5LLQA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119f variant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPFHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interdomain interactions rearrangements control the reaction steps of a thermostable DNA alkyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5llqA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 5llqA01
5DDGA 5A2QZ 3LQQA 3QU3A 4IPAA 2W84A 5D5UB 1UHMA 3I59B 4M9XA 3F8FA 5F6FA 1O3TA 5ERIA 2GA2A 2CYYA 2XRNA 1HXDA 3WGGA 4GCVA 2DBBA 1KU9A 2XAGA 3WTUC 3VEPA 4YFKF 1MJ9A 1T2KA 2VONA 1S7OA 2MH2A 1I6XA 2XVCA 5K5OA 2O0YA 3WTXC 4HBLA 4EM0B 3LAPA 2VE8A 3R61A 3WTYC 2W25A 4RAZA 4UVBA 1LQ1A 2EB7A 4Q47A 3KFWX 1WQ2A 1LDKB 1ZGAA 1QGPA 1O3SA 5BOXA 3BJOA 4FX0A 1FY7A 3WGIA 1SD7A 1TW3A 5FD6A 4EV0A 2UXNA 1T98A 2OQGA 2DPUA 5DV5A 2FBKA 1FC3A 1TNTA 4LLNA 4QLCU 2OU2A 4P9FA 1U8RA 2K4JA 4EJUA 1J2XA 2HR3A 4M6YA 3DF8A 2V6CA 3RJPA 1FBQA 4CICA 5F64A 4P5OA 5D4RA 1ZGJA 1SD5A 1F4KA 3FXQA 1GHCA 2FU4A 3KEOA 3BPVA 3V8LA 1IN6A 1RI7A 3GFLA 2BGCA 4AIKA 3WG9A 2DQRA 3KETA 3HOTA 2NNNA 1G4DA 4IRIA 4XSXF 4IRHA 3CUQB 2QM3A 1DPRA 2DK8A 5D4SA 4JBAA 3RPUA 4CHUA 1JGSA 2CO5A 2L3DA 1TQMA 1W5SA 2UZKA 3P9KA 2IP2A 2ZXJA 3GEZA 3F22A 5LRRA 4BAYA 1KQ9A 2XROA 1IRGA 1YS7A 3C1DA 4IJAA 2QLZA 4JK1X 5HDGA 4TV7A 4HV6A 3GFIA 4OU0A 4M72A 1XSXA 1F1ZA 1DPUA 3J81K 1H9TA 2HOEA 2QBYB 3KZYA 4Q48A 4WF2A 4A12A 3HHGA 1HSTA 2D1VA 3T0YA 1P4WA 4LJZF 1XD7A 3P7NA 1WSUA 3F6VA 2WTEA 1J5YA 5HOOA 1QQIA 3ZMSA 2GA1A 2Q8KA 3E6DA 4XLPF 3D5LA 4UV9A 1Z1DA 4EGYA 3I0TA 4UVAA 2V1DA 1D5VA 2E7WA 1JE8A 2STWA 1B6AA 2UWMA 2F5FA 1P4XA 1USTA 4HF2A 1LEAA 1KYWA 5AIQA 3LWFA 4L9NA 2K86A 4L9JA 3MCZA 1ZG3A 2P8TA 2IT0A 1AOYA 5K5QA 3IHUA 1FYMA 2ZBKA 3BOQA 4XSZF 4BHCA 5ILUA 4CXFA 2DTRA 3ZPLA 2NYXA 1YYVA 1BC8C 2P5LC 2FOKA 4HA8A 3K0LA 3DXJF 4UUVA 5H6QA 1VTNC 3FMSA 2B0LA 2ADUA 4MQ9F 3HTSB 2H09A 3E5XA 3KP5A 3MWMA 2PN6A 2DLLA 2OZ6A 5JHUA 1DUXC 5CVIA 1IF1A 3I5UA 3CTAA 1OR7A 4WXCA 1XDUA 2OQRA 3T5XA 2HGCA 4AIJA 1I5ZA 4N0BA 4KA4A 2JZYA 3PFIA 1Z6TA 3HRMA 1FLIA 2PQ8A 4CO8A 5KK1A 5L3FA 1YS6A 3RYRA 3CUQC 4U0VA 2X4HA 5LEJA 4I0AA 2VOPA 2ZNZA 2JTVA 4U0YA 1A04A 4XRFA 2HEOA 2H6CA 2EJRA 1HSJA 4LG0B 5E20A 4PZJA 3DQVC 3RTRA 2MLGA 3G73A 3FHZA 3E6MA 1O7FA 2DW4A 3KP3A 2FA5A 3BROA 2F5CA 1T39A 5D8LB 2MD5A 1EH6A 2TDXA 5D5WB 1OYWA 4RGXA 1K79A 5CVRA 3QP6A 2Q2EA 4UHTA 2A61A 3SFZA 3SHFA 1U5TA 1FBSA 3GUDA 2FXAA 1R36A 4S05A 2VC0A 3MEXA 4HZFA 3HSEA 4BH9A 1BN5A 4FT8A 4A6EA 3E3VA 3N4MA 2VT3A 4HQMA 1YG2A 4LD5A 5HDNA 1OYYA 3WTTC 3TQNA 2GIVA 1E2XA 1XGMA 4H0EA 2XGXA 3H3UA 2X0LA 5HLHA 4EMSA 2QQ9A 2RQPA 2HWVA 2VBWA 1XCBA 3FZVA 5CJ9A 1V3FA 2P7CB 2BBYA 5AIPA 3GW2A 1WWXA 4ZYEA 2FNAA 2Y48A 2J5PA 3OOPA 2XAFA 5HVQC 3F21A 4U88A 1B9NA 2GXGA 2PI0A 1F5TA 2DQLA 3TO6A 1XN7A 2IJLA 4HDUA 2HKXA 2P5VA 1QPMA 4KIBA 3QRFF 1D8JA 2KIMA 1ZREA 3D0SA 2EV0A 5H6RA 2AXLA 1XMAA 3F8MA 3GZ6A 3GFJA 1PP7U 5E8IA 1YO5C 4XBFA 2ISYA 3CLOA 4HYEA 3F6OA 2FMLA 3PQKA 1C0WA 4L5JA 1TW2A 1Z91A 4KYWA 4Q4ZF 2V1XA 3FWEA 3EYIA 4G6QA 5JR3A 4LK0F 1YLFA 5BQTA 4CGZA 4ENJA 4PGGA 5K5RA 1F9NA 5D6FA 4P9UA 5AONA 1TQIA 3QAHA 3ROUA 4BXUA 3DPLC 2J5OA 1YFHA 2F5EA 1O7LA 3GFMA 2DU9A 4P96A 2ESHA 5HS7A 5K1YA 1J9IA 3KP4A 2KJCA 2E1CA 1R1TA 3RKYA 2Z5UA 3FM5A 2MH9A 2P4WA 2RC4A 2FEZA 2L4MA 4M9SA 3H3ZA 1BBYA 5ILVA 1S3JA 1TLHB 4I0BA 4HF0A 2LNBA 3LQRA 2PFBA 4MGRA 3WTVC 2P5KA 3DV8A 3FX3A 3F8NA 3QU6A 5ILSA 2HKOA 5TRDA 1TNSA 2W85A 2C6YA 5E1XA 5HS8A 1D8KA 4EM2A 3ISPA 3KLNA 1CF7B 3KLOA 1LEBA 2M5WA 1Z6RA 5LRSA 1AWCA 5DEQA 5E18F 5IT9K 4MHGA 3TO7A 1G3SA 2JT1A 2L4AA 1B59A 3HRTA 3TKYA 4YIIA 4PDKA 2GQQA 1IN7A 4ESJA 2Z99A 1PP8F 2CGPA 1U78A 5LGTA 4OIPF 3VB2A 5DYMA 2XASA 4R1HA 4BHPA 1X3UA 5JI6A 2HQRA 3IWFA 4BHBA 2BV6A 3VODA 1Y0UA 2D45A 3L09A 3ZP5A 4WXHA 3GYHX 2HZTA 4G94A 3KCCA 3C3WA 4KT5C 2EFPA 3CO7C 3RDIA 2RV8A 3I59A 4MNUA 1IAWA 5CYVA 3ZN1A 3FMRA 1O3RA 1IXSB 5LHGA 2OA4A 2OD5A 2QQAA 1H9GA 1WRJA 1HW5A 2HQNA 1UFMA 2YSRA 4EGZA 4OMYA 1LNWA 2CW0F 3J80K 1MD0A 3FF5A 2ACJA 1FP2A 3HHHA 3RYPA 5J6XA 2IPQX 2IA0A 2R7FA 1T38A 4KFCA 1FYLA 3LA7A 2MC3A 2O03A 3O2PE 4PCQA 2NNYA 3K69A 2HYFA 1KA8A 3R60A 3J80Z 4QWQA 4A5MA 1U3EM 1ZRDA 2PLYA 4ASNA 3COAC 2FNPA 1LDDA 2DAOA 2F5DA 4G7ZF 1BOAA 5IT9Z 4OMZA 3ECOA 3CUOA 4A0YA 4A5NA 2ZNYA 3SQNA 1ZG5A 3GWZA 3S2WA 3EDPA 4D0PA 2G7UA 5D5XB 3R6SA 4G7OF 1RZ4A 3P9CA 4UNOA 3O6BB 4KDPA 3ECHA 3HSRA 1ULYA 1I27A 2XAJA 4NB5A 2EK5A 2WC2A 2P6SA 2FE3A 2F2EA 4Y15A 3QP5A 1JXSA 1MJAA 3TO9A 1IN4A 1R23A 4I09A 1U2WA 4EJTA 1FWZA 3L9FA 1TTYA 1Q1HA 2BYVE 4K2EA 3T8TA 1R5GA 4KUMA 2EFOA 4UVCA 2UXXA 3F8CA 1S6LA 4L0ZB 2L02A 1W7PA 2A69F 4O3MA 4EM1A 1STZA 1OMIA 1K78A 4A2UA 3W6KB 1TQPA 2QQBA 1L0OC 1FBUA 3ABUA 4I02A 4HX7A 3E5QA 5HS9A 3NEUA 3E5UA 4HV5A 1K78B 2O6GE 3M8EA 4FX4A 3VOEA 3V4GA 1XB4A 2EA4A 2A6HF 1FNNA 4ZH4F 1S29A 3RPQA 4ZZLA 1QZZA 1XCVA 2XAHA 3GVAA 3ZQ7A 4ENKA 5L3DA 3WE2A 3Q5FA 1FOKA 5CLSA 4YFXF 2AS5F 4Y13A 2GZWA 2H6BA 3HOSA 2LDUA 3HRSA 2PEXA 1B9MA 2IA2A 2PBIA 1P6RA 2IA1A 2G9WA 2XV4S 3H92A 4I98B 1FYKA 1KU7A 3JTHA 4RS8A 5BMZA 2QENA 4WK8F 4GYIA 2XKPA 2VBXA 5FD5A 2K7LA 4GO1A 1MGTA 1QBJA 1KU2A 3B02A 5LGUA 3RIRA 4RAYA 2QBYA 2YX7A 5DUIA 4JQFA 4IF4A 5FFXA 3JSPA 5LLQA 2FMYA 3BJAA 3NRVA 2O3FA 5E8GA 4L9TA 2Y75A 1MKMA 3I64A 1T6SA 3QPHA 2A68F 4L9VA 2RGVA 1MZBA 2RDPA 3F8BA 5CVUA 1J75A 2YX4A 5D5VB 2MA3A 3GZ5A 2FBHA 1K6OA 2D1HA 1LB2A 1YIOA 2HS5A 4IHTA 3R0JA 3ERED 3HYIA 3KEQA 4Z2YA 4AWXB 4UV8A 1EV7A 2MBFA 1SMTA 2QYOA 3O3KA 5EEHA 3EETA 3HIFA 5CVJA 2RKHA 3IRQA 4LB6B 2GAUA 4AIHA 1XGSA 4E70A 2ZKZA 4KN7X 1J0RA 4DQ2A 1P92A 1DP7P 1U6GA 5FLXK 1I1GA 2RN7A 1MDMB 4WXDA 2NRAC 1ZYRF 3TOAA 1RNLA 3U2RA 1CGPA 3HUGA 4BQAA 3GF2A 2ZMEB 3FMQA 1RUNA 4HAMA 4ENMA 4RB2C 3KP2A 3BDDA 3K2ZA 3CDHA 4EJOA 5E1ZB 4HQEA 4CZZA 4GYGA 1R1VA 3KZZA 5FLXZ 3KP6A 2DO7A 3FXRA 3P9IA 1R58A 3WGHA 2Q0OA 5ICEA 4F7ZA 1Z9CA 1YW8A 4YFNF 3K1PA 3DEUA 2XIGA 1HQCA 3AAFA 3DKWA 4FHTA 5L3GA 2R3SA 2M45A 3MFKA 4ENNA 4LG0A 3MQ0A 1FPQA 1XGOA 3KP7A 4M74A 1BM9A 5E1WA 2WWYA 4G8XA 2EWNA 3L7WA 4NQWA 2HDCA 1R7JA 4KICA 1FSHA 4I7HA 1QZYA 3WU0A 4ZYDA 2CWEA 1OKRA 3J7AO 1KGSA 4HX8A 3WU1B 4WX9A 5LGNA 4L18B 4KIFA 1CF7A 1G3TA 4Q5SF 3N97A 4KN4X 1HKSA 4IVNA 1GVJA 2QZ8A 2CFXA 3LFKA 1LJ9A 2V1UA 1EH7A 4MTDA 1BIBA 1BI2A 3V8KA 1ONVA 1SFEA 5DUKA 2QWWA 3Q9SA 4M6XA 1OYIA 2NAZA 2A5YB 4LB5A 1R1UA 1QNTA 2FBIA 2RNJA 2KJBA 1G3YA 1LVAA 1S8NA 3Q9VA 1O3QA 4B09A 1MDMA 4I2OA 3DPTA 2GWRA 1R00A 1ZARA 1ODDA 4EQQA 2VOOA 1BJAA 4EJWA 2QVOA 2R7DA 3JAMK 3TOBA 1P4AA 1T0FA 3I58A 2DFIA 4UXNA 2COMA 5ICFA 1Z05A 3R4KA 1UB9A 1QO0D 2Z9OA 4EJVA 2STTA 3I53A 4I01A 3K1NA 1ZH5A 1TBXA 2CQKA 3JW4A 3LSTA 4BNCA 3HTUA 3G3ZA 4RB0A 1IXRC 2GXBA 2O61A 1Z7UA 4O5VA 2QUFA 1SFUA 1ZAOA 1ZN2A 5ICCA 2CSOA 4LLGF 1SFXA 1BI1A 1OPCA 1KQ0A 1YW9A 2VODA 2L54A 4L0YB 2XUBA 1W4MA 3M9AA 3BZ6A 1HKQA 3TDZC 4NHJA 3V7CA 1J59A 4AD9A 2BE5F 3JSOA 1B1BA 2ZFWA 1HBXG 5E17F 1WI9A 3MZYA 3QOPA 1BIAA 4MQVA 3CUQA 4RGRA 4HF1A 1U5TC 5LEKA 1BC7C 1JHHA 1U5TB 5L3EA 3ZMTA 4CYDA 2YU3A 5HDKA 2P6TA 5HLGA 2HTJA 4M71A 3TDUC 4MTEA 3J81Z 3MZHA 2CG4A 3E97A 4IRGA 3OV8A 2W57A 3IWZA 5JVTA 1W5TA 1R5HA 3E6BA 5J8FA 3WTWC 3K9TA 4PGHA 1RUOA 4A6DA 3T1BA 4DNCA 5FGMA 1ZRCA 4G9YA 2Z33A 3SZTA 2OZUA 3BJ6A 4HX4A 4HW0A 1I1SA 1IUYA 3R0AA 4G6DA 3BPXA 1MJBA 3F72A 3SZPA 5LBQA 2KIFA 3T8RA 4S04A 4LGWA 4ON0A 5ED4A 3K1MA 2EA2A 5DCMA 3ABTA 3ZMDA 3ML6A 2MLKA 2VE9A 2EV6A 4P55A 1IXCA 3B73A 3PQJA 1ZG1A 2PJPA 1YQAA 5CVVA 1GXQA 3KE2A 1PDNC 4B8XA 4ZYHA 3V7RA 1ZRFA 3EYYA 1HW2A 5ICGA 4GXOA 1IZ1A 3EUHA 2H27A 2BEOA 2IW5A 1IRFA 3TGNA 4OIQF 4U7BA 4IXAA 1BI3A 2ZJ2A 3IL2A 2PMUA 2FQ3A 2DK5A 3DFGA 3WE3A 1SD4A 2HTSA 3FM3A 1RIOH 4OIRF 5DD8A 5FO5A 1E17A 1DDNA 4IHSA 4WWCA 2Y0MA 1ON1A 5J8CA 4RGSA 3M8FA 4XLNF 3V8JA 4WCGA 4LLLA 1D3YA 2VC1A 2EFWA 2FF4A 2L01A 5KVRA 1USSA 3L2CA 3I54A 2K4BA 4HDVA 2XHKA 1FZPB 2XKOA 1JHFA 1XSDA 2ZMEA 1SAXA 3REOA 1IW7F 2M1BA 3M1EA 4Y17A 3JTGA 4U7DA 1HKTA 2KKOA 3IC7A 5LHIA 2JRTA 4G7HF 1WKMA 5L3BA 2LSOA 3WODF 3MAJA 4A0ZA 3RI4A 3LA2A 2KIUA 2M87A 3BP8A 5IT3A 4KMFA 2VN2A 1KQ8A 2DI3A 4LK1F 4N9IA 4ESBA 4KNYA 4HLYA 4M9ZA 2IRFG 1ZHFA 1ZLKA 2D2WA 3U9GA 2ISZA 1HW1A 3BY6A 1L3LA 1KYZA 3F3XA 5HLIA 3RKWA 3VFZA 1IN5A 1O57A 1G3WA 1XSVA 2EFNA 2DPDA 2WV0A 2LF8A 4OOIA 3LAJA 2E7XA 4YIFA 2OAZA 2FSWA 1SD6A 2YPRA 1ZLJA 2JPCA 1PUEE 5BS6A 4U0WA 3I71A 2A6EF 1W7PB 3E6CC 1S7AA 2O8XA 3CJNA 2KRFA 3F23A 1P2FA 3GXOA 2NS0A 3ZMVA 2ETHA 1IN8A 1J7KA 1YW7A 2W24A 3GX4X 2ESNA 2A3SA 2A07F 1XGNA 1XMKA 1NHAA 4R79A 5FFZA 3ULQB 1K7AA 3JAMZ 3SXYA 4KIGA 3C7JA 2VT2A 2K27A 3HRUA 4HLXA 5DCMB 5FB2A 3WTZA 2OBPA 3IKTA 2Z3YA 5F1RA 1SMYF 3WTSC 3GLXA 4LFUA 2E1NA 5L3CA 6PAXA 2LF7A 1GXPA 4LMYA 5DD4A 2V9VA 4ETSA 1FX7A 3IRRA 2EV5A 1FSEA 5D8KB 2G7HA 2LKPA 1LDJA 4ZZDA 1W7PD 2M30A 5JFRA 4OIOF 4A0XA 4EVIA 4YG2F 4AVPA 1G6NA 4ESFA 2IVMA 3BWGA 4ZYGA 2VXZA 4O6JA 3RKXA 2PMHA 5BPIA 4BYYA 2JPBA 3LA3A 2RVCA 2EFQA 4L5IA 4MEYF 2PG4A 4R8HA 2XAQA 2H94A 4M73A 3ZMZA 3DP7A 1YTYA 3L00A 2M8EA 2VBYA 3ZN0A 2ZCWA 2JSCA 1EH8A 4RB1A 4N9HA 3ELKA 5EEGA 1H0MA 5H20A 1FT9A 2K02A 3I4PA 3W6JB 3EQLF 2P7VB 3V7SA 1UCRA 4MEXF 5BPDA 1ON2A 5D6EA 3HSFA 3C18A 2ZO4A 4OINF 3FXUA 2FRHA 5LHHA 3GO5A 1BI0A 3M7GA 4RB3C 4KMUX 5TJJA 3IKVA 4HOBA 4RGUA 1FP1D 2DT5A 1KU3A 2HYGD 4GGGA 1B4AA 2VBZA 3NQOA 1R22A 2V79A 5A2QK 3CO6C 5DCFA 2ELHA 2YR2A 1V4RA 4CDGA 2HFHA 3QPTA 3U1DA 1UHWA 1XDSA 3ZMUA 1REPC
chains in the Genus database with same CATH superfamily
5DDGA 2KMUA 5A2QZ 2BZTA 4D5FA 3G4SI 2R7UA 2NUEA 3LQQA 3QU3A 4IPAA 1XG1A 2W84A 2YTPA 5D5UB 1UHMA 3I59B 4M9XA 3F8FA 5F6FA 4BCAA 1O3TA 5ERIA 4R2DA 2E36A 2GA2A 3I55I 4YIRX 2G0EA 2CYYA 2XRNA 1HXDA 3WGGA 4GCVA 2R1FA 3CP8A 4CSWA 3PL8A 5F27A 2DBBA 1KU9A 2CRGA 1GLNA 2XAGA 3WTUC 2D5VA 3VEPA 1TWFJ 4YFKF 4PJJA 1MJ9A 3HBLA 4C3JJ 3CCMI 2HOAA 2L3CA 1TF6A 3CJQB 2YSOA 1RPWA 4QSHA 3S2DJ 2ICWG 3LMLA 3VDXA 2OC6A 1T2KA 3DBHB 2M2EA 4XLFA 1S7OA 2VONA 2MH2A 4PFOA 3MN2A 3M4OJ 5HLTA 1I6XA 4DZJA 4BXFA 2UXBE 2XVCA 5T6JA 1A36A 1AA7A 3T1HE 5K5OA 4IZZA 4I8OA 1LFUP 2O0YA 5GAGJ 3WTXC 3ZXSA 5LFAA 4F2JC 4HBLA 4EM0B 3LAPA 2VE8A 3R61A 4GFBA 2XGCA 1OQYA 3WHBA 3WTYC 2W25A 4RAZA 4UVBA 2NA2A 2BOLA 1LQ1A 2EB7A 2WADA 4Q47A 5CQGA 1LVKA 2KZVA 2JA2A 2W4SA 4Y33A 3KFWX 1WQ2A 3DTKA 2JVHA 1LDKB 1ZGAA 3AG4H 3Q0UA 3K4NA 4XM3A 1QGPA 1ACIA 3EUKL 4DKKA 2K9NA 4QIWN 4AIDA 2NABA 1O3SA 5BOXA 3BJOA 2IHR1 3TBIA 4FX0A 1FY7A 3WGIA 4BUPA 1SD7A 2EQ0A 3BR3A 1AU7A 1TW3A 1TP4A 2PJRA 5FD6A 4EV0A 1FEXA 2UXNA 3CCRI 2DOEA 1T98A 2OQGA 2WBMA 2QGUA 1DGRM 2DPUA 5DV5A 5H2FC 2FBKA 2EL5A 1FC3A 2I8DA 1TNTA 2ZXHA 4LLNA 4QLCU 4DGWB 3OYDA 3QYFA 2OU2A 3AG3H 1T08B 1MMDA 4P9FA 4WSPA 1U8RA 1G2FC 4A3IJ 2K4JA 2CSHA 4B3ME 4EJUA 2HPMA 2XF6A 1J2XA 2HR3A 4M6YA 3OR2C 3DF8A 1VQOI 1YRNA 2V6CA 3LLHA 3RJPA 2LK2A 3PUBA 2TRTA 2CT1A 2KISA 2VI6A 2ENHA 1FBQA 4CICA 2K4VA 2DFFA 2ELZA 2OTJI 3M1CA 3CCLI 5F64A 2EN8A 1DU0A 1VI0A 1X1CA 2KZGA 4P5OA 5D4RA 4PJMA 1ZGJA 3B6AA 1SD5A 3G2BA 2JA6J 1F4KA 2H36X 2COBA 1X47A 2WB1N 3FXQA 1X49A 1GHCA 2FU4A 2EM3A 3KX2A 3KEOA 1MW7A 3THNA 5DM6F 3BPVA 1MBFA 3V8LA 1IN6A 1RI7A 4IX7A 5EGOA 3GFLA 3WU2C 2EL4A 2BGCA 4XOPA 1ETVA 3WG9A 4F92B 2DQRA 4AIKA 5B66C 3KETA 3HOTA 4R2CA 5AASA 4E7KA 2RQLA 1U9OA 3G1MA 5M3FJ 2N8XA 2NNNA 4IO9F 1G4DA 4IRIA 4BC7A 4XSXF 1OCCH 3PIOF 4IRHA 4XRSG 3AFHA 3CUQB 4E7LA 2QM3A 1DPRA 4G12A 2LVSA 2L9NA 2R7XA 5D4SA 4JBAA 3RPUA 4CHUA 1JGSA 2CO5A 2L3DA 1TQMA 1SVLA 1W5SA 4EEFG 5EG0B 2UZKA 3P9KA 2VQCA 1VNDA 2QA4I 1NK3P 4HRIA 2R7ZJ 2Z2SB 2IP2A 3BTJA 2ZXJA 3CMEI 3T1YE 3GEZA 3F22A 5LRRA 4BE0A 1YYWA 4BAYA 1KQ9A 4D9JA 2XROA 1IRGA 4JX6A 1BW5A 1YS7A 2EPKX 3C1DA 3S1MJ 4IJAA 2FGGA 1T4OA 2QLZA 2UXCE 2O5RA 3VYYA 2MSYA 4JK1X 2WCC3 1R4MB 5HDGA 4TV7A 4HV6A 2DA4A 3GFIA 4OU0A 4M72A 2VQGA 1XSXA 4F55A 3QPSA 1F1ZA 3A0BC 2EM2A 3MHSC 4XONA 1DPUA 3J81K 3P5JA 1VFCA 1H9TA 2HOEA 2X48A 2QBYB 2EMBA 1F36A 3KZYA 4Q48A 4WF2A 3SYTA 5FLMJ 4A12A 3HHGA 4W1UA 2EPMX 1HSTA 1Y0NA 2D1VA 4M3GA 3T0YA 1P4WA 4A3FJ 4CYCB 1JGGA 1DGCA 2AQEA 3CJTB 4LJZF 1I39A 1XD7A 1CQTA 4RLFA 3P7NA 1WSUA 1EF4A 1APLC 3F6VA 2WTEA 2LP0A 1YUIA 4NXME 1J5YA 2R5ZB 2K40A 4XKVA 5HOOA 3C6MA 1T56A 2ZXIA 4JP0A 1QQIA 3E0JB 3G1OA 4GRIA 3ZMSA 2GA1A 2Q8KA 3BR5A 3ESWB 1BR1A 1BR4A 3E6DA 4B4CA 3GTQJ 1K61A 1YZ9A 2DA2A 4XLPF 3D5LA 4UV9A 1RR7A 5GPCA 1Z1DA 2WA0A 3TP3A 4EGYA 3HTXA 3I0TA 2F4MB 2EOFA 3AG1H 4M30A 4UVAA 2DODA 1Z77A 2EMHA 1ZAAC 5F0HA 2V1DA 3MMYB 1IV8A 4NC8A 1D5VA 2E7WA 2WV1A 3FKIJ 2NXNB 2BXYA 1JE8A 2STWA 1ZBTA 5CFFE 1B6AA 3DF6A 1ETKA 4BXXJ 2UWMA 2F5FA 2WBTA 1A6IA 2HVRA 2EQ3A 4XOTA 1P4XA 1USTA 4BU2A 4HF2A 2MDGA 1LEAA 1KYWA 2JN6A 3LWFA 4L9NA 5AIQA 3I4NJ 1Y39A 3G71I 2DA6A 2K86A 4L9JA 3MCZA 3BCBA 1ZG3A 2P8TA 2IT0A 3I3LA 4BBSJ 2LUPB 1AOYA 2N3GA 3ASNH 2LO3A 5K5QA 3IHUA 1HDPA 3FK7A 1FYMA 2ZBKA 3BOQA 4XSZF 1Z3XA 4X66E 3H5AA 4BHCA 5IT9C 5ILUA 2NS8A 4CXFA 2DTRA 2EPXA 3ZPLA 3CC4I 4JI6E 2NYXA 1YYVA 2YPNA 3S3MA 1BC8C 3OIQA 3S32A 5KCMA 2DMIA 1GVDA 3BT9A 2P5LC 2YTFA 4M0VA 2FOKA 4HA8A 5J3LA 3K0LA 4B47A 3LSGA 3DXJF 4UUVA 4ZC3A 3K2AA 5H6QA 1VTNC 2FUG2 3FMSA 4V2GA 1X1AA 2B0LA 2EMLA 1ZR9A 2V89A 2ADUA 2IGOA 2XDVA 4MQ9F 3A01B 2IAIA 2H09A 3CCQI 3HTSB 3E5XA 3KP5A 4G6TB 4FISA 2E1MB 2QCOA 4E7ZA 3MWMA 2PN6A 2DLLA 2OZ6A 3RSNA 2E2HJ 5JHUA 3CCEI 2EZIA 4F9BB 1DUXC 4E6KG 5A2QC 5CVIA 3ADLA 3CMMA 1RQ0A 1AKHB 1IF1A 1ITYA 3HOVJ 2CU7A 3I5UA 2B7VA 3CTAA 2L9VA 3OMYA 3BQYA 3HPGA 1MMNA 4XR6A 4AVZA 1MNMC 1OR7A 2NUGA 2DYSH 4WXCA 1IDZA 1XDUA 2OQRA 3T5XA 2LJUA 1BR2A 2HGCA 2ME6A 5C44J 4AIJA 1I5ZA 4BACA 2DMYA 3IV5A 4N0BA 4KA4A 3BR0A 2ODRD 2JZYA 2H8RA 3PFIA 3ADGA 3MSWA 4N4OB 1Z6TA 3HRMA 1DI2A 1FLIA 1H88C 2PQ8A 5J4VA 4CO8A 1JT6A 5KK1A 5KNLA 1ZK8A 3DPUA 5L3FA 1YS6A 3EPZA 3RYRA 3K4KA 3IP4B 3CUQC 5IXMB 3NWSA 4U0VA 2X4HA 5LEJA 2MC4A 2Y0SN 4I0AA 1AKHA 2VOPA 2ZNZA 2L92A 4PSWA 4C2MJ 2JTVA 2B7TA 1F2IG 3FDYA 4U0YA 4DR2E 1A04A 2PJRB 4XRFA 2HEOA 2DDBA 2H6CA 2EJRA 1N25A 2HI3A 2V87A 1HSJA 1WJPA 1A31A 2HNHA 2QKMB 3HKZA 3OL4A 4LG0B 5E20A 4Y4RA 4BKXA 4PZJA 1BBGA 3DQVC 3FXKA 1X3CA 2CQQA 3RTRA 2MLGA 4DV4E 5DM7F 3G73A 2RQQA 3FHZA 3B6CA 2CPNA 2OPTA 3HPZA 2Y31A 4PFPA 3OYHA 3E6MA 1O7FA 2Q1ZB 2IEKA 2DW4A 2K9LA 2KT0A 4J00A 3FXMA 3J81C 2WBSA 2DOAA 3KP3A 2FA5A 3BROA 2F5CA 2JRMA 5D8LB 1T39A 2MD5A 1EH6A 2DMTA 2TDXA 3FISA 3K10A 1B72B 5D5WB 4L5NC 4LF8E 4BEHA 3I56I 2FQ4A 1OYWA 1U8BA 1X6EA 2VLAA 2ID3A 4RGXA 1K79A 5CVRA 3QP6A 3C4BA 4A3BJ 2Q2EA 4UHTA 4DV6E 4J8ZA 2EM9A 2A61A 3SFZA 3SHFA 2EN7A 1U5TA 1FBSA 4HEA2 2Z1DA 3OYIA 3GUDA 5DS9A 2FXAA 1R36A 4S05A 2VC0A 3MEXA 2ZB9A 1YI2I 4MFDA 2LOOA 1JJ6C 1UELB 4HZFA 3HSEA 2X6YA 4BH9A 1BN5A 4FT8A 2W82A 3E3VA 4A6EA 1MSFC 2DSYA 2VQEE 2LY2A 2EMZA 3N4MA 4LIVA 2DN0A 2VT3A 4HQMA 1YG2A 3CF2A 4DV3E 1JUMA 4XKCA 4LD5A 3A4CA 2IS2A 2AO9A 4FK5C 4CCMA 5HDNA 2E1MA 4R2AA 1PJTA 1OYYA 2O7OA 3WTTC 2VJJA 3TQNA 2GIVA 4IHXA 2M8GX 2XAUA 3BTLA 1E2XA 1RMDA 4BMJA 4F93B 3PUFA 1XGMA 1LPQA 4L8NA 4DIQA 1DP3A 1A1JA 2V7FA 4H0EA 2VQFE 3BG6A 4A3JJ 2XGXA 3H3UA 2X0LA 5HLHA 3HOYJ 4EMSA 2QQ9A 1R6RA 2X6OA 1ZKGA 2RQPA 3HOZJ 3CC7I 3S14J 2HWVA 2VBWA 1XCBA 4WFTA 3FZVA 2YUSA 2DMQA 4A93J 5CJ9A 1V3FA 2L7FP 4R2EA 2P7CB 2BBYA 2EPCA 5AIPA 1X6HA 1X48A 3GW2A 1WWXA 4ZYEA 2FNAA 2Y48A 2J5PA 3OOPA 2XAFA 3LMMA 5HVQC 4X6AJ 3ADJA 5B1BH 2B9SA 1Z1BA 1RKWA 4Y7NJ 3GTKJ 1YITI 3F21A 1GT0C 3OYCA 2R7WA 5LMUE 4Q28A 1X4OA 4U88A 1B9NA 2GXGA 2PI0A 1GV2A 1UHZA 1F5TA 2DQLA 2M0CA 3TO6A 1XN7A 1OCRH 2IJLA 4HDUA 2V6EA 3ZQQA 2HKXA 2K5CA 2P5VA 2VPRA 3CP2A 3EPJA 3A03A 1QPMA 4XKBA 4KIBA 4BQQA 3QRFF 1D8JA 1W36D 2KIMA 1ZREA 3D0SA 1X6FA 2P81A 4A3MJ 3OYKA 3ZMUA 4JI5E 1JKPC 4AC0A 2EV0A 2VQLA 4XLHA 1HF0A 2HOSA 1Y1VJ 3RZOJ 5H6RA 2BY3A 2AXLA 2ZMEC 3CCSI 1V5EA 2M7AA 1FIAA 1XMAA 1Z21A 3BCAA 2DTZA 3F8MA 2HPIA 1PUFA 3HXLA 1L4SA 3GZ6A 4Q35B 3GFJA 1PP7U 3MKZA 3DLAA 4B44A 5E8IA 5CQEA 1YO5C 1N77A 4XBFA 3BG3A 2ISYA 3CLOA 4HYEA 3F6OA 3QODA 2XPVA 3LSIA 2FMLA 4JX5A 3PQKA 4B48A 1C0WA 2EMGA 1QVTA 4U87A 4CCLA 4L5JA 1TW2A 1Z91A 5B5EC 3MKWB 1VQ8I 3OWTA 5IY5H 2EM7A 4KYWA 1A1GA 4Q4ZF 2ZSHB 2V1XA 2ZFUA 3FWEA 1LFPA 1TN9A 3EYIA 4G6QA 4NNJA 5JR3A 9ANTA 2M0MA 1QA6A 4LK0F 4DUYE 1SVOA 2CS3A 3H0GJ 1YLFA 5BQTA 4ITVA 4A3KJ 2QF7A 5TISC 4ENJA 4CGZA 2KRCA 4DR6E 5TSEA 2LBSB 4PGGA 4QTRA 5K5RA 3VYUB 4BJ6C 1F9NA 1Z3YA 4RDUA 4WYQB 5D6FA 5GAHJ 4P9UA 5AONA 2BB8A 2V1NA 3OYFA 2VXDA 2WAQN 1IRXA 1TQIA 2ZJQF 1HNXE 3QAHA 3ROUA 2RSIA 2VE7C 4BXUA 3DPLC 1SANA 2J5OA 1YFHA 4C2TA 1A6QA 2F5EA 3MZ8A 1O7LA 3GFMA 2DU9A 1JUPA 4P96A 2ENAA 1ORKA 2ESHA 2OCCH 3HGYA 5HS7A 5K1YA 2V9PA 1J9IA 2CTDA 2HXOA 1RC7A 3KP4A 2Y30A 3BF2A 2KJCA 3ZGKA 4ZDPA 3S8PA 2E1CA 2OTLI 1R1TA 2IS4A 3BR1A 4UUTA 2A25A 1XS9A 3RKYA 1TWHJ 4BC9A 2Z5UA 3FM5A 3GTPJ 3K6QA 4KITB 1YRNB 2MH9A 4JOMA 2E19A 4JX4A 4NHRA 2P4WA 3LSRA 2RC4A 1S5LC 2FEZA 1YX5A 1VQMI 2RSMA 2L4MA 2DCEA 3K70C 3GMEA 3EPHA 4M9SA 1S9HA 3H3ZA 1BBYA 5ILVA 4RHBB 4IQ4A 5M5YJ 1S3JA 1TLHB 2DRPA 2RTXA 4I0BA 1B69A 4HF0A 2EN3A 4X9JA 2LNBA 3LQRA 2PFBA 4MGRA 2JA5J 1OCTC 3WTVC 1TF3A 2P5KA 3DV8A 3FX3A 3F8NA 3CCVI 3QU6A 4AQYE 2ECCA 5ILSA 4M2ZA 2HKOA 5TRDA 1LLMC 1TNSA 2W85A 2R92J 2C6YA 5E1XA 3BGHA 2LY1A 5HS8A 1D8KA 4EM2A 1VQKI 4QPQA 2L7KA 2V4JC 1KZHA 2YU9J 3ISPA 3KLNA 2WY8Q 1X1BA 1CF7B 3KLOA 4NZVA 2EPUA 5A6JA 1LEBA 2M5WA 5M3MJ 1Z6RA 4UB8C 1QU6A 5LRSA 2YZTA 4HNTA 1AWCA 2KPMA 5DEQA 5E18F 3AUZA 2EINH 3CF5F 2L33A 3LFUA 2X85A 5IT9K 4MHGA 3TO7A 1G3SA 1Y8QB 1T4NA 2R0QC 1WJCA 2DIXA 1V55H 2HHHE 2EQ1A 4NQWB 2FJ1A 3PSFA 4K0KE 2ENCA 4R2PA 4BDYA 4RA2A 1OCPA 1SR9A 4UUSB 2JT1A 2L4AA 2R7OA 2VJ5A 1B59A 3TL4X 3HRTA 3TKYA 4YIIA 3OYEA 2B7EA 1R4NB 3LSMA 1ZR4A 1IV6A 4PDKA 3S1NJ 3SEZA 2GQQA 3S17J 1IN7A 2V85A 4ESJA 3NARA 3C2HA 3A01A 2Z99A 3FXLA 1PP8F 2CGPA 1HA8A 5J4YA 1QHHD 2NVXJ 1U78A 4JI4E 2WY7Q 4FCYA 5K7HA 5LGTA 4OIPF 3VB2A 4XLCA 4A69C 2IS1A 1MNDA 5DYMA 1JJ8C 4DR3E 3DTIA 2RPCA 2JK3A 2EOOA 2MKNA 2BW3B 2XASA 4R1HA 4BHPA 1IRZA 1X3UA 3K4JA 1BOBA 5IP9J 1N33E 4XORA 2GOXB 2OUMA 5FKKA 4OX9E 1I94E 5JI6A 1V54H 4J19A 3BC8A 3CCYA 1EJ9A 3PNTA 4XLEA 1MBKA 2HQRA 3IWFA 5FKLA 4BHBA 3J7YJ 4B3RE 2BV6A 3VODA 1RETA 2LFBA 5B3SH 3DBRB 1Y0UA 2CUEA 3L09A 4BY7J 3ZP5A 2D45A 3O8GA 4WXHA 1JK2A 3L2RA 3GYHX 2HZTA 3FK6A 3ZR8X 4G94A 5IV8B 1T8IA 3HJEA 3KCCA 3C3WA 1WZ2A 1OR7C 3M8JA 1BL0A 4KT5C 2A5WA 2EFPA 3CO7C 5C3EJ 1GTKA 2E35A 1STUA 3RDIA 3C4TA 2CFOA 2RV8A 3I59A 4A3GJ 4MNUA 1IAWA 5CYVA 3ZN1A 3FMRA 2MG4A 1O3RA 1IXSB 5LHGA 2DYRH 2OA4A 4XRMA 2DOFA 3JRGA 2DJNA 3HDDA 5ADZA 2OD5A 2QQAA 2ME0A 1H9GA 3HM5A 4LIUA 2V8QB 4DV5E 1WRJA 4XLAA 3BTIA 5IPAA 1HW5A 2TCTA 2HQNA 4DR4E 3J80C 1UFMA 2YSRA 3NAUA 4EGZA 4OMYA 4DW6A 2LUQA 2BVMA 3M99B 1LNWA 1E3OC 2MC6A 2A6TA 2CW0F 1V5GA 3J80K 4V19K 1MD0A 4DR5E 3FF5A 2YU5A 4JYKA 4CYCA 2ACJA 3A2KA 1FP2A 2MYSA 3BG9A 3HHHA 3RYPA 5J6XA 2IPQX 2LH9A 2HVQA 2LTPA 2IA0A 2R7FA 3VYTB 4ANJA 2IGMA 1T38A 2EMWA 4D5CA 4KFCA 2VRDA 2Y9ZA 3F0CA 1FYLA 1MEYC 1PJQA 5A6AA 3LA7A 4MLOA 4DBQA 3PJRA 2MC3A 1NG6A 2O03A 3O2PE 4PCQA 1FJGE 1X4PA 2HDWA 2GLIA 2NNYA 3K69A 2HYFA 1KA8A 2KOUA 5KL5A 3R60A 3J80Z 1G2HA 2R5YA 1A5JA 4QWQA 4DYCA 2H8WA 3CJRB 2Y9YA 1B8IB 2EE8A 4A5MA 1I3QJ 1U3EM 1ZRDA 4BEHB 2PLYA 4B1RA 4ASNA 3ZQCA 3EPLA 3COAC 2FNPA 1LDDA 2AQFA 2DAOA 2JWOA 2W7NA 2F5DA 4G7ZF 5C4XJ 1N34E 3HB9A 1BOAA 3BG5A 5IT9Z 2E34A 2R4GA 3UK3C 4OMZA 3ECOA 3CUOA 2FOWA 4A0YA 4A5NA 2ZNYA 5F08A 2UUAE 3SQNA 1ZG5A 4BJTA 3CMYA 3RPUD 1JTYA 3GWZA 3S2WA 3EDPA 1W5CC 2F48A 4D0PA 3RZDJ 1ZR2A 2E5NA 2G7UA 5D5XB 3R6SA 1VQ7I 4G7OF 1RZ4A 4NC7A 2EN4A 2VKHA 3P9CA 4UNOA 3O6BB 5KHDA 4KDPA 1G8XA 5FKOA 3KPHA 2UUCE 1B72A 3OS1A 3OYBA 3GTOJ 3ECHA 3HSRA 2GLOA 1ULYA 1I27A 3EUAA 1BJZA 2LYCA 2XAJA 4NB5A 2EK5A 2A05A 5IYCJ 2WC2A 3LSKA 1JUSA 2P6SA 2FE3A 2EIKH 1I6HJ 1E0EA 2F2EA 2LKSA 4Y15A 3QP5A 1HCRA 2GXAA 2BXZA 3AKZA 1HC8A 1JXSA 4J01A 1MJAA 3M07A 3UNGC 3TO9A 3QG5C 3FXJA 4ZTJA 2M1SA 1IN4A 2V83A 1R23A 4IHWA 1D0XA 1D1CA 1QU3A 1JKQC 3ZQLA 5DNYA 4I09A 1U2WA 2LG4A 2JVAA 2Z16A 1W36C 4EJTA 5AE2A 4I99C 1FWZA 2Q8UA 4QPOA 1WPKA 3KYCB 4CCKA 2EOMA 2UUBE 1AHDP 3L9FA 3K4BA 2D9HA 3IWCA 4E4HA 5GPAA 1WJEA 1TTYA 3W3CA 1Q1HA 2BYVE 5IP7J 4LFCE 1POGA 1MIJA 5EYRA 1N75A 4K2EA 2RREA 1R5GA 3T8TA 4KUMA 3FHNA 5IWAE 2EFOA 2EOIA 2Y69H 2CW7A 2EBIA 4UVCA 2UXXA 3F8CA 2BBGA 1S6LA 4L0ZB 1HDDC 1K6YA 1TWAJ 2L02A 1W7PA 2A69F 3HC7A 4NC6A 3U21A 4O3MA 4EM1A 3H3VK 1STZA 1OMIA 1ZBQA 3JRCA 1K78A 4A2UA 3W6KB 3H35A 1PJSA 1TQPA 4HEIA 2QQBA 3TW6A 2EOEA 3EQ1A 1L0OC 1J09A 1FBUA 3ABUA 4I02A 4HX7A 5HODA 3E5QA 5HS9A 3LOCA 3NEUA 3PO3J 3E5UA 3K7AJ 4HV5A 1ETQA 1K78B 5AC4A 2O6GE 3M8EA 4FX4A 3VOEA 1R5ID 1P9QC 3V4GA 1XB4A 4RBOA 4JI0E 4LU9A 2EA4A 5LMNE 3TEDA 1QZEA 2A6HF 2X1EA 3WHCA 2DA7A 1FNNA 3P1XA 4RAFA 4ZH4F 1NH3A 1YE9A 3D1NI 1S29A 1GV5A 3RPQA 4ZZLA 2R7SA 3C6KA 1QZZA 1XCVA 2XAHA 3GVAA 2LMZA 2DT7B 1YHQI 4YELA 3ZQ7A 2VQHA 4ENKA 1OJLA 3HGGA 5L3DA 1T95A 3WE2A 3Q5FA 2R7RA 1FOKA 2KHXA 4JI8E 1WJFA 5CLSA 4YFXF 4R03A 1JK1A 2AS5F 2EOYA 2VKVA 5IOZA 1WJDA 3V42A 4KT6A 3ZRGA 4H4KC 3F6GA 2KONA 4Y13A 2GZWA 3FIWA 4BBRJ 3QOEA 4BQNA 2JXPA 2R7QA 3BR6A 2H6BA 2ZXWH 3BR2A 5B1AH 3HOSA 2EOXA 4TUIA 1BW6A 2LDUA 3HRSA 4BDZA 5KAFC 1D5YA 2K9SA 2PEXA 1B9MA 2IA2A 1VQ9I 3VSKA 1P7IA 2PBIA 1P6RA 2IA1A 2G9WA 2XV4S 3H92A 4I98B 3JRAA 1FYKA 4KISA 3GTMJ 1KU7A 4M9VC 1WXRA 2R5YB 2WB1A 3JTHA 1EA3A 4RS8A 3JTZA 1RRJA 5IYBJ 5BMZA 2QENA 3K4MA 4WK8F 4GYIA 3DU6A 1LE8A 2ADRA 1T4LB 4E7JA 2XKPA 4IOCF 2VBXA 1YPNA 5FD5A 2K7LA 4GO1A 1MGTA 3K4CA 3WG7H 3TQMA 3RCOA 5M5WJ 4JI2E 3HPSA 1QBJA 1KU2A 3B02A 5LGUA 3RIRA 1YUJA 2EIJH 4RAYA 2QBYA 2YX7A 5DUIA 4JQFA 3CCJI 4IF4A 5FFXA 2EPLX 3JSPA 5LLQA 2HQAA 4DUZE 4XRSA 1N3GA 4HSTA 1WGXA 4M3DA 3DJWA 2VUMJ 5A6KA 4GZNC 2EOHA 2DB2A 1UG0A 2FMYA 3H9JA 3BJAA 3NRVA 3DKYA 1RC9A 2O3FA 1D0ZA 5E8GA 4DV0E 2I13A 1M1EB 1MMSA 2VL8A 4OAYA 2RNGA 3GCMA 3VPRA 5BNGA 1MBJA 4L9TA 2Y75A 1MKMA 3GTJJ 3H0DA 1NEIA 3I64A 4S0HB 2E5ZA 2JA7J 1T6SA 2PMZN 4RAGA 4W97A 3QPHA 3ADIA 2A68F 4RM3A 4L9VA 1Y56A 1MZBA 2RDPA 2RGVA 3GZNB 3F8BA 3HPHA 2K3PA 2JYAA 5CVUA 1OFCX 1X1DA 3IAS2 3Q0VA 4XN3A 1J75A 1IQOA 2YX4A 5D5VB 2MA3A 3DTEA 2E60A 3GZ5A 2M7QA 2FBHA 1K6OA 4OOGC 3JU0A 4DR1E 2D1HA 1XPXA 1LB2A 1YIOA 2HS5A 4IHTA 2NOJB 3R0JA 3HYIA 3KEQA 1WCMJ 4Z2YA 3ERED 2EP3A 4WPYA 4IS1C 4AWXB 4B3TE 4UV8A 3AV0A 1EV7A 1HOMA 2WAEA 2MBFA 1SMTA 2LBFA 2QYOA 3QPLA 2E2JJ 4O43A 3O3KA 4O5GA 1FMVA 2F5VA 5BR8E 5EEHA 2IGNA 3EETA 1VQLI 2EJ4A 2ELYA 2MD0A 3HIFA 5CVJA 4XIDA 5F3WA 4C3IJ 2RKHA 3IRQA 4LB6B 2GAUA 2UUZA 3ASOH 4AIHA 4X65E 5EF6A 4LF6E 1W0UA 1XGSA 4PUSA 4E70A 2E1OA 1UZCA 2ZKZA 3OSGA 2M9HA 4KN7X 1J0RA 5F0FA 2NOGA 4DQ2A 4N4NB 3LNQA 5K7ZA 2YRKA 1P92A 3ZQFA 1DP7P 1U6GA 1RKTA 2MKDA 4R2SA 5FLXK 2JUGA 4C3HJ 4JI7E 4E7SA 1IBLE 2KLOA 4XQFA 2EZLA 1I1GA 2RN7A 1MDMB 4WXDA 2NVYJ 2NRAC 1ZYRF 4C2UA 1X5WA 3TOAA 1RNLA 3U2RA 1CGPA 3HUGA 2AHQA 3GF2A 2CW8A 1PYVA 3OR1C 2ZMEB 4BQAA 3EPKA 2LRDA 2V86A 3FMQA 4CA0A 2QSHX 2EZ6A 2VKDA 2YSPA 2VJ4A 1RUNA 4HAMA 4ENMA 4LITA 4RB2C 4IHVA 3D5RC 2V26A 3KP2A 3BDDA 3K2ZA 3CDHA 5TGTA 3OS0A 4EJOA 1HNZE 3M3YJ 5E1ZB 3S15J 2BY2A 4ZDOA 4HQEA 4CZZA 4GYGA 2KRHA 1R1VA 3KZZA 3E7LA 4DJAA 5FLXZ 3KP6A 2QEXI 4B3SE 2DO7A 5EGOB 4LTYA 3TW7A 4BL0B 4DV7E 2DDAA 3FXRA 2QQ8A 3P9IA 3BG7A 2ZJPF 1R58A 1MMAA 3WGHA 4ZTFA 3L1PA 2M7BA 2Q0OA 5ICEA 4F7ZA 1Z9CA 1K4SA 1YW8A 4YFNF 3K1PA 3RQ4A 3DEUA 2BY1A 3GBGA 4YRVA 2XIGA 1UMQA 3CZ6A 1IQSA 1A1FA 3OYNA 1WI3A 1XMXA 4KHPE 4B3XA 3OSFA 1HQCA 4AM3A 2MC5A 1YYOA 4MIMA 3AAFA 3DKWA 3CMAI 2EN6A 4FHTA 5L3GA 1HR0E 2R3SA 1UBDC 3O8HA 2M45A 3HOUJ 5KL7A 3QYBA 3MFKA 1LUJB 4ENNA 4LG0A 2LTSA 3A02A 3MQ0A 4F3QA 2EQRA 5JLWA 3W2WA 1FPQA 1OISA 1XGOA 3GTGJ 2B63J 2YT4A 3KP7A 3J7ZI 4NUBA 2L9SA 3BQZA 1YOVB 2DA1A 4M74A 1BM9A 5E1WA 1ZQ3P 3S2HJ 2WWYA 5CKTA 3CQZJ 1E3PA 3ABLH 2DXIA 3BBGA 2EIMH 4G8XA 1A1HA 2EWNA 3KEYA 2LTRA 3L7WA 4FTHA 5GADJ 4NQWA 2CV2A 2HDCA 5A6BA 1R7JA 2X1DA 4KICA 3L2QA 1FSHA 4I7HA 2WZOA 1QZYA 2BY0A 3WU0A 5E3MA 4ZYDA 2CWEA 2LRSA 1LFBA 1FTTA 1OKRA 1DQ3A 3J7AO 1MH3A 3OYAA 4HG2A 5IYDJ 2HOTA 1KGSA 4E7HA 4HX8A 4Y3OA 3WU1B 3AG2H 4F9AB 4WX9A 2EWLA 3VYSB 5LGNA 4CCNA 3UKGA 4L18B 1WHNA 4KIFA 2YTGA 1CF7A 4BE1A 1G3TA 4Q5SF 2CUFA 3N97A 3RMPA 4KN4X 2NVUB 1XMOE 2YTOA 1HKSA 3BTCA 4IVNA 3MKYB 1GUUA 4F9CB 1GVJA 2QZ8A 1VQNI 2DLQA 2CFXA 3ECRA 2RAEA 4DBRA 2XSJC 1LJ9A 3LFKA 2V1UA 1EH7A 3DKXA 4MTDA 1BIBA 2ZJRF 1BI2A 1QHGA 3V8KA 1FIPA 1ONVA 1SFEA 2LE2A 2YTJA 5DUKA 2QWWA 2EM8A 5FRMA 3Q9SA 4M6XA 2Y2ZA 4M6VA 1OYIA 2K9QA 2NAZA 1WJAA 2A5YB 2XB5A 4LB5A 5AC5A 1R1UA 3TP0A 1QNTA 2FBIA 1SFOJ 3CD6I 2EMAA 1Y8RB 2EMFA 4F52A 2E5LE 2RNJA 2KJBA 1JI8A 5A69A 3OL3A 1G3YA 3FBIB 3FKJA 5IOYA 1ERDA 1LVAA 1AH5A 4ZDLA 1S8NA 3Q9VA 4X1EA 1O3QA 4IKFA 4B09A 2GIZA 3HQ1A 2MABA 1MDMA 4I2OA 3DPTA 1Z7LA 2GWRA 1R00A 1MBGA 1ZARA 1ODDA 2F4OB 3Q3SA 4PJLA 4EQQA 3OYGA 2VOOA 1BJAA 2EOZA 4F54A 1WH5A 2X6XA 2VB6A 3BLYA 4R8OA 4EJWA 2QVOA 1X2MA 1X58A 2R7DA 3JAMK 1RR8C 3VYRB 4HPQA 4C30A 3TOBA 3H5NA 2NVQJ 1P4AA 1T0FA 3I58A 4IJDA 4CUGA 2DFIA 4UXNA 2COMA 1A1IA 3SJMA 5ICFA 5F04A 5GAEJ 2P0WA 3SDBA 1YYKA 1Z05A 2F6CA 3KIOA 2DFEA 2LBFB 3R4KA 3SDGA 3G6EI 1UB9A 3K6GA 1QO0D 2Z9OA 4EJVA 2STTA 3I53A 2HU9A 4I01A 3K1NA 1UILA 3AL0C 1D1AA 4FQGA 1ZH5A 5J1RA 1TBXA 3VSLA 3F9KA 2CQKA 4HNUA 2H1KA 3JW4A 4LF9E 3LSTA 4BNCA 4KZSA 3HTUA 1IDYA 3G3ZA 4NBQA 4RB0A 1IXRC 2L7ZA 3HOXJ 3QWLA 3OIPA 2JSPA 1PJRA 2GXBA 2O61A 1Z7UA 2EZHA 2EZKA 4O5VA 3DEEA 2QUFA 4E7IA 1SFUA 3OMLA 1ZAOA 1ZN2A 2V88A 5ICCA 1W0TA 2CSOA 4LLGF 3KYLA 1BA5A 1SFXA 4F6NA 5F0CA 1BI1A 1OPCA 1KQ0A 1DGWY 3KZIC 1YW9A 4X62E 1QPIA 4AUXA 2VODA 4DZPA 2L54A 2ZM6E 4L0YB 3RQIA 3OYLA 1XC5A 2XUBA 3D5SC 3JREA 1TWCJ 1W4MA 2M3AA 3M9AA 2HDDA 3BZ6A 1KYQA 4X8WA 2EOQA 1HKQA 2XSDC 3TDZC 2E1MC 4NHJA 3V7CA 1EKZA 1J59A 3S1RJ 3W2VA 4AD9A 2LV2A 2BE5F 1UAAA 3JSOA 2M4IA 1B1BA 1GZ6A 2ZFWA 3JRIA 1HLVA 2Q2EB 1HBXG 4FASD 5E17F 2LREA 2DJIA 3IWBA 1PVEA 1ENHA 2VIXA 2EMXA 2JUCA 1WI9A 3MZYA 4BS9A 2ECBA 3QOPA 1X3WB 3JRDA 1F43A 2HC5A 2ELKA 1Y1WJ 4RMNA 1BIAA 1VQ6I 4MQVA 3CUQA 2X9DA 4RGRA 4TUGA 2DT6A 2FD5A 2CQNA 4HF1A 5J47A 1U5TC 5LEKA 1BC7C 1KJKA 4NDLA 2XPUA 1YJWI 1JHHA 1U5TB 1IMUA 2LMDA 4FETA 5L3EA 3ZMTA 4CYDA 4EATA 5EDNA 2R7VA 2EOSA 1FJLA 2YU3A 2JPAA 1XX5A 5HDKA 2P6TA 5HLGA 3H09A 2HTJA 4M71A 1X1PA 3TDUC 4MTEA 3J81Z 4A3EJ 5DTDA 3MZHA 2L2OA 2KDZA 2I10A 5AE3A 2CG4A 3E97A 4IRGA 3HL2A 2DLKA 3OV8A 2W57A 4CCJA 3IWZA 2M4KA 3MVPA 1P7JA 5JVTA 1W5TA 1R5HA 3DWLE 3E6BA 5J8FA 2R7TA 3WTWC 3K9TA 3QQAA 1A1KA 1BBOA 1S72I 1JKOC 4Y52J 4PGHA 3CCUI 4II3A 1RUOA 4A6DA 1SAUA 3T1BA 2RS7A 4DNCA 2HVSA 5FGMA 1ZRCA 5FKNA 3W6VA 1IBKE 1YJ9I 4G9YA 2H1LA 2K85A 2Z33A 4LF4E 1JT0A 2PRTA 1Q1VA 3SZTA 2XRLA 2OZUA 3BJ6A 4HX4A 4HW0A 1I1SA 3DEWA 1IUYA 2CUJA 4ZYAA 4JV5E 3R0AA 2VKEA 4G6DA 3BPXA 5C4JJ 1UN6B 1ETOA 1MJBA 3F72A 2YWQA 3SZPA 3C2GA 2DFHA 3CDLA 1H89C 2EOJA 4MO7A 5LBQA 2KIFA 2OCEA 3T8RA 4A3LJ 2JMWA 4S04A 4LGWA 2XC7A 4ON0A 1IGNA 4IQJA 4WSGA 2YU8A 1A35A 4V2FA 3KWRA 2KQRA 5ED4A 1XTAA 3K1MA 2EA2A 3I9V2 5DCMA 1RESA 2I5UA 3ABTA 2RS6A 3PSIA 3ZMDA 3CDIA 3ML6A 2JR1A 2JY9A 1NK2P 3HG9A 2MLKA 4D7MA 2VE9A 2EV6A 4P55A 3DCFA 1IXCA 4ABZA 3OY9A 3CLQA 1K83J 5JVGF 2L2MA 2NUFA 3B73A 3H9QA 3PQJA 4C9YA 1ZG1A 2PJPA 1YQAA 5CVVA 4DYRA 1GXQA 1LKXA 3KE2A 1PDNC 4B8XA 4ZYHA 3V7RA 1ZRFA 3A1YA 3EYYA 5CPRB 1UG2A 1HW2A 4BY1J 5ICGA 3S16J 2VASA 4GXOA 4OAZA 4RLQA 1IZ1A 3EUHA 2H27A 3DU5A 5IP6A 2IS6A 5HNFA 4BBYA 2BEOA 4L5EA 2IW5A 1QRYA 1OLTA 1IRFA 1OCZH 3TGNA 2EN2A 5KAIC 4OIQF 2GHFA 4FE7A 3EUHC 1ZGWA 2Y0SA 4U7BA 2CQ7A 2HYJA 3DLLF 3HOWJ 4IXAA 1BI3A 2ZJ2A 1NG7A 1SC7A 3IH4A 4UB6C 3FXOA 2L3JA 4FE4A 3LSPA 3IL2A 3S3OA 1WHUA 2PMUA 3IH3A 2FQ3A 2EPRA 2L0KA 2DK5A 3DFGA 3WE3A 1SD4A 2MGQA 2HTSA 2AXTC 1ETYA 3FM3A 4MLQA 1W1WE 4JI3E 5E3NA 3IH2A 4N4RB 3N05A 1RIOH 2R76A 1G59A 4OIRF 2OF7A 2ID6A 5AE1A 4R2RA 1N36E 1P47A 4LFBE 1DU6A 2YTEA 5DD8A 5EJCA 3SEQA 5HNHA 2CV0A 3TMOA 5FO5A 4A3DJ 1E17A 3VHTB 1DDNA 1S7EA 1H8AC 1DQUA 1FOYA 4IHSA 3F6HA 4DV2E 4WWCA 3ZQGA 5LL6R 2Y0MA 2CV1A 1ON1A 5J8CA 3K4LA 4RGSA 2EPPA 2YTDA 2DA3A 2L5QA 3M8FA 1MBHA 4IEJA 4XLNF 4D7NA 3V8JA 2K7IA 4WCGA 1MBEA 1D3YA 4LLLA 2VC1A 4CZCA 2FF4A 2EFWA 1D1BA 2L01A 5KVRA 1USSA 5EZGA 2PX9A 4I6ZA 3L2CA 4HTGA 2PMZA 2O8KA 3I54A 3OOUA 2LLKA 2K4BA 2XF5A 3J7Yp 2UV1A 2IGKA 2ZC2A 4I76A 4HDVA 1N32E 2XHKA 1FZPB 3C2BA 5E79C 1MMGA 2XKOA 1JHFA 1XSDA 2ZMEA 2FTXB 4YY3E 1BB8A 1TZLA 1SAXA 4RH8A 3REOA 1IW7F 2HJJA 2EM4A 3PFYA 5FRNA 5M5XJ 5J1UA 2KIQA 2M1BA 2L6MA 3M1EA 2M9AA 4Y17A 2EPZA 3JTGA 2WAFA 1IC8A 2JOBA 4U7DA 2XB0X 2EPFA 2DA5A 2UXDE 1HKTA 1JTXA 5EZHA 2KKOA 2NS7A 1GDTA 2N3HA 3FBNB 3IC7A 3MKLA 5LHIA 4P1WA 2YRHA 2JRTA 4G7HF 1I50J 1WKMA 5L3BA 2LSOA 3K70D 3WODF 3MAJA 4A0ZA 1YSAC 4A3CJ 2F4IA 1PDAA 2LY9A 1UHSA 3RI4A 3LA2A 2KIUA 5JHFA 3J7AG 2M87A 4P7DA 3BP8A 5EG0A 5IT3A 4KMFA 2MDRA 2VN2A 2QSGX 2X1CA 2BW3A 4GKKE 1KQ8A 2DI3A 2EMKA 2JP9A 4HNVA 2KP6A 4X0GA 4LK1F 4N9IA 4AYBA 4ESBA 4KNYA 4HLYA 2B9DA 4M9ZA 5GTHC 2IRFG 4BJ5C 1ZHFA 4CCOA 2EM6A 1ZLKA 3ZQIA 1NCSA 2KFDA 2D2WA 3U9GA 1R49A 2GM4A 2ISZA 2EMYA 1TT5B 2B3TB 2WAQA 4LOCA 1HW1A 3BY6A 1L3LA 4P78A 1Z67A 1KYZA 3F3XA 5HLIA 3RKWA 1R9TJ 1MSEC 1U0JA 3VFZA 2K9MA 1IN5A 1T33A 2VJIA 3S93A 1V5FA 2ZSIB 1O57A 2W48A 2IXSA 1G3WA 4B43A 5KL4A 1XSVA 2ELJA 4XL9A 2EFNA 1ZTRA 1X3ZB 1LE8B 2DPDA 1XMQE 1AAYA 2WV0A 2HXIA 3KYDB 2LF8A 5K7FA 3ABMH 4OOIA 4AU7A 3LAJA 2R5ZA 1SFKA 4PJ0C 2E7XA 4LG3A 2LD5A 1Y6IA 4YIFA 3VK6A 2OAZA 2ODRC 2FSWA 3VYXA 1SD6A 2YPRA 3ONQA 3U1KA 4XKWA 5LD2C 4MLVA 1ZLJA 4II2A 2HQ5A 1XNRE 2JPCA 1VQ4I 1PUEE 4GEQB 1TWGJ 5BS6A 4U0WA 2JOXA 3I71A 5FKMA 4M3EA 1J5EE 5GP9A 1WJ5A 2L2KB 2A6EF 3IAM2 1W7PB 2X6WA 2V9KA 2EILH 3E6CC 4O24A 1S7AA 2O8XA 3CJNA 3JRBA 2F4VE 2KRFA 3F23A 5FJ8J 1P2FA 3GXOA 2R93J 2GBYA 2NS0A 5J1YA 4F6MA 1X2NA 3ZMVA 5FLXC 4PSXA 4BQOA 1YIJI 4DV1E 3CC2I 3S3NA 2ETHA 4DYQA 1IN8A 1J7KA 1PKPA 3J7AY 4YEJA 3UR3C 2WBUA 1YW7A 2W24A 3CESA 1U9NA 3OYJA 4PJNA 2GOMA 2YRMA 3PO2J 4IHYA 2MFZA 3THOB 3GX4X 4LFAE 2ESNA 2I9IA 4GKJE 2A3SA 2M4GA 1XGNA 2XF7A 1IO2A 1VF9A 4MFEA 2A07F 2EM5A 1XMKA 2VPLA 2JJ7A 1NHAA 4O4KA 1T0FC 1WJBA 2X51A 3ABKH 2HZDA 4CH7A 4R79A 4D1QA 4RM2A 2LJHA 5FFZA 2IBDA 3ULQB 1K7AA 3OYMA 3JAMZ 4UY8I 3SXYA 4DMIA 1FKAE 4KIGA 4ZJZA 4F91B 2L8TA 1IUFA 3C7JA 4XICA 2LT7A 2VT2A 2K27A 3HRUA 5F1JA 1IJWC 2DMUA 4DR7E 2K3FA 4HLXA 4M3BA 5DCMB 5FB2A 2L7MP 3GLLA 3WTZA 1HNWE 3JRFA 2OBPA 3IKTA 2EMCA 3OTOE 3E1SA 2Z3YA 5F1RA 1SMYF 4PK4A 2DMNA 2EL6A 3WTSC 3BZCA 3GLXA 3H5RA 4B3AA 2BHYA 4LFUA 2E1NA 5L3CA 1SVMA 3JRHA 3RKQA 4LF5E 4Z6YA 3HEFA 1R71A 6PAXA 2N8GA 3H9GA 1OCOH 2YS9A 2EPNA 2YTIA 4JI1E 2O9LA 2JVGA 2LF7A 3LSHA 4OWRB 2XGEA 1GXPA 4LMYA 5DD4A 2V9VA 1QVUA 3MD2A 3JAMC 4ETSA 1FX7A 4XNFA 5J40A 3IRRA 2EV5A 1FSEA 3AL0B 5D8KB 1KONA 1VZ0A 3NWTA 2CUZA 2G7HA 3ZCOA 2F8BA 5EEAA 5KL6A 3W2AA 2LKPA 1LDJA 4ZZDA 1W7PD 2M30A 3ZOBA 1WVRA 5JFRA 1VQPI 4OIOF 4HSRA 1G2DC 4A0XA 4EVIA 4YG2F 1MNEA 4AVPA 1G6NA 3JR9A 1E3HA 4ESFA 2IVMA 4NXNE 2E2IJ 2L9RA 3BWGA 3G1LA 5FLVA 2NVTJ 2EMIA 3ZQHA 4ZYGA 2VXZA 1WFXA 4O6JA 3RKXA 2LVHA 2PMHA 1FOXA 5BPIA 3I4MJ 3FIGA 2M34A 4AYBN 1YJNI 1FOWA 4BYYA 2JPBA 3LA3A 2MW8A 2OV7A 2EFQA 2RVCA 4L5IA 3H36A 3HUGB 2PG4A 4MEYF 3L2UA 4R8HA 4M3FA 4JYAE 3OIOA 2E71A 2XAQA 3DBLB 2H94A 3L2WA 3HZJA 4M73A 2JWTA 1X19A 2FX0A 5JLXA 2DMPA 3SZGA 3OS2A 3ZMZA 1O4XA 1IBME 4YHHE 3DP7A 1YTYA 4LF7E 3L00A 2M8EA 1J26A 2L2NA 2VBYA 3ZN0A 2ZCWA 4KWYA 2EM0A 2EPOA 3PNYA 2JSCA 4KJZA 1PUFB 2YTQA 3PM1A 3MHHC 1EH8A 4RB1A 4N9HA 2JA8J 2BVLA 2W00A 1A1LA 3VWBA 3ELKA 5EEGA 1TT0A 1H0MA 5H20A 1MH4A 1FT9A 2K02A 3I4PA 2J7JA 3IWDA 3W6JB 3EQLF 3H1CA 3LL7A 2P7VB 3BIDA 3LSJA 4XMYA 3V7SA 1UCRA 4MEXF 3A0HC 3HKZN 1ON2A 5BPDA 3GTLJ 2EN1A 5D6EA 5KL2A 4GDFA 3HSFA 3C18A 2ZO4A 4OINF 1TL8A 3FXUA 2FRHA 2W1OA 2KL4A 4X64E 2EPAA 2KHMA 1EKEA 1NTCA 2VF1A 5LHHA 2BHZA 3BZKA 2CMPA 2XGDA 3GO5A 2LR8A 1IG7A 1BI0A 2CJJA 2FV4B 3ZOQB 5FROA 4DOZA 3M7GA 2HGHA 1ETWA 1I3AA 5E3LA 2CH0A 4KMUX 4RB3C 1ETXA 4IL6C 1K4TA 5TJJA 2LKXA 1B8IA 3IKVA 3PIPF 4HOBA 3L2VA 2OJED 2QSFX 4RGUA 1FP1D 2XPWA 3IUOA 5GTIC 2DT5A 1KU3A 2LCEA 3PNVA 2HYGD 4R2QA 4GGGA 3JCUC 1B4AA 2LC2A 2VBZA 3X2QH 2GPIA 3SFIA 3NQOA 4IOAF 4BGDA 1R22A 2EH3A 2V79A 1Z0XA 3S1QJ 5KL3A 5A2QK 4XK4A 3CO6C 4BE2A 3Q0WA 5DCFA 2ELHA 1ZU1A 1SEUA 1TC3C 2QKLB 1XNQE 1UJ8A 2YTNA 2YR2A 1WHQA 5E3OA 1N78A 1V4RA 1WH7A 2E72A 4CDGA 2UU9E 1JKRC 4XN0A 1O0WA 1FTZA 2DGCA 2CQXA 2JQ7A 1ZELA 1YX3A 1VQ5I 5A6BD 2HFHA 3QPTA 1D0YA 3ERMA 4UUSA 1FMWA 3U1DA 2EORA 1UHWA 1XDSA 3QYEA 2KDOA 1GQEA 2DK8A 1REPC
chains in the Genus database with same CATH topology
5DDGA 5A2QZ 3LQQA 3QU3A 4IPAA 2W84A 5D5UB 1UHMA 3I59B 4M9XA 3F8FA 5F6FA 1O3TA 5ERIA 2GA2A 2CYYA 2XRNA 1HXDA 3WGGA 4GCVA 2DBBA 1KU9A 2XAGA 3WTUC 3VEPA 4YFKF 1MJ9A 1T2KA 2VONA 1S7OA 2MH2A 1I6XA 2XVCA 5K5OA 2O0YA 3WTXC 4HBLA 4EM0B 3LAPA 2VE8A 3R61A 3WTYC 2W25A 4RAZA 4UVBA 1LQ1A 2EB7A 4Q47A 3KFWX 1WQ2A 1LDKB 1ZGAA 1QGPA 1O3SA 5BOXA 3BJOA 4FX0A 1FY7A 3WGIA 1SD7A 1TW3A 5FD6A 4EV0A 2UXNA 1T98A 2OQGA 2DPUA 5DV5A 2FBKA 1FC3A 1TNTA 4LLNA 4QLCU 2OU2A 4P9FA 1U8RA 2K4JA 4EJUA 1J2XA 2HR3A 4M6YA 3DF8A 2V6CA 3RJPA 1FBQA 4CICA 5F64A 4P5OA 5D4RA 1ZGJA 1SD5A 1F4KA 3FXQA 1GHCA 2FU4A 3KEOA 3BPVA 3V8LA 1IN6A 1RI7A 3GFLA 2BGCA 4AIKA 3WG9A 2DQRA 3KETA 3HOTA 2NNNA 1G4DA 4IRIA 4XSXF 4IRHA 3CUQB 2QM3A 1DPRA 2DK8A 5D4SA 4JBAA 3RPUA 4CHUA 1JGSA 2CO5A 2L3DA 1TQMA 1W5SA 2UZKA 3P9KA 2IP2A 2ZXJA 3GEZA 3F22A 5LRRA 4BAYA 1KQ9A 2XROA 1IRGA 1YS7A 3C1DA 4IJAA 2QLZA 4JK1X 5HDGA 4TV7A 4HV6A 3GFIA 4OU0A 4M72A 1XSXA 1F1ZA 1DPUA 3J81K 1H9TA 2HOEA 2QBYB 3KZYA 4Q48A 4WF2A 4A12A 3HHGA 1HSTA 2D1VA 3T0YA 1P4WA 4LJZF 1XD7A 3P7NA 1WSUA 3F6VA 2WTEA 1J5YA 5HOOA 1QQIA 3ZMSA 2GA1A 2Q8KA 3E6DA 4XLPF 3D5LA 4UV9A 1Z1DA 4EGYA 3I0TA 4UVAA 2V1DA 1D5VA 2E7WA 1JE8A 2STWA 1B6AA 2UWMA 2F5FA 1P4XA 1USTA 4HF2A 1LEAA 1KYWA 5AIQA 3LWFA 4L9NA 2K86A 4L9JA 3MCZA 1ZG3A 2P8TA 2IT0A 1AOYA 5K5QA 3IHUA 1FYMA 2ZBKA 3BOQA 4XSZF 4BHCA 5ILUA 4CXFA 2DTRA 3ZPLA 2NYXA 1YYVA 1BC8C 2P5LC 2FOKA 4HA8A 3K0LA 3DXJF 4UUVA 5H6QA 1VTNC 3FMSA 2B0LA 2ADUA 4MQ9F 3HTSB 2H09A 3E5XA 3KP5A 3MWMA 2PN6A 2DLLA 2OZ6A 5JHUA 1DUXC 5CVIA 1IF1A 3I5UA 3CTAA 1OR7A 4WXCA 1XDUA 2OQRA 3T5XA 2HGCA 4AIJA 1I5ZA 4N0BA 4KA4A 2JZYA 3PFIA 1Z6TA 3HRMA 1FLIA 2PQ8A 4CO8A 5KK1A 5L3FA 1YS6A 3RYRA 3CUQC 4U0VA 2X4HA 5LEJA 4I0AA 2VOPA 2ZNZA 2JTVA 4U0YA 1A04A 4XRFA 2HEOA 2H6CA 2EJRA 1HSJA 4LG0B 5E20A 4PZJA 3DQVC 3RTRA 2MLGA 3G73A 3FHZA 3E6MA 1O7FA 2DW4A 3KP3A 2FA5A 3BROA 2F5CA 1T39A 5D8LB 2MD5A 1EH6A 2TDXA 5D5WB 1OYWA 4RGXA 1K79A 5CVRA 3QP6A 2Q2EA 4UHTA 2A61A 3SFZA 3SHFA 1U5TA 1FBSA 3GUDA 2FXAA 1R36A 4S05A 2VC0A 3MEXA 4HZFA 3HSEA 4BH9A 1BN5A 4FT8A 4A6EA 3E3VA 3N4MA 2VT3A 4HQMA 1YG2A 4LD5A 5HDNA 1OYYA 3WTTC 3TQNA 2GIVA 1E2XA 1XGMA 4H0EA 2XGXA 3H3UA 2X0LA 5HLHA 4EMSA 2QQ9A 2RQPA 2HWVA 2VBWA 1XCBA 3FZVA 5CJ9A 1V3FA 2P7CB 2BBYA 5AIPA 3GW2A 1WWXA 4ZYEA 2FNAA 2Y48A 2J5PA 3OOPA 2XAFA 5HVQC 3F21A 4U88A 1B9NA 2GXGA 2PI0A 1F5TA 2DQLA 3TO6A 1XN7A 2IJLA 4HDUA 2HKXA 2P5VA 1QPMA 4KIBA 3QRFF 1D8JA 2KIMA 1ZREA 3D0SA 2EV0A 5H6RA 2AXLA 1XMAA 3F8MA 3GZ6A 3GFJA 1PP7U 5E8IA 1YO5C 4XBFA 2ISYA 3CLOA 4HYEA 3F6OA 2FMLA 3PQKA 1C0WA 4L5JA 1TW2A 1Z91A 4KYWA 4Q4ZF 2V1XA 3FWEA 3EYIA 4G6QA 5JR3A 4LK0F 1YLFA 5BQTA 4CGZA 4ENJA 4PGGA 5K5RA 1F9NA 5D6FA 4P9UA 5AONA 1TQIA 3QAHA 3ROUA 4BXUA 3DPLC 2J5OA 1YFHA 2F5EA 1O7LA 3GFMA 2DU9A 4P96A 2ESHA 5HS7A 5K1YA 1J9IA 3KP4A 2KJCA 2E1CA 1R1TA 3RKYA 2Z5UA 3FM5A 2MH9A 2P4WA 2RC4A 2FEZA 2L4MA 4M9SA 3H3ZA 1BBYA 5ILVA 1S3JA 1TLHB 4I0BA 4HF0A 2LNBA 3LQRA 2PFBA 4MGRA 3WTVC 2P5KA 3DV8A 3FX3A 3F8NA 3QU6A 5ILSA 2HKOA 5TRDA 1TNSA 2W85A 2C6YA 5E1XA 5HS8A 1D8KA 4EM2A 3ISPA 3KLNA 1CF7B 3KLOA 1LEBA 2M5WA 1Z6RA 5LRSA 1AWCA 5DEQA 5E18F 5IT9K 4MHGA 3TO7A 1G3SA 2JT1A 2L4AA 1B59A 3HRTA 3TKYA 4YIIA 4PDKA 2GQQA 1IN7A 4ESJA 2Z99A 1PP8F 2CGPA 1U78A 5LGTA 4OIPF 3VB2A 5DYMA 2XASA 4R1HA 4BHPA 1X3UA 5JI6A 2HQRA 3IWFA 4BHBA 2BV6A 3VODA 1Y0UA 2D45A 3L09A 3ZP5A 4WXHA 3GYHX 2HZTA 4G94A 3KCCA 3C3WA 4KT5C 2EFPA 3CO7C 3RDIA 2RV8A 3I59A 4MNUA 1IAWA 5CYVA 3ZN1A 3FMRA 1O3RA 1IXSB 5LHGA 2OA4A 2OD5A 2QQAA 1H9GA 1WRJA 1HW5A 2HQNA 1UFMA 2YSRA 4EGZA 4OMYA 1LNWA 2CW0F 3J80K 1MD0A 3FF5A 2ACJA 1FP2A 3HHHA 3RYPA 5J6XA 2IPQX 2IA0A 2R7FA 1T38A 4KFCA 1FYLA 3LA7A 2MC3A 2O03A 3O2PE 4PCQA 2NNYA 3K69A 2HYFA 1KA8A 3R60A 3J80Z 4QWQA 4A5MA 1U3EM 1ZRDA 2PLYA 4ASNA 3COAC 2FNPA 1LDDA 2DAOA 2F5DA 4G7ZF 1BOAA 5IT9Z 4OMZA 3ECOA 3CUOA 4A0YA 4A5NA 2ZNYA 3SQNA 1ZG5A 3GWZA 3S2WA 3EDPA 4D0PA 2G7UA 5D5XB 3R6SA 4G7OF 1RZ4A 3P9CA 4UNOA 3O6BB 4KDPA 3ECHA 3HSRA 1ULYA 1I27A 2XAJA 4NB5A 2EK5A 2WC2A 2P6SA 2FE3A 2F2EA 4Y15A 3QP5A 1JXSA 1MJAA 3TO9A 1IN4A 1R23A 4I09A 1U2WA 4EJTA 1FWZA 3L9FA 1TTYA 1Q1HA 2BYVE 4K2EA 3T8TA 1R5GA 4KUMA 2EFOA 4UVCA 2UXXA 3F8CA 1S6LA 4L0ZB 2L02A 1W7PA 2A69F 4O3MA 4EM1A 1STZA 1OMIA 1K78A 4A2UA 3W6KB 1TQPA 2QQBA 1L0OC 1FBUA 3ABUA 4I02A 4HX7A 3E5QA 5HS9A 3NEUA 3E5UA 4HV5A 1K78B 2O6GE 3M8EA 4FX4A 3VOEA 3V4GA 1XB4A 2EA4A 2A6HF 1FNNA 4ZH4F 1S29A 3RPQA 4ZZLA 1QZZA 1XCVA 2XAHA 3GVAA 3ZQ7A 4ENKA 5L3DA 3WE2A 3Q5FA 1FOKA 5CLSA 4YFXF 2AS5F 4Y13A 2GZWA 2H6BA 3HOSA 2LDUA 3HRSA 2PEXA 1B9MA 2IA2A 2PBIA 1P6RA 2IA1A 2G9WA 2XV4S 3H92A 4I98B 1FYKA 1KU7A 3JTHA 4RS8A 5BMZA 2QENA 4WK8F 4GYIA 2XKPA 2VBXA 5FD5A 2K7LA 4GO1A 1MGTA 1QBJA 1KU2A 3B02A 5LGUA 3RIRA 4RAYA 2QBYA 2YX7A 5DUIA 4JQFA 4IF4A 5FFXA 3JSPA 5LLQA 2FMYA 3BJAA 3NRVA 2O3FA 5E8GA 4L9TA 2Y75A 1MKMA 3I64A 1T6SA 3QPHA 2A68F 4L9VA 2RGVA 1MZBA 2RDPA 3F8BA 5CVUA 1J75A 2YX4A 5D5VB 2MA3A 3GZ5A 2FBHA 1K6OA 2D1HA 1LB2A 1YIOA 2HS5A 4IHTA 3R0JA 3ERED 3HYIA 3KEQA 4Z2YA 4AWXB 4UV8A 1EV7A 2MBFA 1SMTA 2QYOA 3O3KA 5EEHA 3EETA 3HIFA 5CVJA 2RKHA 3IRQA 4LB6B 2GAUA 4AIHA 1XGSA 4E70A 2ZKZA 4KN7X 1J0RA 4DQ2A 1P92A 1DP7P 1U6GA 5FLXK 1I1GA 2RN7A 1MDMB 4WXDA 2NRAC 1ZYRF 3TOAA 1RNLA 3U2RA 1CGPA 3HUGA 4BQAA 3GF2A 2ZMEB 3FMQA 1RUNA 4HAMA 4ENMA 4RB2C 3KP2A 3BDDA 3K2ZA 3CDHA 4EJOA 5E1ZB 4HQEA 4CZZA 4GYGA 1R1VA 3KZZA 5FLXZ 3KP6A 2DO7A 3FXRA 3P9IA 1R58A 3WGHA 2Q0OA 5ICEA 4F7ZA 1Z9CA 1YW8A 4YFNF 3K1PA 3DEUA 2XIGA 1HQCA 3AAFA 3DKWA 4FHTA 5L3GA 2R3SA 2M45A 3MFKA 4ENNA 4LG0A 3MQ0A 1FPQA 1XGOA 3KP7A 4M74A 1BM9A 5E1WA 2WWYA 4G8XA 2EWNA 3L7WA 4NQWA 2HDCA 1R7JA 4KICA 1FSHA 4I7HA 1QZYA 3WU0A 4ZYDA 2CWEA 1OKRA 3J7AO 1KGSA 4HX8A 3WU1B 4WX9A 5LGNA 4L18B 4KIFA 1CF7A 1G3TA 4Q5SF 3N97A 4KN4X 1HKSA 4IVNA 1GVJA 2QZ8A 2CFXA 3LFKA 1LJ9A 2V1UA 1EH7A 4MTDA 1BIBA 1BI2A 3V8KA 1ONVA 1SFEA 5DUKA 2QWWA 3Q9SA 4M6XA 1OYIA 2NAZA 2A5YB 4LB5A 1R1UA 1QNTA 2FBIA 2RNJA 2KJBA 1G3YA 1LVAA 1S8NA 3Q9VA 1O3QA 4B09A 1MDMA 4I2OA 3DPTA 2GWRA 1R00A 1ZARA 1ODDA 4EQQA 2VOOA 1BJAA 4EJWA 2QVOA 2R7DA 3JAMK 3TOBA 1P4AA 1T0FA 3I58A 2DFIA 4UXNA 2COMA 5ICFA 1Z05A 3R4KA 1UB9A 1QO0D 2Z9OA 4EJVA 2STTA 3I53A 4I01A 3K1NA 1ZH5A 1TBXA 2CQKA 3JW4A 3LSTA 4BNCA 3HTUA 3G3ZA 4RB0A 1IXRC 2GXBA 2O61A 1Z7UA 4O5VA 2QUFA 1SFUA 1ZAOA 1ZN2A 5ICCA 2CSOA 4LLGF 1SFXA 1BI1A 1OPCA 1KQ0A 1YW9A 2VODA 2L54A 4L0YB 2XUBA 1W4MA 3M9AA 3BZ6A 1HKQA 3TDZC 4NHJA 3V7CA 1J59A 4AD9A 2BE5F 3JSOA 1B1BA 2ZFWA 1HBXG 5E17F 1WI9A 3MZYA 3QOPA 1BIAA 4MQVA 3CUQA 4RGRA 4HF1A 1U5TC 5LEKA 1BC7C 1JHHA 1U5TB 5L3EA 3ZMTA 4CYDA 2YU3A 5HDKA 2P6TA 5HLGA 2HTJA 4M71A 3TDUC 4MTEA 3J81Z 3MZHA 2CG4A 3E97A 4IRGA 3OV8A 2W57A 3IWZA 5JVTA 1W5TA 1R5HA 3E6BA 5J8FA 3WTWC 3K9TA 4PGHA 1RUOA 4A6DA 3T1BA 4DNCA 5FGMA 1ZRCA 4G9YA 2Z33A 3SZTA 2OZUA 3BJ6A 4HX4A 4HW0A 1I1SA 1IUYA 3R0AA 4G6DA 3BPXA 1MJBA 3F72A 3SZPA 5LBQA 2KIFA 3T8RA 4S04A 4LGWA 4ON0A 5ED4A 3K1MA 2EA2A 5DCMA 3ABTA 3ZMDA 3ML6A 2MLKA 2VE9A 2EV6A 4P55A 1IXCA 3B73A 3PQJA 1ZG1A 2PJPA 1YQAA 5CVVA 1GXQA 3KE2A 1PDNC 4B8XA 4ZYHA 3V7RA 1ZRFA 3EYYA 1HW2A 5ICGA 4GXOA 1IZ1A 3EUHA 2H27A 2BEOA 2IW5A 1IRFA 3TGNA 4OIQF 4U7BA 4IXAA 1BI3A 2ZJ2A 3IL2A 2PMUA 2FQ3A 2DK5A 3DFGA 3WE3A 1SD4A 2HTSA 3FM3A 1RIOH 4OIRF 5DD8A 5FO5A 1E17A 1DDNA 4IHSA 4WWCA 2Y0MA 1ON1A 5J8CA 4RGSA 3M8FA 4XLNF 3V8JA 4WCGA 4LLLA 1D3YA 2VC1A 2EFWA 2FF4A 2L01A 5KVRA 1USSA 3L2CA 3I54A 2K4BA 4HDVA 2XHKA 1FZPB 2XKOA 1JHFA 1XSDA 2ZMEA 1SAXA 3REOA 1IW7F 2M1BA 3M1EA 4Y17A 3JTGA 4U7DA 1HKTA 2KKOA 3IC7A 5LHIA 2JRTA 4G7HF 1WKMA 5L3BA 2LSOA 3WODF 3MAJA 4A0ZA 3RI4A 3LA2A 2KIUA 2M87A 3BP8A 5IT3A 4KMFA 2VN2A 1KQ8A 2DI3A 4LK1F 4N9IA 4ESBA 4KNYA 4HLYA 4M9ZA 2IRFG 1ZHFA 1ZLKA 2D2WA 3U9GA 2ISZA 1HW1A 3BY6A 1L3LA 1KYZA 3F3XA 5HLIA 3RKWA 3VFZA 1IN5A 1O57A 1G3WA 1XSVA 2EFNA 2DPDA 2WV0A 2LF8A 4OOIA 3LAJA 2E7XA 4YIFA 2OAZA 2FSWA 1SD6A 2YPRA 1ZLJA 2JPCA 1PUEE 5BS6A 4U0WA 3I71A 2A6EF 1W7PB 3E6CC 1S7AA 2O8XA 3CJNA 2KRFA 3F23A 1P2FA 3GXOA 2NS0A 3ZMVA 2ETHA 1IN8A 1J7KA 1YW7A 2W24A 3GX4X 2ESNA 2A3SA 2A07F 1XGNA 1XMKA 1NHAA 4R79A 5FFZA 3ULQB 1K7AA 3JAMZ 3SXYA 4KIGA 3C7JA 2VT2A 2K27A 3HRUA 4HLXA 5DCMB 5FB2A 3WTZA 2OBPA 3IKTA 2Z3YA 5F1RA 1SMYF 3WTSC 3GLXA 4LFUA 2E1NA 5L3CA 6PAXA 2LF7A 1GXPA 4LMYA 5DD4A 2V9VA 4ETSA 1FX7A 3IRRA 2EV5A 1FSEA 5D8KB 2G7HA 2LKPA 1LDJA 4ZZDA 1W7PD 2M30A 5JFRA 4OIOF 4A0XA 4EVIA 4YG2F 4AVPA 1G6NA 4ESFA 2IVMA 3BWGA 4ZYGA 2VXZA 4O6JA 3RKXA 2PMHA 5BPIA 4BYYA 2JPBA 3LA3A 2RVCA 2EFQA 4L5IA 4MEYF 2PG4A 4R8HA 2XAQA 2H94A 4M73A 3ZMZA 3DP7A 1YTYA 3L00A 2M8EA 2VBYA 3ZN0A 2ZCWA 2JSCA 1EH8A 4RB1A 4N9HA 3ELKA 5EEGA 1H0MA 5H20A 1FT9A 2K02A 3I4PA 3W6JB 3EQLF 2P7VB 3V7SA