A 3I4MJ 1J09A 2EORA 4M3BA 5ERIA 2FTXB 1U6GA 3ZMVA 5D5VB 5HVQC 3OIQA 4RB0A 3L1PA 1T8IA 2D9HA 3BDDA 2VXZA 4D1QA 3F22A 1ZG5A 4LLNA 2L2KB 2DMPA 2J5PA 1Z7UA 1HC8A 2B7VA 3BCBA 4Y7NJ 3HHGA 3MKYB 4XLCA 5LMUE 3DU5A 4PJ0C 5KAFC 2R7QA 2YS9A 2QBYA 1I6XA 3QPLA 4CO8A 1L4SA 2DA2A 3TL4X 1XTAA 2LUQA 3D1NI 5IP9J 1APLC 4EQQA 1VQ9I 2GOMA 3ZMUA 1KQ8A 4GGGA 1A1LA 3BOQA 4H4KC 2EE8A 1BI3A 4NBQA 1MBHA 2GHFA 3LSRA 4XIDA 1HNZE 5TGTA 1IXCA 2VBXA 3HKZN 4CZZA 3G73A 3CCUI 2EOZA 4H0EA 3IUOA 1LKXA 2LVSA 4I7HA 3CCSI 2E1MA 2V88A 3LSHA 1ZRDA 2PJPA 2L6MA 1S3JA 2VKHA 3MWMA 4LF9E 3GTMJ 3BF2A 4BBRJ 1Z9CA 4BKXA 2QQBA 2QVOA 4P55A 2MGQA 2M7BA 4DGWB 1YRNB 4JI2E 3MZHA 2IPQX 2PMZA 4BXFA 3MSWA 3TO7A 1Z1DA 4HEA2 4LLGF 1WPKA 4BBYA 3C1DA 3Q0WA 2STWA 4IO9F 5DV5A 4CHUA 1WKMA 4G9YA 3CJNA 2ZJRF 2IS6A 1YI2I 1BI2A 2X6YA 1FEXA 4CYCA 3BJAA 5GAHJ 1PP7U 2BY2A 1R4MB 1JHFA 3F8MA 1HSJA 4J01A 3HJEA 2ADRA 1WJAA 2LFBA 3K4JA 1B8IA 1GV2A 1MH3A 2LSOA 2WAQN 2YPRA 4N9HA 2A5YB 5L3BA 4U7BA 2PFBA 1BI1A 2UUCE 1TWGJ 1D1BA 3FIWA 3WG7H 4B1RA 1G2DC 1BW5A 2JVAA 4X66E 3LQRA 5DEQA 3WU1B 4JI7E 3FXKA 3AAFA 4F7ZA 4G6QA 4PGHA 3QRFF 5B5EC 4R2QA 5LMNE 1FIAA 2EZHA 2OUMA 4CYDA 2CPNA 5GPCA 2X9DA 2K9LA 3BJOA 2QSHX 4JI0E 3LL7A 3ZPLA 3GTOJ 4I76A 3HOZJ 5E1XA 1XMOE 4XM3A 4NXME 4OX9E 4MLVA 2LH9A 4RGXA 1ZELA 4X62E 1X6HA 1OMIA 2X85A 2Z1DA 3KYCB 4KIBA 2XSJC 4IQJA 3PUFA 2HOAA 1PDNC 4C2MJ 3FDYA 1MSEC 3K69A 3RZOJ 3BCAA 4UY8I 5AE3A 1OJLA 6PAXA 4RB3C 2V6CA 3WHBA 4FT8A 4DOZA 1YRNA 3GO5A 1F9NA 1REPC 5DM7F 4NNJA 2YTPA 1MBGA 5A2QC 1AAYA 2IAIA 3DPUA 4RGRA 4JBAA 2RQQA 1FPQA 3M1EA 2JUGA 4HNUA 3IWZA 1RUOA 2A5WA 4GFBA 3FHNA 3JTHA 1F2IG 1Z05A 2A6HF 2IGOA 3SHFA 5HDKA 3EPLA 1EH8A 2OU2A 3VYRB 3JTGA 2EOHA 2YTGA 3R0AA 2JQ7A 3OY9A 1YQAA 2Y9YA 3ABMH 4M9SA 2VQEE 1R22A 4RAZA 1FKAE 2HHHE 1R1TA 4U87A 4N4NB 1BJAA 2LF8A 2DAOA 2EV0A 3PNYA 3ZR8X 5FLVA 3UK3C 5KL7A 1AU7A 2LKPA 2ENHA 2CFOA 2ELJA 3DTEA 3I54A 2EMKA 1MJBA 9ANTA 3MD2A 2BBGA 3RQIA 2JA8J 2CGPA 3V7SA 1IW7F 1PUFA 2V4JC 2G7UA 2IA1A 3DTIA 2O9LA 1U9OA 2LY9A 4LG3A 2A07F 4BACA 4O6JA 4O4KA 5IT9C 2MFZA 4GEQB 2Q2EA 4M6VA 4V2GA 3KFWX 1PKPA 5EZGA 2EFPA 4FE7A 2KHMA 5IP7J 2YTQA 2DO7A 3LAPA 2DK5A 2LTRA 3FBNB 2VPLA 4XBFA 4EJVA 5J8CA 5JLWA 2LKXA 1V5FA 2V1DA 3JSPA 4YFNF 4FTHA 2RREA 2W48A 1VNDA 2STTA 2DQLA 3KP4A 5HS7A 1OCCH 2XAFA 5GADJ 4C3IJ 1YG2A 1BC8C 1IJWC 2XGCA 3GBGA 4Z6YA 3WGIA 3PUBA 1ZN2A 1ZRFA 1T4OA 4XR6A 4WCGA 4ABZA 3HDDA 2EM8A 2WAQA 1Q1HA 1TTYA 4UB6C 2UXNA 4NUBA 1T0FC 1W7PA 2F6CA 4F92B 3OWTA 4IOCF 2WCC3 5DD4A 1MW7A 3DU6A 2EM3A 1WHUA 1MZBA 2M1BA 4IHSA 3QP5A 5AIPA 2DDAA 4P96A 5K7HA 5DM6F 3OOPA 3M8EA 4NC7A 1KU9A 2H09A 1V5GA 5HS8A 1NH3A 2W82A 4BMJA 2EPOA 1SD4A 2QF7A 1ZQ3P 2HKOA 2R7FA 3JRDA 1MBKA 3TGNA 3WTYC 2HFHA 4YFXF 2EM5A 2OC6A 4CICA 2E2IJ 4HZFA 4ON0A 1XMKA 4NQWB 2GA1A 2EMXA 1VF9A 3QYBA 5DNYA 1HSTA 3H3ZA 2L9NA 5HLIA 3SDBA 3DQVC 2DA4A 3FXQA 1HLVA 1N33E 4B4CA 1E0EA 1MGTA 1A1FA 2O8KA 2OZ6A 2R7DA 3GEZA 4ZTFA 3G1MA 5LLQA 1UN6B 3KZYA 3HSFA 3RYPA 4DV4E 1TC3C 2RQLA 2CFXA 4U0WA 5JLXA 2XF6A 1AA7A 3WU2C 4A3GJ 2LCEA 5CVRA 2HZTA 3MCZA 1TN9A 3CQZJ 1NHAA 1WHQA 2UWMA 3GZ5A 3ASOH 1GXQA 4XLPF 3IV5A 3K70C 4FISA 3S1MJ 2KDOA 1STZA 1LPQA 1PJTA 4CCJA 3GLLA 1A6QA 2F4OB 2EV5A 3LFKA 3OYGA 2XIGA 5FROA 4A3LJ 5M3MJ 1XX5A 1Z77A 1WI3A 3IRRA 3OMYA 2QGUA 2X6OA 1YW9A 1D1AA 3PQKA 2XV4S 1HW5A 2L7KA 3LSIA 4IJAA 2DTRA 5L3CA 4P7DA 4LLLA 1YFHA 4EV0A 3L00A 2DPUA 1J26A 2G0EA 2OBPA 4NC8A 2NA2A 2MSYA 4JOMA 1HDDC 3QQAA 2OTLI 1HDPA 1NTCA 3W2WA 1KA8A 4HSTA 1Y8QB 5FO5A 1PUEE 2VKDA 2A6TA 2IS2A 2V89A 5H6QA 3BGHA 3JAMC 1ZYRF 2EPAA 5HNHA 2JTVA 2EMAA 3M99B 2K4VA 5D8KB 3LSGA 4WSPA 3BR6A 1X6FA 3CJQB 4Y52J 1ETXA 1ODDA 3RMPA 1Z3XA 4D9JA 4J19A 2HZDA 2KQRA 1LFUP 1QU3A 4RDUA 3GZ6A 4XICA 3CC4I 4M73A 5LL6R 2XB5A 4JX5A 1Z91A 2P0WA 2IEKA 2ISYA 2EINH 4YFKF 2L2NA 3EUHC 1FY7A 4BJTA 2COMA 1NK2P 2UV1A 2ZCWA 2DRPA 2HQRA 2G7HA 2YT4A 1IXSB 5AASA 2Y2ZA 3RCOA 2QCOA 1Z6RA 3K7AJ 4L5EA 3I59A 3JAMK 4BJ5C 2NS8A 1SR9A 1IRFA 5LGNA 1PVEA 5GAGJ 1SFUA 2ZO4A 1LE8B 2NVXJ 2KFDA 2BW3B 2CSOA 3RKWA 3I55I 1LB2A 3ECRA 2VKEA 3HOTA 2XGEA 1FJLA 5KCMA 3HOWJ 1X1DA 3HKZA 1HBXG 1TWHJ 2HOTA 3HOSA 2VKVA 1ETYA 2BY1A 1J0RA 3GYHX 1BR4A 2M3AA 5LGUA 1K6OA 5F0FA 2V1UA 4X65E 4DNCA 3BR0A 1LDDA 3FMRA 4L9NA 2XROA 1X4PA 3C3WA 4HW0A 1W36C 1DP3A 1JJ6C 1J2XA 2GLOA 1T38A 3MAJA 3BBGA 2V9KA 4G7ZF 4F9BB 2I10A 1J75A 3OR2C 2HC5A 3CCVI 1JTXA 2NVTJ 1JKOC 1POGA 2GBYA 2CQKA 3LSMA 4CGZA 2LTSA 3CCYA 3F8CA 3ZQGA 1SD7A 2VIXA 2X4HA 2EA2A 2R7SA 1G3WA 1FSHA 3HC7A 5K7ZA 1SD6A 3Q3SA 4R2CA 4JI6E 4N9IA 2ECCA 2EIJH 3GMEA 4R2PA 2EFWA 4JX4A 2EJRA 3BT9A 2XVCA 2B3TB 2CSHA 1XSXA 3WTSC 2ZC2A 1X1PA 4E70A 4IRHA 4BCAA 3DBLB 2EPFA 2LKSA 5H20A 1RQ0A 3A4CA 4KNYA 3ZMTA 1WJFA 4Y3OA 2I13A 1KU2A 4F9AB 4MFEA 1TLHB 3I53A 4R1HA 2DXIA 2LJHA 3ECHA 1LLMC 1A1GA 2HQAA 3E6DA 2LT7A 2XRNA 2VE8A 3ZQHA 4DR7E 1HF0A 2N3HA 1VQKI 2EPMX 1U8RA 1WJ5A 3CUQB 1ZGJA 4K2EA 2AXLA 2WY7Q 3MN2A 2YZTA 1KQ0A 1N78A 4FQGA 2ZSIB 4U0YA 2RSMA 2PBIA 4AC0A 4LD5A 4FK5C 2PX9A 2Y69H 3SFIA 1P9QC 2UXXA 3FKIJ 4L5JA 4NZVA 3BG5A 2KKOA 5H6RA 1F43A 2LE2A 1E3OC 1KYZA 2VL8A 2GPIA 2EN3A 1P92A 3Q9SA 4FCYA 5IT9K 5J6XA 3OYEA 3KP2A 1LFBA 4A2UA 2VRDA 3VYTB 1A5JA 4JYKA 2EM4A 3RQ4A 3HSRA 1F1ZA 2R93J 1D1CA 4GDFA 3C6MA 1SVLA 5IOZA 3OS0A 2FBHA 2EOJA 4II2A 2PJRB 2F8BA 1RRJA 4ZYHA 1B59A 2YTJA 2QSFX 3VB2A 2FBIA 1TWFJ 1UG2A 2V9VA 4DQ2A 3ZP5A 3S1QJ 4X6AJ 2YWQA 2VOPA 2N3GA 2CV2A 1X49A 1EKEA 5GTIC 1T39A 1TNSA 1P4AA 5HLHA 4GO1A 1VI0A 2A6EF 5EYRA 1QZEA 2D2WA 2VPRA 3S1RJ 2EV6A 1IN5A 2H8WA 2KMUA 3H3VK 4HBLA 2FV4B 2KDZA 3ML6A 3RYRA 1QRYA 2HI3A 2UUBE 2W24A 2I9IA 4LG0B 2RVCA 1R58A 4L9TA 4XK4A 2PMHA 2GWRA 1UZCA 2HXOA 1DQUA 5TRDA 3J7AY 4BDZA 2MDRA 2IHR1 3TW6A 4WXHA 4EVIA 4JV5E 2P5LC 2YU9J 4RA2A 3HEFA 3S8PA 3S15J 4R2RA 4B09A 5LHIA 2EN1A 2L9RA 3M7GA 3S3NA 2JY9A 3HRSA 4B44A 3COAC 5GP9A 2NS7A 2C6YA 4G7OF 3UKGA 2F5FA 4DR2E 1R23A 5DYMA 2DT5A 2WA0A 4MIMA 2VQGA 2WAFA 2VXDA 4KA4A 5LFAA 4LF5E 1RZ4A 4AQYE 2IS4A 4MHGA 4UHTA 1BB8A 3TBIA 1T4NA 4X64E 3BTCA 3DKYA 1T0FA 2BOLA 1C0WA 5D4SA 2EZIA 1HCRA 3FMSA 2ETHA 2P8TA 3DLLF 5IPAA 2DOAA 5L3DA 2EN6A 1IQOA 5D8LB 3W2AA 2LUPB 3VEPA 2IXSA 3D0SA 3OL3A 2LBSB 5KL2A 1YX5A 4II3A 4W1UA 2KIQA 2ZSHB 3J7YJ 1B1BA 4CDGA 2YTOA 2DK8A 3M8JA 1GHCA 2AO9A 5B3SH 5KL6A 2ESHA 1I3AA 3KP3A 3MKLA 4B43A 4O24A 4R2EA 5CQEA 3K4BA 5CFFE 2DLLA 1OQYA 2CUZA 2DJNA 3RPUA 2A25A 2LBFB 2EPUA 2ACJA 4RS8A 4EJOA 2VODA 3QU3A 3JRIA 2K3FA 4AM3A 1R6RA 4EM1A 1K7AA 4MQ9F 4XNFA 3FK6A 1MH4A 3FIGA 4KFCA 1GUUA 2JSPA 3J7AG 5ED4A 2V83A 2QKMB 1ETOA 2GIVA 3NWSA 3PL8A 4PJNA 4Y4RA 1ZBQA 1N34E 5B1BH 3N4MA 2DJIA 4KHPE 5KL4A 4FX4A 3C18A 2EPZA 2RNJA 4BC7A 4X9JA 2MD0A 2L01A 2CQNA 3E3VA 4FHTA 3PJRA 1EH6A 3Q5FA 1QNTA 5FKLA 1RIOH 4L8NA 1Z67A 3K2AA 2E36A 4OINF 4RGUA 1ETWA 3IRQA 2CT1A 5J1YA 1BIAA 2NVQJ 2JR1A 3BR1A 3G71I 1XN7A 2LD5A 4I0AA 3HYIA 4D7MA 1ZH5A 4ESFA 1SMTA 2OQRA 3PM1A 1VQOI 4DMIA 3HPHA 4HLYA 1FMVA 1W7PD 2ZXIA 1X5WA 3WTZA 2E1OA 1XDSA 2XKPA 3T8TA 3I0TA 1IUFA 2E60A 2NABA 1V4RA 2W85A 3AG2H 2RS7A 3QODA 2DIXA 1D5VA 1PJSA 4ENNA 4P5OA 4DYQA 2F4IA 4BE2A 4RB2C 5BOXA 3ADJA 1FLIA 3J81C 2F4MB 2WTEA 3K1MA 3K4LA 1GDTA 1X3UA 3GVAA 2M0MA 4B3SE 4C3HJ 2X6XA 2KOUA 4A5NA 2HVQA 2D5VA 2A61A 3CLQA 2M4GA 4C2TA 1S72I 2VLAA 1R5GA 1MMSA 1AKHA 2I5UA 5J47A 1ENHA 3EPZA 4DBQA 1JT0A 3W3CA 5D5XB 4HX8A 5CLSA 2B7TA 2R7XA 2L3JA 2ADUA 1CF7A 1MBJA 3KE2A 4M74A 1U78A 1WJDA 2JXPA 2PI0A 4M3FA 2JPCA 1NCSA 4J00A 1VQ6I 3Q9VA 1YSAC 4LFAE 2ZMEC 2JT1A 4ZYGA 1TT0A 3CCLI 2E35A 1OLTA 1SVMA 1Y1VJ 2WB1A 3KEQA 4P78A 3HM5A 3BTIA 5GPAA 1VQ7I 1N25A 1B72B 1IBLE 2R7ZJ 2CG4A 2KIFA 1ORKA 3WTXC 2VUMJ 1YOVB 1IBKE 4HOBA 2H27A 2LDUA 3E6MA 4EJUA 2QQAA 2NNNA 3WHCA 4AD9A 1B72A 4IJDA 2WB1N 2HYFA 4P9FA 4DR4E 1IN4A 5J3LA 2EOXA 2LNBA 4XLHA 3VOEA 4G6TB 2A68F 3V8JA 5LRRA 1UJ8A 2FNPA 2HWVA 4QTRA 3KP5A 3LWFA 1ZR4A 3BR2A 4TUGA 2M4KA 3H92A 2KPMA 3A2KA 4IVNA 1O7FA 3IH2A 4BE0A 2MW8A 1GLNA 1OYWA 1R5HA 3W6VA 3GF2A 3I56I 1A6IA 1BC7C 3RKQA 2XAQA 3IWFA 5E20A 2D1HA 2BHZA 4XKVA 1J7KA 4XSXF 2JRTA 2MC3A 1EKZA 2YU8A 2KRHA 3C2HA 3TOBA 4BU2A 2TRTA 2W7NA 3T5XA 3GTKJ 2LLKA 2EM2A 4W97A 2V6EA 3CDLA 3H9GA 5TSEA 4M3GA 2ZM6E 2WV1A 3EUHA 2Z3YA 3LSKA 2LJUA 1G2HA 2DMIA 2O7OA 2F4VE 2JVHA 2VC0A 1F4KA 2VB6A 1R7JA 3WTVC 4BBSJ 4E7SA 2K4JA 1E3HA 4DV2E 3MQ0A 1IN6A 1A1IA 3FM3A 2PG4A 2DA1A 2E19A 2NVYJ 2LREA 3LOCA 4GYIA 3A01B 3W6KB 1D8KA 3HUGB 1JGGA 4ZH4F 3ULQB 4BAYA 2PMZN 5C4XJ 1O7LA 2LOOA 2PLYA 2EA4A 3M3YJ 5DCMA 1OCPA 3CF5F 4QLCU 5AE1A 2X51A 2GM4A 1SFEA 5LRSA 4MTDA 2F48A 4BYYA 2E1MB 4G6DA 4EEFG 2DQRA 2CU7A 1RI7A 2EMYA 2ZNZA 3O3KA 2DOEA 1YUIA 2ICWG 2NVUB 5ICEA 1K4SA 1X2NA 1BN5A 2V87A 2OQGA 1SMYF 3BR5A 3DV8A 2DFIA 3I4NJ 3OYDA 2V1NA 2M7AA 2FA5A 4MNUA 4Q4ZF 1F5TA 2DB2A 1H9TA 2JMWA 1DQ3A 1IO2A 1FC3A 4JI8E 5CPRB 2HQNA 2KONA 3A0BC 2DCEA 4OIRF 3CDIA 1XNQE 1RESA 3V4GA 4MEXF 1P4WA 4CCLA 5FRMA 2EOIA 1R71A 2IS1A 2HYGD 5K5RA 1CGPA 1MKMA 2J7JA 1X48A 1QBJA 2EN8A 3CP2A 3I58A 1QZYA 3ABUA 2HOEA 1OR7A 1LUJB 4YIFA 4L5IA 2E1CA 1KU3A 4DYCA 1TF3A 4B47A 2HTJA 3V8LA 1EF4A 4BQNA 1AH5A 3H5RA 1TW3A 3F8BA 2AXTC 4G8XA 3SZGA 2XC7A 4E7KA 3NQOA 3WE3A 1XSDA 3R0JA 1U9NA 2E71A 3OYKA 3ADLA 3F9KA 3BP8A 2KLOA 1B6AA 2K7LA 3HTXA 2BGCA 2H1LA 1JTYA 1TW2A 1VQ4I 2L92A 3BG3A 4Y17A 4AIHA 2Q8KA 1YE9A 4AIDA 2VBZA 2E2HJ 1XMQE 4E4HA 2O8XA 1XNRE 1MDMB 2Z9OA 1XS9A 4HF1A 1OKRA 1GQEA 2IJLA 2KL4A 3R6SA 4KISA 3H9QA 4IPAA 2B63J 4Y15A 4V2FA 4QPQA 1R9TJ 3EPJA 2XKOA 3E5XA 1SANA 4A0XA 3L2QA 2ENAA 3A1YA 2DU9A 2EWLA 2PEXA 3OYNA 2GXGA 4RMNA 4C2UA 5J40A 3ZGKA 3WTUC 1XPXA 1ZGAA 4DBRA 1P47A 1RR7A 2DTZA 3DKWA 3BG6A 3G3ZA 4PGGA 3GTPJ 4IHYA 1WXRA 1W5TA 1ETKA 4O5VA 4KICA 4I8OA 1WQ2A 2RPCA 2YRKA 3J80C 2JPBA 2DA5A 2ID3A 3CUOA 4NB5A 2EOFA 2VT2A 1HOMA 3ASNH 1WJEA 1Z1BA 2W00A 4R2AA 4DR1E 2NUEA 2MLKA 2JVGA 1MD0A 3RTRA 1DPRA 2QQ9A 3J7ZI 1WWXA 2W25A 1QHHD 3O6BB 5HDNA 3GLXA 4OIQF 1X1AA 3JSOA 1ULYA 1X47A 4HAMA 3SXYA 4S05A 2VE9A 2YTIA 3M4OJ 4LF8E 3MZ8A 1L3LA 2LYCA 5KK1A 5FFZA 1X4OA 2QA4I 3NWTA 1UELB 2QZ8A 1DDNA 3BQYA 1IQSA 5A6BD 5E8IA 3V7CA 3BY6A 1IGNA 4DV0E 1MEYC 2HR3A 2VN2A 5A6BA 3V8KA 1XDUA 3HOVJ 2L54A 3U9GA 2EIMH 1MMAA 4XLAA 5DD8A 2HPIA 1EA3A 1KGSA 2EM7A 2EQ1A 2X0LA 1G3SA 1S7AA 4PDKA 1YYKA 1X19A 4O43A 2MA3A 3OIPA 4B3ME 2BBYA 2E7XA 4JI4E 4C9YA 4D7NA 2E7WA 4XN3A 5KHDA 2MH2A 2LV2A 1JT6A 2VJ4A 1BBYA 2GQQA 2QEXI 3JRHA 4A3DJ 1I94E 3OYHA 2H36X 3HGYA 5CVVA 3K1NA 1STUA 1OR7C 4G12A 3QPSA 4UVBA 1ACIA 1OPCA 1I6HJ 5AC4A 2UXCE 4CZCA 4OU0A 4BEHB 2EFNA 3WGGA 4R03A 1GVJA 2VQHA 1BW6A 3M8FA 5F1JA 2IA2A 1XCVA 2NYXA 4MO7A 1LE8A 4GCVA 3N05A 1ON2A 4YEJA 2LY1A 4Q35B 3MVPA 4XN0A 1LFPA 2NUGA 3KP6A 2YR2A 5KNLA 3SJMA 5IWAE 5FKOA 5JVGF 4E7JA 2QLZA 3BTJA 4F6NA 5IY5H 4YIIA 3M9AA 2UUAE 4ZDLA 5E1ZB 1FOKA 1H89C 3MZYA 3KCCA 4I01A 1ZRCA 1ETVA 2BHYA 4DZPA 2Y31A 3CDHA 4A0YA 5EG0A 4GKKE 3L2CA 3L2RA 2BVMA 2NRAC 2NNYA 4E7HA 4ZJZA 4AUXA 4XKWA 4HV6A 4CSWA 4LB5A 2MC5A 4Q28A 2V9PA 3CJRB 5D6FA 3EQ1A 1I5ZA 1R1VA 2L9SA 4U7DA 4CXFA 3ZRGA 1K79A 1S7EA 4HF2A 4DUYE 3L9FA 4DV7E 5ADZA 4B3RE 1EH7A 4LIVA 3C6KA 2DBBA 3BROA 2EOEA 2LRDA 4S0HB 5LEJA 4M2ZA 5J4VA 1FYMA 3DEWA 1IRZA 3LSTA 2KJBA 1A04A 1G3YA 1YPNA 1KZHA 3EPHA 3J7Yp 2ZBKA 4HLXA 2JRMA 2PQ8A 5A2QZ 4AWXB 1I3QJ 4N4OB 2CQ7A 2VASA 3P9CA 3TMOA 1JKQC 2M34A 2YX4A 4LJZF 5FRNA 4OOGC 1AHDP 4WWCA 3CD6I 2JA2A 1ZBTA 2BW3A 2R4GA 2DMQA 3FXLA 3WU0A 1YITI 3IWBA 2FOWA 4XKCA 3OSGA 2WBTA 3CUQC 3JRFA 1WH5A 4PJJA 2R5YB 2DGCA 3VYUB 1O57A 1D0XA 3UR3C 2WZOA 4R2SA 2RGVA 1S9HA 1A1KA 4LOCA 4A6EA 5ILVA 2GXAA 1HNWE 3R60A 4IXAA 1YJ9I 4KT6A 1FWZA 3CF2A 2IGNA 1QZZA 4BL0B 4F52A 5CVUA 2NS0A 2ENCA 4WSGA 3HHHA 3RIRA 3AV0A 4DR3E 2JWTA 3H1CA 2R7OA 3K4MA 3VFZA 1JGSA 1YS7A 2Z99A 4U0VA 3X2QH 2WWYA 2R92J 4A93J 3I3LA 2DLKA 3FXMA 1OYYA 1S5LC 1AOYA 1G6NA 5A69A 3F6OA 5J4YA 3HPZA 3DF6A 4HSRA 3BPXA 4TUIA 2JA5J 4MQVA 1MMGA 4DR6E 4OAZA 4KYWA 4I2OA 1IUYA 2EPRA 2MH9A 3EDPA 2XSDC 3C2GA 1VFCA 5K7FA 4FE4A 3CMEI 5M3FJ 1TQMA 1YTYA 2ZFUA 1DUXC 1MNMC 3FXJA 4ITVA 3EUAA 5B1AH 3U21A 4M30A 4KN7X 5D5WB 2EL6A 4QSHA 1P4XA 2EQ0A 1TQPA 1J9IA 2FQ4A 4ZYAA 4C3JJ 4PJLA 3ZQ7A 3S2DJ 4YELA 1UFMA 2QENA 2FF4A 2EWNA 4XONA 2R5ZA 2CUFA 3TO9A 4FASD 2VJJA 3G6EI 2V26A 2UXBE 4AYBN 3BZ6A 3ESWB 1O4XA 2YUSA 4GYGA 2CW7A 3O8GA 1ZREA 2PJRA 3E6BA 1HNXE 3FK7A 2DA3A 3NRVA 1R5ID 2P5KA 4LFUA 2F5EA 3ERMA 4I0BA 2B9DA 2ELKA 2YU3A 3CO6C 2K9NA 4ENMA 1KJKA 4BQAA 2O0YA 1U2WA 4M9XA 1P6RA 4F55A 3GX4X 1KYWA 3HRTA 3ZCOA 1IN8A 2F5CA 1T56A 2XAJA 2HU9A 1LDJA 3MHSC 2K40A 2VBWA 4L0ZB 4ZDPA 5A2QK 2K3PA 4M9VC 2F2EA 3AG3H 1BBGA 4FX0A 3KP7A 2EQ3A 2DW4A 1FOWA 5FLXZ 1JK1A 5HODA 4LK0F 4RAYA 2FJ1A 2N8GA 3VPRA 4HPQA 5IOYA 1RMDA 2L7MP 3LAJA 1Z21A 3OV8A 2F5DA 4XORA 3ZQQA 2FX0A 3HOXJ 2P7CB 2JA6J 4DW6A 2JOBA 3H09A 2GOXB 3HUGA 3E97A 4NHRA 4F3QA 2DOFA 1VQ8I 1ZU1A 2KT0A 5E1WA 3ELKA 4HG2A 2PN6A 1KQ9A 5E79C 4MFDA 5E8GA 1Y1WJ 1O3TA 3LSPA 3PSIA 4M3DA 3T1YE 2XUBA 1WFXA 1ERDA 5L3EA 1FOXA 1BIBA 2DLQA 1TNTA 1MIJA 1ZAOA 1MBEA 3GTJJ 3W6JB 2HYJA 4IF4A 3EYIA 1ZR9A 3WG9A 2M0CA 4ZC3A 2EMBA 3AFHA 3LQQA 2ECBA 2EMHA 3CC7I 3DBHB 4LMYA 2LO3A 5ILUA 2L02A 5DDGA 4RB1A 1X6EA 2E5ZA 2K27A 3IAS2 5F3WA 5AIQA 4JQFA 2YSRA 1JE8A 3K4NA 1PJQA 4LU9A 4L9VA 2JP9A 1XCBA 2WV0A 3E7LA 2V8QB 1U5TA 2M4IA 3S16J 2EH3A 1N77A 5ICFA 3CMYA 1L0OC 3SEZA 1B4AA 2K9SA 4M9ZA 4IHVA 1T33A 5D6EA 3G1LA 3K4KA 4RLFA 1PUFB 2ZMEB 3P5JA 1QU6A 2M45A 5DTDA 1GTKA 4QPOA 4R79A 5D4RA 1TL8A 3TEDA 2R5YA 1P7IA 3VYYA 3K2ZA 4ZYDA 1TWAJ 2LVHA 2HEOA 1WJPA 4I6ZA 2RV8A 4L9JA 2CV1A 4BUPA 2EMCA 3GTGJ 4U88A 1S8NA 3QYFA 2IVMA 2VC1A 1OISA 2VI6A 2FQ3A 1AWCA 4JX6A 2YSPA 3I71A 2BVLA 1LVKA 4KIFA 1RR8C 4DIQA 2D45A 4AYBA 3FXRA 2WAEA 4I98B 3B73A 4HDUA 3JW4A 5KL3A 1X3WB 3FWEA 5K5OA 4HEIA 1E17A 3KEOA 5TISC 3J80Z 4P9UA 1Y56A 5E17F 1BL0A 1T2KA 3H0GJ 1I1GA 2HGCA 5CJ9A 4ESJA 1B69A 4E7ZA 4F93B 1TZLA 3H9JA 3RKXA 4NXNE 2LBFA 4B3XA 4WF2A 3O2PE 2YPNA 2QYOA 3F0CA 4G7HF 2IRFG 4BY1J 1J5EE 2QM3A 1IAWA 2Z2SB 2ZXJA 3U2RA 4JK1X 2OD5A 1YS6A 2E5NA 1SFOJ 1BA5A 3K1PA 3TDUC 2ZJQF 4G94A 3AUZA 1T6SA 4O5GA 3BLYA 2Y75A 3KETA 4A3FJ 1M1EB 3GFJA 4WFTA 1U5TC 4PSWA 4EGZA 1I50J 2V1XA 4A3KJ 2KRCA 5L3FA 4LB6B 2XGDA 3WE2A 1QO0D 4Q5SF 4HNTA 2DFHA 3J81Z 3LLHA 4OMYA 2OZUA 1NG7A 2BXYA 1MSFC 2DDBA 2EM9A 5HLTA 3CZ6A 3D5LA 5KAIC 4A3IJ 3ZMDA 2GXBA 3EETA 3K10A 1RC9A 2KRFA 2XRLA 4BY7J 2YRMA 1V55H 3AKZA 3TQMA 1WGXA 5BS6A 1XD7A 1OFCX 3BZKA 3T1BA 3HOYJ 3U1KA 3NEUA 2HTSA 2CQQA 3PNTA 4IL6C 1YIJI 3TOAA 2YX7A 2E5LE 2CWEA 5FD5A 3QPHA 2YTNA 2DYSH 2VQFE 4A3JJ 3VSKA 4XRSA 2EILH 2EPXA 2HS5A 2ZJPF 5A6KA 1JKRC 2BY3A 1S29A 4BHPA 2M7QA 3DWLE 2OJED 3BG7A 3W2VA 3VYSB 2XF5A 3OL4A 2CRGA 5F27A 3SDGA 2E1MC 2M30A 3S17J 5HS9A 1LNWA 2FUG2 4AVPA 5EG0B 2TCTA 3RSNA 3I4PA 2R5ZB 3S2WA 2RDPA 1XSVA 2M9HA 3FHZA 2EMZA 1QA6A 2CH0A 4IZZA 1K6YA 2O3FA 4HYEA 2A69F 3EYYA 2B0LA 3DFGA 2BE5F 1TP4A 4RBOA 2BY0A 2DN0A 4F91B 4GZNC 3B6AA 3IWCA 1R49A 5H2FC 2RN7A 3CP8A 2BYVE 3ADIA 1MJ9A 3DPLC 3FF5A 3CCMI 1GZ6A 4NDLA 2KIMA 1TQIA 4GKJE 1AKHB 1NEIA 1IG7A 3GW2A 4UUSA 3DLAA 1QPIA 3R61A 4IRGA 4R8OA 2JZYA 2EM0A 3IAM2 4LFCE 4RLQA 4DR5E 1N32E 2GAUA 2K86A 4UUVA 4M0VA 1X1CA 1FMWA 1ZTRA 1PDAA 3BPVA 3FISA 5IYCJ 5E3OA 2PMUA 4KMUX 3Q0VA 3FMQA 4M72A 3VWBA 2WADA 1BOAA 3JREA 5EF6A 2OA4A 1QGPA 1WHNA 4WK8F 4M3EA 1UAAA 2BZTA 1B9NA 3CCQI 3A02A 2PRTA 3IKVA 2P7VB 3J81K 4PSXA 1ZLKA 2DMNA 2ZB9A 3D5SC 3A0HC 4DV3E 3TW7A 2IP2A 2X48A 4J8ZA 1BBOA 1UHSA 3SZPA 4KJZA 4WX9A 1GV5A 1KU7A 4KMFA 4RAGA 4BXXJ 5BQTA 3BG9A 1U0JA 2JA7J 2GIZA 1RPWA 1OCZH
chains in the Genus database with same CATH topology
3DPTA 5LHGA 4EGYA 4UVAA 1SAXA 4ENKA 1O3RA 3LA2A 5JR3A 4HA8A 3GXOA 2FU4A 3B02A 4KDPA 3QP6A 3J80K 3P7NA 4ESBA 5JVTA 3WTWC 3U1DA 3MEXA 3CO7C 2FOKA 5LGTA 5E18F 5DUIA 4AIJA 1USSA 1T98A 3I64A 2RQPA 2ISZA 3J7AO 1IRGA 2P6TA 3TQNA 3HIFA 3F72A 3RKYA 1XGSA 1R36A 3DXJF 5DCMB 1FX7A 2KJCA 5LBQA 5TJJA 1HXDA 4EM2A 1LJ9A 4UVCA 1OYIA 3WTTC 1XB4A 4I02A 5K1YA 2O6GE 1I27A 3WODF 2VOOA 4YG2F 2IA0A 1XGNA 3KLOA 1HQCA 4ZYEA 1XGOA 3E6CC 3KLNA 2Z5UA 2CYYA 5ICCA 3R4KA 4R8HA 1FYLA 4XSZF 1LEBA 1ONVA 1W7PB 1V3FA 4NQWA 4O3MA 1Y0UA 2P5VA 4XRFA 1J59A 3CLOA 3IL2A 1LVAA 3T0YA 5CVIA 2FEZA 2K4BA 2L3DA 3ROUA 4WXDA 2M8EA 2Z33A 1U3EM 3GUDA 2O61A 3ZMSA 3PQJA 1D3YA 4M71A 2UZKA 3GFLA 3FM5A 3RI4A 2A3SA 3QAHA 2MBFA 4GXOA 2RC4A 2AS5F 3LA7A 2CW0F 4ASNA 4I09A 1HW1A 1DPUA 3IKTA 3GWZA 1JHHA 3ZN0A 3K9TA 4KUMA 1HW2A 2KIUA 1S6LA 1CF7B 4UNOA 4UV8A 4LK1F 4ENJA 1FP2A 2MLGA 3QPTA 3IHUA 2BV6A 1RUNA 2TDXA 2FMYA 3FXUA 4Q47A 2FXAA 1J5YA 1FSEA 3RJPA 2XGXA 3K0LA 3F21A 1R1UA 2VONA 2XHKA 1HKSA 2O03A 2G9WA 3EQLF 3ECOA 1Z6TA 5F64A 2IW5A 2M5WA 1VTNC 5JHUA 1HKTA 5L3GA 4HF0A 3F23A 3ERED 4OMZA 3SFZA 5J8FA 5F6FA 3I59B 3E5UA 2XAGA 5JI6A 1SD5A 4Z2YA 4QWQA 2RKHA 5LEKA 1S7OA 3HSEA 2QWWA 2E1NA 3HTSB 2ELHA 4A6DA 4HX4A 4EJTA 2EK5A 4KIGA 1W5SA 2FSWA 1R00A 2DI3A 4AIKA 4HQMA 4BHCA 3BWGA 5D5UB 4N0BA 1YO5C 4LG0A 1MJAA 2L4AA 2NAZA 4UXNA 2GA2A 5FD6A 1UHWA 1YLFA 2Y0MA 2ESNA 4L18B 1ZARA 4HV5A 4UV9A 4WXCA 1LQ1A 2FMLA 3TO6A 5BPDA 2HDCA 2QBYB 1I1SA 5FB2A 4A5MA 1O3SA 1UHMA 3TKYA 3L09A 4HDVA 3LA3A 1D8JA 1DP7P 2ZMEA 5HOOA 5JFRA 2FNAA 1LDKB 3F6VA 2OAZA 4OIPF 4BNCA 1FBQA 5EEGA 1FBSA 4TV7A 4B8XA 3E5QA 1ZHFA 3CTAA 3DEUA 3DP7A 5IT3A 5AONA 4ZZLA 4RGSA 2D1VA 1YW7A 3T8RA 5CVJA 4PZJA 4Y13A 2IT0A 5ILSA 3ZN1A 1WI9A 1YIOA 3VODA 1EV7A 1H0MA 2JSCA 3QOPA 2H6CA 5K5QA 1FT9A 2FBKA 3HRUA 2L4MA 2V79A 1YYVA 1W4MA 3REOA 2LF7A 3SZTA 2H94A 2QUFA 1G4DA 5HDGA 1IF1A 3WGHA 2K02A 2VBYA 1FZPB 4BXUA 1IXRC 3HRMA 3RPQA 5BPIA 3FX3A 1HKQA 3N97A 1BM9A 2Y48A 2M87A 5LHHA 1WSUA 3L7WA 2H6BA 2Q0OA 5HLGA 2GZWA 4ETSA 4Q48A 5FLXK 1BI0A 1GXPA 2XAHA 1UCRA 4MGRA 2XASA 1FP1D 4MTEA 4A12A 4S04A 5DCFA 3RDIA 3V7RA 1QPMA 4HX7A 2W57A 5F1RA 2EB7A 4MEYF 2HKXA 2WC2A 4PCQA 2P4WA 4EJWA 3CUQA 1MDMA 1FBUA 2P6SA 3I5UA 4L0YB 3HTUA 3ZMZA 1FNNA 1XGMA 1B9MA 4IHTA 4HQEA 2FE3A 3ISPA 3P9KA 4LGWA 3JAMZ 3GFIA 1H9GA 3QU6A 3F8FA 3IC7A 1PP8F 3SQNA 2ZNYA 1QQIA 5BMZA 1E2XA 1ZLJA 1WRJA 2W84A 1IZ1A 3FZVA 1SFXA 1RNLA 3MFKA 1ON1A 1YW8A 5ICGA 1ZG3A 2J5OA 3PFIA 4NHJA 3GFMA 5CYVA 2FRHA 1G3TA 4OIOF 2EFQA 3P9IA 4EM0B 3C7JA 2R3SA 1K78A 1IN7A 2ZFWA 3F3XA 4BHBA 5IT9Z 3ABTA 4A0ZA 1TBXA 3F8NA 1FYKA 4EMSA 2MD5A 1XMAA 3KZZA 5EEHA 2BEOA 1P2FA 2EFOA 1UB9A 1O3QA 3H3UA 1U5TB 1ZG1A 5KVRA 4IRIA 4BH9A 5FGMA 4M6YA 2DPDA 1JXSA 1USTA 2ZJ2A 1LEAA 4KN4X 4XLNF 1K78B 4ZZDA 4KT5C 3DF8A 2VT3A 4OOIA 5FFXA 4M6XA 2ZKZA 5DUKA 3TDZC 2CO5A 3BJ6A 4D0PA 5ERIA 1U6GA 3ZMVA 5D5VB 5HVQC 4RB0A 3BDDA 2VXZA 1ZG5A 3F22A 4LLNA 2J5PA 1Z7UA 3HHGA 2QBYA 1I6XA 4CO8A 4EQQA 1KQ8A 3ZMUA 4GGGA 3BOQA 1BI3A 1IXCA 2VBXA 4CZZA 3G73A 4H0EA 4I7HA 1ZRDA 2PJPA 1S3JA 3MWMA 1Z9CA 2QQBA 2QVOA 4P55A 3MZHA 2IPQX 3TO7A 1Z1DA 4LLGF 3C1DA 2STWA 5DV5A 4CHUA 1WKMA 4G9YA 3CJNA 1BI2A 3BJAA 1PP7U 1JHFA 3F8MA 1HSJA 2LSOA 2YPRA 4N9HA 2A5YB 5L3BA 4U7BA 2PFBA 1BI1A 3LQRA 5DEQA 3WU1B 3AAFA 4F7ZA 4G6QA 4PGHA 3QRFF 4CYDA 3BJOA 3ZPLA 5E1XA 4RGXA 1OMIA 4KIBA 1PDNC 3K69A 6PAXA 4RB3C 2V6CA 4FT8A 3GO5A 1F9NA 1REPC 4RGRA 4JBAA 1FPQA 3M1EA 3IWZA 1RUOA 3JTHA 1Z05A 2A6HF 3SHFA 5HDKA 1EH8A 2OU2A 3JTGA 3R0AA 1YQAA 4M9SA 1R22A 4RAZA 1R1TA 1BJAA 2LF8A 2DAOA 2EV0A 2LKPA 3I54A 1MJBA 2CGPA 3V7SA 1IW7F 2G7UA 2IA1A 2A07F 4O6JA 2Q2EA 3KFWX 2EFPA 2DO7A 3LAPA 2DK5A 4XBFA 4EJVA 5J8CA 2V1DA 3JSPA 4YFNF 2STTA 2DQLA 3KP4A 5HS7A 2XAFA 1YG2A 1BC8C 3WGIA 1ZRFA 1ZN2A 4WCGA 1Q1HA 1TTYA 2UXNA 1W7PA 5DD4A 1MZBA 2M1BA 4IHSA 3QP5A 5AIPA 4P96A 3OOPA 3M8EA 1KU9A 2H09A 5HS8A 1SD4A 2HKOA 2R7FA 3TGNA 3WTYC 2HFHA 4YFXF 4CICA 4HZFA 4ON0A 1XMKA 2GA1A 1HSTA 3H3ZA 5HLIA 3DQVC 3FXQA 1MGTA 2OZ6A 2R7DA 3GEZA 5LLQA 3KZYA 3HSFA 3RYPA 2CFXA 4U0WA 5CVRA 2HZTA 3MCZA 1NHAA 2UWMA 3GZ5A 1GXQA 4XLPF 1STZA 2EV5A 3LFKA 2XIGA 3IRRA 1YW9A 3PQKA 2XV4S 1HW5A 5L3CA 4IJAA 2DTRA 4LLLA 1YFHA 4EV0A 3L00A 2DPUA 2OBPA 1KA8A 5FO5A 1PUEE 5H6QA 1ZYRF 2JTVA 5D8KB 1ODDA 3GZ6A 4M73A 1Z91A 2ISYA 4YFKF 1FY7A 2COMA 2ZCWA 2HQRA 2G7HA 1IXSB 1Z6RA 3I59A 3JAMK 1IRFA 5LGNA 1SFUA 2ZO4A 3RKWA 2CSOA 1LB2A 3HOTA 1HBXG 3HOSA 1J0RA 3GYHX 5LGUA 1K6OA 2V1UA 4DNCA 1LDDA 3FMRA 4L9NA 2XROA 3C3WA 4HW0A 1J2XA 1T38A 3MAJA 4G7ZF 1J75A 2CQKA 4CGZA 3F8CA 1SD7A 2X4HA 2EA2A 1G3WA 1FSHA 1SD6A 4N9IA 2EFWA 2EJRA 2XVCA 1XSXA 3WTSC 4E70A 4IRHA 5H20A 4KNYA 3ZMTA 1KU2A 1TLHB 3I53A 4R1HA 3ECHA 3E6DA 2XRNA 2VE8A 1U8RA 3CUQB 1ZGJA 4K2EA 2AXLA 1KQ0A 4U0YA 2PBIA 4LD5A 2UXXA 4L5JA 2KKOA 5H6RA 1KYZA 1P92A 3Q9SA 5IT9K 5J6XA 3KP2A 4A2UA 3HSRA 1F1ZA 2FBHA 4ZYHA 1B59A 3VB2A 2FBIA 2V9VA 4DQ2A 3ZP5A 2VOPA 1T39A 1TNSA 1P4AA 5HLHA 4GO1A 2A6EF 2D2WA 2EV6A 1IN5A 4HBLA 3ML6A 3RYRA 2W24A 4LG0B 2RVCA 1R58A 4L9TA 2PMHA 2GWRA 5TRDA 4WXHA 4EVIA 2P5LC 4B09A 5LHIA 3M7GA 3HRSA 3COAC 2C6YA 4G7OF 2F5FA 1R23A 5DYMA 2DT5A 4KA4A 1RZ4A 4MHGA 4UHTA 1T0FA 1C0WA 5D4SA 3FMSA 2ETHA 2P8TA 5L3DA 5D8LB 3VEPA 3D0SA 1B1BA 4CDGA 2DK8A 1GHCA 2ESHA 3KP3A 2DLLA 3RPUA 2ACJA 4RS8A 4EJOA 2VODA 3QU3A 1K7AA 4EM1A 4MQ9F 4KFCA 5ED4A 2GIVA 3N4MA 4FX4A 3C18A 2RNJA 2L01A 3E3VA 4FHTA 1EH6A 3Q5FA 1QNTA 1RIOH 4OINF 4RGUA 3IRQA 1BIAA 1XN7A 4I0AA 3HYIA 1ZH5A 4ESFA 1SMTA 2OQRA 4HLYA 1W7PD 3WTZA 3T8TA 1XDSA 2XKPA 3I0TA 1V4RA 2W85A 1D5VA 4ENNA 4P5OA 5BOXA 4RB2C 1FLIA 2WTEA 3K1MA 1X3UA 3GVAA 4A5NA 2A61A 1R5GA 5D5XB 4HX8A 5CLSA 2ADUA 1CF7A 3KE2A 4M74A 1U78A 2PI0A 2JPCA 3Q9VA 2JT1A 4ZYGA 3KEQA 2CG4A 2KIFA 3WTXC 4HOBA 2H27A 2LDUA 3E6MA 4EJUA 2QQAA 2NNNA 4AD9A 2HYFA 4P9FA 1IN4A 2LNBA 3VOEA 3V8JA 2A68F 5LRRA 2FNPA 2HWVA 3KP5A 3LWFA 3H92A 4IVNA 1O7FA 1OYWA 1R5HA 3GF2A 1BC7C 2XAQA 3IWFA 5E20A 2D1HA 1J7KA 4XSXF 2JRTA 2MC3A 3TOBA 3T5XA 3EUHA 2Z3YA 2VC0A 1F4KA 1R7JA 3WTVC 2K4JA 3MQ0A 1IN6A 3FM3A 2PG4A 4GYIA 3W6KB 1D8KA 4ZH4F 3ULQB 4BAYA 1O7LA 2PLYA 2EA4A 5DCMA 4QLCU 1SFEA 5LRSA 4MTDA 4BYYA 4G6DA 2DQRA 1RI7A 2ZNZA 3O3KA 5ICEA 1BN5A 2OQGA 1SMYF 3DV8A 2DFIA 4MNUA 2FA5A 4Q4ZF 1F5TA 1H9TA 1FC3A 2HQNA 4OIRF 3V4GA 4MEXF 1P4WA 2HYGD 5K5RA 1CGPA 1MKMA 1QBJA 3I58A 1QZYA 3ABUA 2HOEA 1OR7A 4YIFA 4L5IA 2E1CA 1KU3A 2HTJA 3V8LA 1TW3A 3F8BA 4G8XA 3NQOA 3WE3A 1XSDA 3R0JA 3BP8A 1B6AA 2K7LA 2BGCA 1TW2A 4Y17A 4AIHA 2Q8KA 2VBZA 2O8XA 1MDMB 2Z9OA 4HF1A 1OKRA 2IJLA 3R6SA 4IPAA 4Y15A 2XKOA 3E5XA 4A0XA 2DU9A 2PEXA 2GXGA 3WTUC 1ZGAA 3DKWA 3G3ZA 4PGGA 1W5TA 4O5VA 4KICA 1WQ2A 2JPBA 3CUOA 4NB5A 2VT2A 2MLKA 1MD0A 3RTRA 1DPRA 2QQ9A 1WWXA 2W25A 3O6BB 4OIQF 5HDNA 3GLXA 3JSOA 1ULYA 4HAMA 3SXYA 4S05A 2VE9A 1L3LA 5KK1A 5FFZA 2QZ8A 1DDNA 5E8IA 3V7CA 3BY6A 2HR3A 2VN2A 3V8KA 1XDUA 2L54A 3U9GA 5DD8A 1KGSA 2X0LA 1G3SA 1S7AA 4PDKA 2MA3A 2BBYA 2E7XA 2E7WA 2MH2A 1BBYA 2GQQA 5CVVA 3K1NA 4UVBA 1OPCA 4OU0A 2EFNA 3WGGA 1GVJA 3M8FA 2IA2A 1XCVA 2NYXA 4GCVA 1ON2A 3KP6A 2YR2A 2QLZA 4YIIA 3M9AA 5E1ZB 1FOKA 3MZYA 3KCCA 4I01A 1ZRCA 3CDHA 4A0YA 3L2CA 2NRAC 2NNYA 4HV6A 4LB5A 5D6FA 1I5ZA 1R1VA 1K79A 4U7DA 4CXFA 4HF2A 3L9FA 1EH7A 2DBBA 3BROA 5LEJA 1FYMA 3LSTA 2KJBA 1A04A 1G3YA 2ZBKA 4HLXA 2PQ8A 5A2QZ 4AWXB 3P9CA 4LJZF 2YX4A 4WWCA 3WU0A 3CUQC 1O57A 2RGVA 4A6EA 5ILVA 3R60A 4IXAA 1FWZA 1QZZA 5CVUA 2NS0A 3HHHA 3RIRA 3VFZA 1JGSA 1YS7A 2Z99A 4U0VA 2WWYA 1OYYA 1AOYA 1G6NA 3F6OA 3BPXA 4MQVA 4KYWA 4I2OA 1IUYA 2MH9A 3EDPA 1YTYA 1TQMA 1DUXC 4KN7X 5D5WB 1P4XA 1TQPA 1J9IA 3ZQ7A 1UFMA 2QENA 2FF4A 2EWNA 3TO9A 3BZ6A 4GYGA 1ZREA 3E6BA 3NRVA 2P5KA 4LFUA 2F5EA 4I0BA 2YU3A 3CO6C 4ENMA 4BQAA 2O0YA 1U2WA 4M9XA 1P6RA 3GX4X 1KYWA 3HRTA 1IN8A 2F5CA 2XAJA 1LDJA 2VBWA 4L0ZB 5A2QK 2F2EA 4FX0A 3KP7A 2DW4A 5FLXZ 4LK0F 4RAYA 3LAJA 3OV8A 2F5DA 2P7CB 3HUGA 3E97A 5E1WA 3ELKA 2PN6A 1KQ9A 1O3TA 5E8GA 2XUBA 5L3EA 1BIBA 1TNTA 1ZAOA 3W6JB 4IF4A 3EYIA 3WG9A 3LQQA 4LMYA 5ILUA 4RB1A 2L02A 5DDGA 2K27A 5AIQA 4JQFA 2YSRA 1JE8A 4L9VA 1XCBA 2WV0A 1U5TA 5ICFA 1L0OC 1B4AA 4M9ZA 5D6EA 2ZMEB 2M45A 4R79A 5D4RA 3K2ZA 4ZYDA 2HEOA 2RV8A 4L9JA 4U88A 1S8NA 2IVMA 2VC1A 2FQ3A 1AWCA 3I71A 4KIFA 2D45A 3FXRA 4I98B 3B73A 4HDUA 3JW4A 3FWEA 5K5OA 1E17A 3KEOA 3J80Z 4P9UA 5E17F 1T2KA 1I1GA 2HGCA 5CJ9A 4ESJA 3RKXA 4WF2A 3O2PE 2QYOA 4G7HF 2IRFG 2QM3A 1IAWA 2ZXJA 3U2RA 4JK1X 2OD5A 1YS6A 3K1PA 3TDUC 4G94A 1T6SA 2Y75A 3KETA 3GFJA 1U5TC 4EGZA 2V1XA 5L3FA 4LB6B 3WE2A 1QO0D 4Q5SF 3J81Z 4OMYA 2OZUA 3D5LA 3ZMDA 2GXBA 3EETA 2KRFA 5BS6A 1XD7A 3T1BA 3NEUA 2HTSA 3TOAA 2YX7A 2CWEA 5FD5A 3QPHA 2HS5A 1S29A 4BHPA 2M30A 5HS9A 1LNWA 4AVPA 3I4PA