5LLQA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119f variant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPFHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Interdomain interactions rearrangements control the reaction steps of a thermostable DNA alkyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
molecule tags Transferase
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5llqA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 5llqA01
1KU9A 2XROA 1SD6A 4A0ZA 2XAGA 4M71A 1J0RA 4M9SA 4M73A 3F3XA 5D8LB 2MC3A 2P6SA 2MLKA 4EMSA 3W6JB 1OYYA 2ADUA 4U7BA 4BHPA 1ZG3A 4HX4A 1LEAA 2K27A 4MQVA 3HOTA 4L18B 4BXUA 1HW1A 1TTYA 2K02A 3DPLC 4RGRA 4KNYA 1ZREA 4KT5C 3I4PA 4AIHA 4ESBA 1H9GA 2CO5A 2DO7A 1RIOH 4BQAA 3QP6A 4CGZA 2XAHA 3QP5A 5ERIA 2XASA 2IRFG 2IP2A 3E5QA 3DXJF 2AXLA 1LEBA 3KE2A 3ISPA 2ZNZA 3M7GA 1QQIA 2FE3A 3KZZA 3MFKA 3HRSA 4RAZA 5E20A 3Q9VA 2KRFA 4LB5A 1FT9A 2E1NA 3FXRA 2ELHA 3HHHA 4MHGA 3K1PA 2M5WA 4KFCA 2XHKA 3I53A 5BQTA 2GQQA 1DDNA 3IL2A 2M30A 1FYMA 3P9CA 1RUOA 5HDKA 1T2KA 3FWEA 2BEOA 2Q2EA 1P4AA 3ZMDA 1XCBA 2CGPA 3HUGA 2A68F 3BJOA 2IA0A 1YQAA 4S04A 2YSRA 3L00A 1ZHFA 3L09A 2BE5F 1MJAA 1B59A 2VXZA 2XIGA 1USTA 1KU2A 4OU0A 2XKPA 3ROUA 5ICGA 1XMAA 3HSEA 2DI3A 2C6YA 2CWEA 1R5HA 1REPC 1KQ9A 4ESJA 3RPUA 2DU9A 5FD6A 3JW4A 1D5VA 2V1DA 4E70A 2PN6A 5EEHA 1K78A 5BPIA 5K5RA 5BPDA 3DV8A 2GA1A 1TLHB 5CVRA 1F5TA 5L3CA 2NNNA 3GFMA 3KEQA 1WSUA 1VTNC 4UVCA 1YFHA 4O5VA 2OQRA 3K1MA 2E7XA 1W7PA 3WTSC 3M1EA 2Z33A 5IT9K 5DCMA 3WU0A 2DT5A 4KN4X 1X3UA 3ZMTA 2EV0A 3WTVC 1KQ0A 3CLOA 3KEOA 2D1HA 1LDDA 2NNYA 2XGXA 1S3JA 2QBYB 4M72A 5E8GA 3MZYA 3HTSB 1GXPA 3L7WA 3F23A 3P7NA 3HTUA 3HHGA 4M6YA 2VBWA 1JHHA 2WC2A 2O61A 2FBHA 1G3WA 2QWWA 4ZYGA 2GXBA 2V6CA 3LQQA 4KIGA 1OYIA 2EFQA 1XDUA 3CO6C 4MTEA 3MAJA 1AWCA 1BIBA 3WE2A 4HF0A 3MWMA 1F1ZA 1I27A 1KYWA 2ESHA 2OU2A 2LKPA 4IJAA 2ZFWA 4TV7A 2QYOA 2P7VB 5E17F 3JSPA 4U0VA 3J81K 1SAXA 3U9GA 1ZAOA 4G9YA 2L3DA 2DW4A 5JFRA 3F8FA 4EJOA 3DEUA 3GFLA 3WGHA 5D6EA 3R0JA 4FX0A 3ERED 1Z6TA 1WWXA 2VN2A 2O3FA 2M87A 4OOIA 2WTEA 1Z9CA 4RB0A 5ICCA 2A6HF 5HLHA 2F5FA 2ZMEA 4Q48A 3U1DA 3P9IA 3CJNA 4EM0B 1ZGJA 2WV0A 3R61A 1LQ1A 1HBXG 2PFBA 3CUQC 1FNNA 4WX9A 3FXQA 5F6FA 3P9KA 1XCVA 4ON0A 1SMYF 4HW0A 3EETA 4AIJA 1IN5A 2P4WA 1R36A 2W57A 1T0FA 2VBZA 5DEQA 1I6XA 1FOKA 4YFKF 3G3ZA 4NQWA 1TNTA 1PDNC 3TQNA 2A3SA 1MGTA 2HKXA 3KETA 5D4RA 1P4WA 4N0BA 4XBFA 3LQRA 5E18F 2BBYA 1C0WA 1UHMA 2L02A 5DV5A 1MJ9A 2O0YA 2RDPA 3SQNA 1F9NA 3BJAA 4HV5A 4ASNA 2D45A 3I5UA 2PEXA 3FXUA 1U2WA 3T8TA 4HQMA 4I98B 5L3GA 1ZG5A 1ONVA 4I01A 4O6JA 1ZRCA 5KVRA 3S2WA 3Q9SA 1RI7A 2MH9A 3K1NA 3WG9A 5BMZA 4UXNA 1RUNA 2Q0OA 2PMUA 5D4SA 1G3YA 4OIOF 1XSXA 5LGNA 2FU4A 3IRQA 4L9NA 2HZTA 2G7HA 5A2QK 3RI4A 2EFOA 4M74A 1IXSB 1R1VA 2E7WA 1LVAA 5DCFA 3RTRA 4Y13A 3KP3A 1HW5A 5LHHA 1BBYA 1TW2A 2QQBA 5A2QZ 5CVUA 2RVCA 3WU1B 2KIMA 3MEXA 4G8XA 2LF7A 5FB2A 2MA3A 4Z2YA 5HLIA 3KLNA 5HOOA 2B0LA 3I71A 4AD9A 2OZ6A 2JPCA 1WKMA 4UVAA 3C3WA 3LSTA 4BNCA 2ZCWA 2Y0MA 2V1UA 1ZH5A 5D5WB 4N9IA 3ABUA 1TW3A 5ED4A 2XUBA 1V4RA 1G6NA 2VONA 3R0AA 4UV9A 1QGPA 3BJ6A 3FMSA 1UCRA 3EQLF 2HWVA 3RPQA 5ICFA 1RNLA 2DFIA 2VT2A 1MDMB 2YX4A 1LJ9A 3O3KA 4ZYHA 5J8FA 1UHWA 1QO0D 1QPMA 1HKTA 1EH8A 4IVNA 1JE8A 4I09A 1TNSA 3KLOA 1J59A 2RV8A 2J5PA 4RGSA 2CG4A 3QOPA 4MEXF 2QBYA 3SFZA 4ESFA 3OOPA 1FSEA 3LAPA 1IRFA 5TJJA 1FP1D 4LD5A 1HSJA 3FM3A 3E3VA 4HAMA 2Q8KA 1YYVA 1O7LA 2FMLA 2JT1A 4LGWA 2IJLA 2HR3A 3DKWA 2QZ8A 3HIFA 2PG4A 1CGPA 4G6DA 1EH7A 4OIQF 3ECOA 2GWRA 5LLQA 2DTRA 4OMZA 1W5TA 1T6SA 2CYYA 3VEPA 3VFZA 2XAQA 1B4AA 2LDUA 1XB4A 1IF1A 4ENMA 2HFHA 3RJPA 1BI2A 1XGNA 3LFKA 2O6GE 2W25A 3RYRA 1ZLJA 3QU6A 2YX7A 4I0AA 2Y48A 5BOXA 1YW7A 1JHFA 5LHIA 4YFXF 4HQEA 1TQPA 4CO8A 3TDUC 4B8XA 2QLZA 3O2PE 4G6QA 4LK0F 4OIRF 2DK8A 3F6OA 2EV6A 1T38A 3VB2A 1J7KA 1T98A 2FXAA 4HV6A 3ZMUA 3AAFA 5JHUA 1U5TA 4GO1A 2PMHA 4MNUA 2L54A 2QQ9A 1R7JA 4DQ2A 3C7JA 4GYGA 4HA8A 2KIUA 5L3BA 3GF2A 4P9UA 4OIPF 3BPVA 3GYHX 2A69F 1SFUA 3BOQA 2P7CB 4U0WA 2P5LC 4UHTA 4CZZA 4Y15A 3HSRA 3KP7A 1WRJA 4UNOA 3TOBA 2K7LA 1P92A 3I64A 1IXRC 1YS6A 4AVPA 3RKWA 1BOAA 4Y17A 3BY6A 4I02A 3N97A 4F7ZA 1U6GA 2J5OA 4XLNF 5H20A 4A6EA 3GFJA 1FYLA 4CYDA 3O6BB 3I59B 2RNJA 4ENJA 4LLNA 4WCGA 5IT3A 2EA2A 4HZFA 1V3FA 2L01A 3TKYA 2STWA 2RKHA 2IT0A 2W84A 5CLSA 2QUFA 2F5CA 4UUVA 2VBXA 1FYKA 1BC8C 2VBYA 3T5XA 2EK5A 1FBQA 4RB1A 4EM1A 2P6TA 2JRTA 3V8KA 2HEOA 1U5TC 2NYXA 4WK8F 3F8BA 1R58A 2FNPA 3CUOA 2TDXA 5DYMA 4FT8A 1R1UA 5HDGA 2D1VA 3SZTA 2COMA 2IA1A 1LNWA 1XGMA 3E5XA 2FEZA 3GZ6A 2PJPA 1O7FA 3E97A 5K5QA 1XMKA 3KCCA 4R1HA 1YO5C 2FBKA 3ZN0A 4EVIA 4KMUX 1BM9A 2XAFA 5E1ZB 5HS7A 4OMYA 4GCVA 2K4BA 4KN7X 1RZ4A 2QQAA 5ICEA 4D0PA 1FP2A 2A61A 4YIIA 1EV7A 3BZ6A 1W7PD 3EYYA 1IAWA 3B02A 1Z1DA 2OBPA 2M8EA 3CTAA 2A6EF 5CVVA 3IHUA 3GW2A 1LB2A 1GHCA 1S7AA 1FBUA 3ABTA 2VOPA 2NS0A 5FD5A 1ULYA 4HBLA 1XGSA 5D5XB 1W4MA 1G4DA 5DUIA 1MJBA 1KYZA 1NHAA 4GGGA 4MEYF 2EFWA 4P5OA 5LEKA 5LEJA 1BI1A 4JK1X 1O57A 2XKOA 3DQVC 3SZPA 1D8KA 4K2EA 2O8XA 4ZYEA 3EDPA 1FZPB 1IN6A 2RQPA 1S6LA 1XGOA 4L9TA 3V8LA 1MDMA 4EGYA 4HF1A 4YG2F 1XD7A 1BN5A 2KJBA 3KP5A 4RS8A 3ECHA 3WTYC 3FX3A 2E1CA 2JPBA 2VC1A 3NRVA 2VT3A 3PFIA 3T8RA 1UFMA 1DPUA 2PBIA 2IA2A 4P9FA 1PUEE 3I58A 2M1BA 5L3DA 1FWZA 1R5GA 4IXAA 1O3SA 3FM5A 5K1YA 3T0YA 2YU3A 5TRDA 1IXCA 3IRRA 3MCZA 4BH9A 5CVIA 4N9HA 4ENKA 1B9NA 3TO9A 6PAXA 3N4MA 3IKTA 2O03A 1GVJA 3F22A 4XLPF 4LK1F 3JTHA 1S7OA 2VE8A 2FQ3A 2JZYA 3D5LA 4I0BA 1FPQA 4PGHA 3M8EA 1U3EM 2UXXA 3ULQB 3EYIA 4LG0B 4BAYA 5D5UB 4MQ9F 3IWZA 2FSWA 3K0LA 2P5KA 3GWZA 4KA4A 4IPAA 4YFNF 4EJTA 3MZHA 1OMIA 4XRFA 3JSOA 3GO5A 2UZKA 4EM2A 1QNTA 4KDPA 1FLIA 5DD8A 3WTWC 2R3SA 2DLLA 2LNBA 2DPDA 5DCMB 3JTGA 4BHBA 2RGVA 3IKVA 3MQ0A 1FY7A 1CF7B 4WXHA 4DNCA 1FBSA 4P96A 3QPTA 3I0TA 1B1BA 4EV0A 4O3MA 3TOAA 1IUYA 4EJWA 1MZBA 1S8NA 3LAJA 3ZQ7A 3M9AA 3QU3A 3QRFF 4H0EA 3H3ZA 4WWCA 1K79A 2GIVA 3J7AO 2ETHA 3CUQB 4JQFA 4LB6B 4EJUA 4IHSA 1MKMA 5HVQC 4S05A 5AIQA 1YG2A 4FHTA 5FLXZ 4HDVA 2YR2A 1SMTA 2JTVA 1W5SA 3I59A 1ODDA 4IF4A 3WE3A 3W6KB 1ON1A 4L9VA 2FF4A 1P4XA 5J6XA 4EJVA 3ML6A 5H6QA 3C18A 1TQMA 2VC0A 2QENA 2D2WA 3VOEA 2GAUA 5ILUA 4Q47A 3RYPA 3ELKA 2IVMA 2EA4A 4I7HA 4RAYA 1BJAA 3F8MA 1DUXC 5J8CA 4QLCU 1DPRA 4A0YA 1TBXA 4A6DA 3LWFA 4XSZF 5D5VB 1USSA 2WWYA 3ZP5A 3E6DA 3WGGA 5H6RA 4HX7A 2DPUA 1ZRFA 1SFXA 4KIBA 4BHCA 2VOOA 3JAMZ 1GXQA 3VODA 1E17A 3FMQA 2MBFA 3GUDA 2STTA 4R8HA 3ZMZA 2DQRA 1AOYA 2HTSA 4PDKA 2H27A 1FSHA 2GA2A 1YIOA 2HDCA 2ACJA 2OA4A 2CSOA 2Z5UA 5L3FA 1KA8A 5L3EA 2UWMA 3NQOA 1G3SA 2ZKZA 5LHGA 2PQ8A 2H6CA 4ETSA 5E8IA 3SHFA 3QPHA 2X0LA 1SFEA 1PP7U 1MD0A 1BC7C 4HLXA 3WGIA 3IC7A 4ZZDA 1SD4A 2M45A 3GEZA 1R1TA 2V1XA 4HF2A 3REOA 1PP8F 3ZPLA 3R6SA 2P5VA 3F6VA 4KMFA 2A5YB 1UB9A 1L0OC 2OZUA 1ZARA 1ZLKA 4M6XA 5FFXA 1SD5A 1Q1HA 2OAZA 4WXCA 1Z7UA 3GZ5A 2GXGA 4U88A 2K86A 3FF5A 4MTDA 3E6MA 2VODA 1STZA 3F8NA 3GVAA 1OR7A 4L0YB 3PQJA 4I2OA 1OYWA 1I1SA 2HOEA 1HKSA 4IHTA 3I54A 4JBAA 2ESNA 5AONA 5KK1A 2ZNYA 1YS7A 2UXNA 3LA7A 1I5ZA 4PZJA 1IN7A 2EFPA 2F2EA 4G94A 1YTYA 2NAZA 5HS9A 1O3RA 2RC4A 1K6OA 3PQKA 1IW7F 1KU7A 4CHUA 2MD5A 3CDHA 4IRHA 3EUHA 2Y75A 2H09A 2BV6A 4NB5A 1HXDA 3HOSA 3V7CA 3H92A 2RN7A 2W24A 2F5DA 5BS6A 2R7DA 4WF2A 2LF8A 3GX4X 4CXFA 1KGSA 3F21A 3LA3A 5D8KB 3K2ZA 2MH2A 2G9WA 2Z99A 3J80K 1BIAA 1OPCA 2CW0F 4PGGA 1L3LA 2G7UA 1YW9A 1LDKB 5FFZA 2KJCA 3F8CA 4L0ZB 4FX4A 4LG0A 4LJZF 1XDSA 3BDDA 1FC3A 2EWNA 2ZXJA 4RB3C 3H3UA 3J80Z 4IRGA 3WTUC 5K5OA 2MLGA 5E1WA 1O3QA 3M8FA 1J2XA 1R00A 2IPQX 3ZN1A 1ZRDA 1IN8A 1Z6RA 2HYFA 5DDGA 3CO7C 1WQ2A 3V7SA 4ZYDA 1P2FA 5FO5A 4RGUA 2XVCA 1U8RA 1OKRA 3HRUA 1JXSA 2HYGD 2ISYA 4CICA 3SXYA 1CF7A 1E2XA 1O3TA 4LMYA 5DD4A 1F4KA 4GXOA 5IT9Z 1J75A 3COAC 1HW2A 3DPTA 5E1XA 3WTTC 4BYYA 2OD5A 4B09A 1ZYRF 4Q4ZF 3FMRA 1WI9A 3LA2A 3NEUA 3V8JA 2ZJ2A 2JSCA 1G3TA 2FBIA 5FGMA 3CUQA 5LGTA 2W85A 1BI3A 2QM3A 1J9IA 2PI0A 1IN4A 2A07F 3RDIA 2CFXA 4LFUA 3BROA 2K4JA 1YLFA 2V79A 2H94A 4HLYA 4A2UA 1D3YA 5LGUA 1K7AA 2ZO4A 4G7OF 1XSVA 1P6RA 3DF8A 3DP7A 1KQ8A 1DP7P 2YPRA 2ISZA 4L5IA 2FRHA 2L4MA 3U2RA 2DBBA 4A0XA 4M9ZA 3E6BA 3HRMA 2QVOA 2DQLA 1Z05A 3DFGA 4UVBA 5HLGA 1Z91A 3FHZA 4PCQA 3V4GA 3HYIA 4EGZA 3BP8A 5CVJA 4R79A 3D0SA 3R4KA 4HYEA 1HKQA 5LBQA 1U78A 3RKYA 2EJRA 1U5TB 3J81Z 3IWFA 3TDZC 5DUKA 4G7ZF 3WODF 2XAJA 4M9XA 1JGSA 2HTJA 1TQIA 3E5UA 1J5YA 4RGXA 4KICA 4KUMA 3KFWX 4AWXB 3C1DA 1Y0UA 2IW5A 2AS5F 2Z3YA 1I1GA 4AIKA 4KYWA 4U7DA 4G7HF 4WXDA 3QAHA 1ZN2A 2P8TA 4ENNA 4LLGF 4L9JA 3GXOA 3K69A 3KZYA 2HQRA 2KKOA 3BPXA 5ILSA 2V9VA 4A5MA 3L2CA 3Q5FA 3G73A 1K78B 1T39A 2OQGA 4MGRA 4CDGA 4RB2C 1S29A 4EQQA 2KIFA 3TO7A 3V7RA 2FA5A 3FZVA 3KP4A 2EB7A 1BI0A 3R60A 1XN7A 1EH6A 2HKOA 4P55A 3RIRA 3GFIA 1W7PB 2XV4S 3HRTA 3K9TA 4UV8A 3F72A 2H6BA 1QBJA 2Z9OA 5LRRA 1YW8A 1FX7A 5EEGA 2VE9A 4HOBA 1IZ1A 4XSXF 5ILVA 4ZZLA 1ZGAA 1R22A 2HS5A 3L9FA 1LDJA 2EV5A 4YIFA 3TO6A 2GZWA 1R23A 3GLXA 5AIPA 5FLXK 2BGCA 3TGNA 5CJ9A 5HDNA 4IRIA 1D8JA 4ZH4F 4KIFA 1QZZA 1B6AA 1ON2A 5CYVA 2XRNA 3BWGA 2CQKA 1ZG1A 3HSFA 5JI6A 1HSTA 2NRAC 2FMYA 5LRSA 1HQCA 1A04A 4U0YA 2L4AA 5HS8A 2X4HA 3WTXC 1H0MA 5F1RA 2EFNA 3KP6A 1B9MA 3ZMVA 5D6FA 4HX8A 5F64A 4LLLA 4A12A 2HQNA 4L5JA 3E6CC 2FOKA 4Q5SF 3RKXA 3KP2A 1H9TA 1QZYA 1SD7A 3T1BA 3JAMK 4GYIA 2DK5A 2FNAA 2ZBKA 3B73A 3OV8A 3WTZA 4OINF 2HGCA 2BYVE 4HDUA 1KU3A 4A5NA 1XSDA 2PLYA 2DAOA 4NHJA 3ZMSA 1IRGA 2R7FA 5JR3A 2LSOA 5JVTA 2F5EA 4QWQA 2ZMEB
chains in the Genus database with same CATH superfamily
1KU9A 2XROA 2HJJA 2EOIA 1SD6A 4H4KC 4A0ZA 5IOYA 1V5GA 2XAGA 5C4XJ 2KRHA 4M71A 2X6XA 4UUTA 3ZOBA 1J0RA 2QA4I 4MFDA 2EORA 1QPIA 4M9SA 2E36A 3F3XA 4M73A 4C30A 5D8LB 2CW8A 3F6HA 2MC3A 1Z3YA 5IT9C 2P6SA 1U9OA 3C2BA 2MLKA 4BUPA 1IDZA 4EMSA 4FETA 2ZJQF 2F8BA 3ABLH 3DJWA 3SEZA 3W6JB 1OYYA 2ADUA 1XTAA 4PK4A 1IBME 2W00A 4FISA 2EOFA 2H1KA 4U7BA 2WA0A 1UHZA 2HU9A 1QU3A 2MSYA 4NQWB 4DV0E 1V5FA 1ZG3A 4BHPA 1X47A 2LJHA 2LTSA 3CMAI 1OCCH 4HX4A 1YRNB 5CFFE 1LEAA 2K27A 4MQVA 3HOTA 1HF0A 4L18B 1YYKA 3PSFA 5FKMA 4F92B 4OWRB 4BXUA 1Y1VJ 3KZIC 2BB8A 3BIDA 5AE1A 1HW1A 1TTYA 1WCMJ 4J8ZA 2BVLA 2K02A 3DPLC 4RGRA 4KNYA 1ZREA 3EPLA 2DOAA 4KT5C 1PJQA 3I4PA 4C3JJ 4DR4E 4V19K 4AIHA 4ESBA 2CU7A 4QTRA 1H9GA 2EM6A 2YTOA 2CO5A 3HXLA 3BTJA 2DO7A 1RIOH 4BQAA 4BC9A 2LD5A 3QP6A 1V55H 3M1CA 2Q1ZB 4CGZA 4BCAA 2QSHX 2XAHA 1LPQA 3QP5A 1SVMA 4JI4E 3FXMA 2RSIA 3E7LA 4CUGA 3BGHA 4LF8E 2L6MA 2AQEA 5ERIA 2EOMA 2XASA 3K4NA 2IRFG 2IP2A 3E5QA 2E2IJ 3DXJF 2AXLA 1LEBA 1GUUA 3KE2A 3LSRA 2RSMA 1ETXA 3ISPA 3I4MJ 5AC4A 2ZNZA 3DTEA 1QQIA 3M7GA 2HVQA 4JI1E 3H1CA 3K4BA 2FE3A 5FRMA 1RKWA 3KZZA 1UMQA 3I3LA 3MFKA 2IGOA 3HRSA 3J7YJ 2ZSHB 1AU7A 4RAZA 4PFPA 5E20A 3VSLA 1Y6IA 1QZEA 3Q9VA 1UHSA 4BXFA 4GKJE 2L7MP 1Z67A 2KRFA 3K4JA 4LB5A 1JTXA 1FT9A 2E1NA 5JHFA 3FXRA 2YU5A 4M9VC 3OYAA 2IS6A 2ELHA 1FEXA 3DU6A 3HHHA 1A1LA 1HNXE 3TP3A 4MHGA 4CCOA 3K1PA 2M5WA 2WAQN 4FE4A 4X0GA 4KFCA 4BMJA 5B1AH 2XHKA 3I53A 5BQTA 1A1GA 3OOUA 1YOVB 2GQQA 2OC6A 3J81C 1DDNA 3BBGA 5FKOA 3VYUB 2CV1A 3IL2A 1ZR4A 3HB9A 2M30A 2DOFA 2L5QA 1FYMA 4A3BJ 3P9CA 4YY3E 2KL4A 3IAM2 2ADRA 4DR6E 1RUOA 5HDKA 5M5WJ 3ZCOA 1T2KA 3FWEA 2BEOA 2Q2EA 1P4AA 3ZMDA 2X6YA 1XCBA 3BF2A 2CGPA 3CDIA 1ZBTA 1UJ8A 4JV5E 3HUGA 5IP9J 1F43A 2A68F 1QU6A 4NXNE 3BJOA 2IA0A 1R5ID 1YQAA 3SYTA 1FIPA 2WAFA 4S04A 2YSRA 3L00A 1ZHFA 4NDLA 1DGCA 3L09A 2BE5F 4GDFA 4CCLA 4F9AB 1MJAA 1B59A 4XKCA 3BG5A 3MKLA 4XLHA 3ESWB 2WB1N 2VXZA 2VKEA 2XIGA 5TGTA 3RZDJ 1LE8B 2EP3A 4JX5A 1USTA 3HQ1A 1KU2A 4OU0A 2XKPA 4Y4RA 1OISA 1B8IB 3ROUA 2A25A 4B3TE 1M1EB 5ICGA 1XMAA 3HSEA 3GBGA 2DI3A 4CSWA 5F3WA 2C6YA 5IYCJ 2CWEA 1R5HA 1REPC 2EPFA 2NS8A 4WSGA 5IV8B 4HNVA 4MLOA 1KQ9A 4ESJA 4XKWA 2EMXA 4ZTFA 3RPUA 2DU9A 5FD6A 1X48A 3TL4X 3JW4A 1D5VA 2V1DA 1NH3A 4E70A 2PN6A 5EEHA 4UUSA 5BPIA 5K5RA 1K78A 2EMWA 3HPHA 2ZXHA 5BPDA 2V6EA 3DV8A 2GA1A 2X1DA 3WU2C 1TLHB 3THOB 5CVRA 4XKBA 1F5TA 1OR7C 4B3ME 5L3CA 3GTOJ 4IHWA 1ETYA 2NNNA 3GFMA 3KEQA 3M3YJ 1WSUA 2YU8A 1VTNC 4UVCA 5EEAA 1YFHA 2V88A 2L9SA 4O5VA 2EMIA 3CD6I 1IGNA 1FTZA 1HNZE 1TF3A 1IBLE 2OQRA 5H2FC 2P0WA 2MKDA 2BHZA 1I6HJ 3AKZA 1EKEA 4MLQA 2W4SA 2RQLA 1A6IA 3A01A 2NUFA 3K1MA 1VQPI 2LMDA 2E7XA 2LC2A 1W7PA 4LOCA 2EZIA 3WTSC 3M1EA 1IC8A 2Z33A 5IT9K 1N3GA 2RS6A 5DCMA 2UUZA 3WU0A 2EOQA 3LL7A 3LOCA 1HR0E 4LFBE 2DT5A 2WAEA 1X19A 1SFOJ 1LLMC 4F6MA 4DV3E 3K70D 5EG0A 2ZXWH 1G59A 3K4LA 4KN4X 2Y0SA 5J4YA 1X3UA 3ZMTA 2EN2A 2IBDA 5IWAE 2EV0A 3WTVC 1FIAA 1KQ0A 2W1OA 3CLOA 4DUYE 2LOOA 1D0ZA 3KEOA 3V42A 1T95A 2ZXIA 3ZQIA 4GFBA 4HSRA 2D1HA 1D5YA 1LDDA 2NNYA 5GADJ 2XGXA 1S3JA 2QBYB 4M72A 5FKLA 1AKHA 5E8GA 3MZYA 1YYOA 3CP2A 3HTSB 1GXPA 2K40A 3L7WA 1S7EA 2WBMA 5KNLA 3F23A 2HOTA 2E1OA 3FBNB 3P7NA 2F4MB 1Z7LA 5F0HA 3HTUA 3HHGA 4M6YA 4NHRA 2VBWA 3W2WA 4WSPA 2Y9YA 4KWYA 4F2JC 1JHHA 2O5RA 4X66E 2WC2A 3BR3A 2O61A 2AHQA 1G3WA 2FBHA 5K7FA 2F6CA 2QWWA 5LFAA 3B6CA 4ZYGA 4RBOA 2CTDA 2GXBA 3LSJA 4IO9F 2V6CA 3LQQA 4NC6A 3WHBA 2FV4B 4KIGA 1OYIA 2EFQA 2DJIA 3K6GA 2DLQA 3NAUA 1I3AA 2EZHA 2K3PA 1XDUA 3OYEA 2K3FA 2EMLA 3CO6C 2EOXA 4MTEA 4DZPA 4DR2E 3MAJA 1AWCA 1BIBA 2TRTA 4B1RA 2EM7A 3WE2A 4HF0A 3MWMA 1F1ZA 1I27A 1KYWA 1DI2A 1Q1VA 2ESHA 2OU2A 3C6KA 2LKPA 4IJAA 3SJMA 3MKYB 1E0EA 2ZFWA 4TV7A 1LFBA 2QYOA 3FXLA 3CCVI 5KL4A 2P7VB 5M5YJ 5E17F 4O24A 3JSPA 3C2HA 4OX9E 4U0VA 5J3LA 3E1SA 3J81K 2ZB9A 4LITA 1SAXA 3U9GA 2YTQA 1ZAOA 3OIPA 4G9YA 2B9SA 2JUGA 2L3DA 5C3EJ 1A35A 2DW4A 2RS7A 5JFRA 3F8FA 4EJOA 3DEUA 1RQ0A 2LJUA 3QG5C 2E60A 2ELZA 2PMZA 3PL8A 3LLHA 3GFLA 3J7AG 2GXAA 4ZDLA 3WGHA 1WHNA 4V2GA 5D6EA 4BJ5C 4II3A 5DS9A 3R0JA 4FX0A 2OV7A 3ERED 1Z6TA 2DFFA 1W0TA 1A1IA 1WWXA 3S1RJ 3GTQJ 2VN2A 3D1NI 2VASA 2HGHA 2O3FA 2M87A 3A0BC 4OOIA 2ELYA 2WTEA 3A0HC 3BR5A 1Z9CA 4RB0A 4BU2A 5ICCA 1D1CA 2EMYA 4BGDA 3H3VK 4IL6C 2A6HF 2LRSA 1WGXA 5KHDA 3CCMI 2EN4A 5HLHA 2AO9A 2F5FA 2ZMEA 2EOZA 4Q48A 3U1DA 3P9IA 3C4BA 3CJNA 1NK3P 4EM0B 3SDBA 1ZGJA 2WV0A 3LMLA 1J26A 2M2EA 3R61A 2DA7A 2K9NA 1HDDC 1LQ1A 1HBXG 2QQ8A 2PFBA 3I9V2 3CUQC 2R7UA 2EPKX 1FNNA 5IY5H 3FXQA 5F6FA 4WX9A 3P9KA 1XCVA 4ON0A 2Y0SN 1SMYF 1OCOH 2JOBA 4HW0A 3PUFA 1Z1BA 3EETA 3ZQHA 2M9HA 1Z21A 3HGGA 4AIJA 1IN5A 2QEXI 1CQTA 2P4WA 1QRYA 1R36A 2W57A 2NA2A 2Y9ZA 3VK6A 1T0FA 4K0KE 2VBZA 1X49A 2VJJA 2MC4A 5DEQA 1I6XA 1FOKA 1HNWE 4YFKF 3G3ZA 4NQWA 1TNTA 1PDNC 3TQNA 2A3SA 2X85A 4XK4A 1TWGJ 1YE9A 1MGTA 2HKXA 3KETA 1YRNA 5D4RA 1P4WA 4JX6A 3W3CA 1TWAJ 4N0BA 2BY0A 5CPRB 4XBFA 1OLTA 3LQRA 5E18F 2BBYA 2R7QA 1UHMA 1C0WA 4X6AJ 1Z3XA 2B7EA 2L02A 3HPSA 5DV5A 1MJ9A 2EIJH 4LF6E 1R4MB 2O0YA 2RDPA 1MBGA 3H35A 2CW7A 3ZR8X 3SQNA 3KYDB 4PJJA 1F9NA 2L2NA 3BJAA 4HV5A 3LNQA 4ASNA 2COBA 2D45A 2DT7B 1XX5A 2D9HA 3I5UA 2PEXA 3G1LA 4LFAE 5A6AA 2CQQA 3FXUA 1U2WA 2XDVA 4HQMA 4I98B 3T8TA 3BQYA 3JU0A 1YX5A 5L3GA 1ZG5A 1ONVA 3M99B 4I01A 4O6JA 1Y39A 1ZRCA 4M2ZA 5KVRA 3S2WA 3Q9SA 3C4TA 3PSIA 2ME6A 4F54A 4S0HB 1XC5A 3S2HJ 2V7FA 1RI7A 3AG3H 3Q0UA 4LF7E 2MH9A 3K1NA 2DDAA 2HNHA 3WG9A 4A3IJ 3AG1H 4A3GJ 3EPZA 5BMZA 2EQ0A 4UXNA 3A03A 4NC7A 1RUNA 4TUGA 2Q0OA 2PMUA 4DR3E 1X2NA 3ADIA 4L8NA 5D4SA 1G3YA 1VQOI 4OIOF 1XSXA 4BJTA 3GLLA 5LGNA 5F27A 5F08A 1N25A 1F2IG 3NARA 2FU4A 4D1QA 3IRQA 5AE3A 3GTKJ 4D5CA 2JA5J 2ECCA 2HZTA 4L9NA 2G7HA 4FASD 4BL0B 5A2QK 2ZMEC 3RI4A 2LUQA 4XQFA 2EFOA 2I9IA 4M3DA 4M74A 4C2TA 4E7ZA 1IXSB 3FKIJ 1R1VA 3H36A 2E7WA 1LVAA 2RTXA 3OR2C 1VQ4I 5HNHA 1PJTA 2V4JC 5DCFA 5GAGJ 1SC7A 1X4PA 3RTRA 4Y13A 2QCOA 3KP3A 1HW5A 4RLQA 1BBYA 1TW2A 5LHHA 2QQBA 1X1CA 3CESA 3W6VA 2XF7A 2DMNA 2L7ZA 5A2QZ 3W2AA 4XOTA 5CVUA 3L2UA 3BC8A 1MSFC 2RVCA 1GZ6A 4RLFA 3WU1B 4FTHA 4L5NC 3S93A 4B47A 2IS2A 3CJTB 2KIMA 3MEXA 5EGOB 4G8XA 2LF7A 4AYBN 4YEJA 5FB2A 2MA3A 2EPZA 4Z2YA 5HLIA 3KLNA 2L2MA 3MD2A 3PJRA 5HOOA 2B0LA 3I71A 4AD9A 4E7SA 1LE8A 2OZ6A 3L2QA 3HTXA 2JPCA 4KHPE 4E7LA 2IEKA 1WKMA 5M3FJ 4UVAA 3C3WA 2KHMA 3LSTA 4BNCA 2VQHA 4FCYA 4GEQB 2UUCE 1IRXA 5J1UA 4A69C 2ZCWA 2Y0MA 2V1UA 1V5EA 1XMQE 5E3LA 2GHFA 2XF5A 1ZH5A 2UUAE 1X2MA 5D5WB 1O0WA 2DB2A 4A3CJ 2L3JA 2YS9A 4N9IA 4JI8E 2B63J 3OYCA 3L1PA 2IGKA 3Q0WA 1N32E 2HHHE 3ABUA 3ZQQA 4J00A 4KZSA 1TW3A 1DGWY 4C3HJ 5ED4A 3BG9A 2RREA 2XUBA 4HEA2 4WFTA 2EZ6A 3CCEI 4LIVA 1A1JA 5HNFA 5GAEJ 5LMUE 1V4RA 1G6NA 2JJ7A 4BE1A 1N34E 4I8OA 1XMXA 5F1JA 2VONA 3R0AA 5GTIC 5M3MJ 1FJLA 4UV9A 4IKFA 2DIXA 2DSYA 1QGPA 1X1AA 4CCJA 3BJ6A 3FMSA 3K7AJ 1UCRA 2UU9E 3EQLF 2HWVA 2YTIA 3RPQA 4U87A 5KL7A 5ICFA 1BR4A 2LY1A 1RNLA 1S72I 2DFIA 2EL5A 2KFDA 2VT2A 4F9CB 1ETOA 1WVRA 2CV0A 1MDMB 3DWLE 2WBTA 4IX7A 2YX4A 1LJ9A 3BT9A 1DQ3A 4BBRJ 2JRMA 3O3KA 4ZYHA 4DR1E 2CUZA 5J8FA 1UHWA 1APLC 1QO0D 1QPMA 4M30A 2NVXJ 2CQNA 1HKTA 4I76A 4JI0E 1WJEA 1EH8A 1EF4A 4IVNA 2OUMA 1JE8A 2FUG2 4I09A 4P78A 1TNSA 3KLOA 3EPJA 1B69A 5EYRA 1J59A 1JKPC 2X48A 3OY9A 2RV8A 5EZHA 2J5PA 4D7MA 4RGSA 2XRLA 4IHXA 4XN0A 1YZ9A 2DDBA 1FJGE 1ZK8A 2CG4A 2G0EA 3GMEA 3QOPA 2O9LA 3D5RC 4CH7A 2EPMX 3E0JB 4R2SA 5DTDA 4MEXF 2QBYA 4PSWA 2E2HJ 3SFZA 2E1MB 4ESFA 4D7NA 2NUEA 3K4MA 3OOPA 1FSEA 3LAPA 1KONA 1IRFA 2FD5A 2VJ4A 4BBSJ 3QOEA 1JKRC 2NABA 2DGCA 1SFKA 3VWBA 2ME0A 4XR6A 5TJJA 4GZNC 1FP1D 4CCKA 4LD5A 2QF7A 1HSJA 3FM3A 3D5SC 3E3VA 5DM7F 2WV1A 4HAMA 2Q8KA 1YYVA 4B48A 1O7LA 3ZRGA 2FMLA 2JT1A 4LGWA 2IJLA 1HC8A 2HR3A 3CCRI 2EOSA 3DKWA 1NG7A 2VF1A 4Z6YA 2QZ8A 2VE7C 3HIFA 1QVUA 3OYGA 2PG4A 3KYCB 4MFEA 1CGPA 1IV6A 4G6DA 1EH7A 2JA6J 3H5RA 4OIQF 3SFIA 2VXDA 3ECOA 2CSHA 2GWRA 2HPIA 2DODA 3DLLF 3PNYA 5LLQA 2KZVA 5GAHJ 2DTRA 2EOHA 1T33A 4OMZA 1W5TA 1T6SA 2N8XA 2CYYA 3DLAA 4XL9A 3VEPA 2I13A 3VFZA 4JI6E 2XAQA 1B4AA 2LDUA 2XB5A 2E72A 1XB4A 1IF1A 2M0MA 1VQ5I 3SEQA 2X51A 4ENMA 2XSDC 2I5UA 1DQUA 2HFHA 5J4VA 3RJPA 3RSNA 1BI2A 1XGNA 1X1BA 2EQRA 3LFKA 1HCRA 2O6GE 2YSPA 2W25A 4NUBA 3RYRA 1ZLJA 3QU6A 2YX7A 1IDYA 4PUSA 4I0AA 4R2RA 2Y48A 3DTKA 2X6WA 5IYDJ 2IHR1 2LBFB 5BOXA 1YW7A 3FK7A 2R5YB 3O8HA 1JHFA 5LHIA 4II2A 4YFXF 1WJAA 4HQEA 1MBJA 1TQPA 4A3FJ 1FOYA 2HXOA 4CO8A 3TDUC 2DTZA 4B8XA 2QLZA 3O2PE 4G6QA 4LK0F 4OIRF 1T4NA 2DK8A 4N4RB 2DFEA 3W2VA 3F6OA 2EV6A 1NEIA 1X3WB 1I3QJ 2EILH 4DBRA 3VB2A 1T38A 1JI8A 1J7KA 1T98A 2HOAA 3S3OA 2FXAA 2MGQA 3OYMA 2AQFA 4HV6A 4E7IA 5A6BA 2IGNA 3ZMUA 3AAFA 5JHUA 3JREA 1U5TA 1TZLA 4GO1A 1WJBA 2MABA 2PMHA 2NVUB 4MNUA 2L54A 2QQ9A 2OPTA 1R7JA 4DQ2A 4KJZA 3C7JA 3MKWB 4GYGA 1K4TA 3QPSA 5J1YA 4HA8A 2KIUA 3RCOA 4Y3OA 5L3BA 1DGRM 3GF2A 4P9UA 3OYDA 3LSIA 2A6TA 4OIPF 3LSGA 3CC7I 4D9JA 4LU9A 3OYIA 4JI3E 3BPVA 3GYHX 4XRMA 2LKSA 3A02A 1NK2P 2A69F 1X1PA 1SFUA 3BTIA 3BOQA 3ASOH 2ELKA 1AHDP 1R9TJ 4LFCE 2P7CB 4U0WA 2P5LC 2EQ1A 4R2EA 4UHTA 2VQFE 1MH4A 2R7OA 4CZZA 2V8QB 1ETQA 2EPPA 4Y15A 3HSRA 3KP7A 3OS2A 1WRJA 5IP6A 2V26A 4UNOA 3TOBA 2K7LA 4C9YA 1PUFB 2QSGX 1P92A 2EIMH 1UZCA 1IXRC 1NG6A 3I64A 3IH4A 1YS6A 5GP9A 3ADGA 1T8IA 2MG4A 4AVPA 3RKWA 5B66C 3FBIB 1BOAA 4Y17A 3BY6A 4I02A 3HDDA 2JA8J 3N97A 4F7ZA 2EH3A 1U6GA 1E3PA 2GLIA 2J5OA 1Z77A 4XLNF 4B3SE 5H20A 1D0XA 4A6EA 3GFJA 3FHNA 1FYLA 2GOMA 2NOJB 4CYDA 1H89C 3O6BB 3EPKA 3I59B 4A93J 3N05A 2WY7Q 2VKHA 3A4CA 2RNJA 4ENJA 4LLNA 4BE2A 4WCGA 3DBLB 4LTYA 5CQEA 5IT3A 1JTYA 2EA2A 4HZFA 1VNDA 1V3FA 1A31A 2L01A 2DMIA 3DF6A 3TKYA 4XM3A 1WZ2A 2STWA 2RKHA 2IT0A 1MMGA 2W84A 5CLSA 1ZELA 2QUFA 4BY7J 4DYQA 5IXMB 2F5CA 3K2AA 2Y69H 2CS3A 2D5VA 4PSXA 1I39A 4UUVA 4DBQA 4Y52J 4JX4A 5J47A 2VBXA 1FYKA 1BC8C 2VBYA 2XPUA 3T5XA 4HTGA 3QWLA 2EK5A 1ZR9A 1VQ9I 2HDWA 4P1WA 1FBQA 1H8AC 4RB1A 1XPXA 2DXIA 4EM1A 2P6TA 2LUPB 5AASA 1ZKGA 2JRTA 3V8KA 2HEOA 1U5TC 4M3EA 2Z16A 2V89A 2NYXA 4WK8F 3F8BA 2ELJA 2L3CA 1R58A 1T08B 4E7KA 2HYJA 4C2MJ 2FNPA 3BLYA 3CUOA 5GTHC 2TDXA 5DYMA 1Y8QB 1IBKE 4FT8A 3RMPA 1K6YA 3HC7A 2N3GA 4B3RE 1R1UA 3K4CA 5HDGA 2D1VA 3SZTA 1B72A 2BXYA 2COMA 2ZJRF 4M3FA 3RPUD 3VDXA 4ABZA 2IA1A 2EMHA 2L92A 1BBOA 1LNWA 2JXPA 1XGMA 3S1QJ 3E5XA 2FEZA 3GZ6A 2PJPA 1O7FA 3E97A 3PIOF 1X6HA 5K5QA 4B3AA 1XMKA 4RDUA 2R76A 3KCCA 4R1HA 1YO5C 3ECRA 2EN1A 2FBKA 2F4OB 2JA7J 3ZN0A 4EVIA 2EM5A 3H5NA 3IWCA 4KMUX 1BM9A 2XAFA 5E1ZB 3JRFA 4XNFA 4F91B 1RC7A 5HS7A 3QPLA 4OMYA 2CMPA 2XAUA 1A36A 4GCVA 1X1DA 2K4BA 4KN7X 3JRBA 1RZ4A 4X9JA 2QQAA 5J1RA 3RZOJ 5ICEA 4D0PA 1N36E 2XSJC 3QYBA 3TQMA 1FP2A 2A61A 3CJQB 4YIIA 2DMYA 2M9AA 2EM2A 3K4KA 3F6GA 1EV7A 3BZ6A 1N75A 4I99C 1W7PD 3EYYA 2DCEA 2R7WA 1JT6A 2DA4A 3B02A 3KYLA 1IAWA 2PJRB 1IJWC 1Z1DA 3P1XA 5A2QC 4DIQA 5EGOA 2OBPA 2R92J 2M8EA 3CTAA 2A6EF 5CVVA 2ZC2A 3IHUA 4NNJA 2JWTA 4XIDA 1MNMC 1EKZA 4IQ4A 3ZOQB 1JUPA 1MNEA 1I50J 1SANA 2VJIA 1ZTRA 3GW2A 3QODA 1LB2A 2EOJA 1GHCA 2L9NA 4W1UA 1S7AA 1ERDA 1FBUA 4DR5E 1VQ7I 3ABTA 1MMNA 1PVEA 4CZCA 4JYKA 2VOPA 3HJEA 2Q8UA 4Q35B 3H9JA 2NS0A 2KOUA 3ERMA 5FD5A 3HOWJ 1ULYA 1IV8A 4HBLA 1XGSA 5D5XB 1X5WA 1RMDA 3ADLA 1ETVA 2DFHA 3HOUJ 4ZJZA 2LREA 1W4MA 1G4DA 2ZSIB 4BBYA 2YTEA 5LD2C 4XN3A 3FXOA 2VKDA 2IXSA 5DUIA 4YIRX 1MJBA 1KYZA 1NHAA 4GGGA 4MEYF 3J7ZI 2EFWA 3GZNB 4P5OA 5LEKA 3U1KA 3TBIA 2WADA 3IP4B 2YU9J 4UY8I 4M0VA 4AC0A 2YTGA 1MBKA 2UXDE 4X62E 2R7SA 1RC9A 2LRDA 2V9PA 1R71A 2EM9A 4NC8A 3SZGA 5LEJA 2DN0A 1RR7A 1ITYA 1WHUA 1BI1A 4JK1X 4HPQA 1O57A 1J5EE 2XKOA 3DQVC 1ZGWA 4OOGC 4IJDA 4O43A 5F0CA 3SZPA 4BQQA 3BCAA 3OYHA 2HOSA 2LTRA 2BW3B 4XLEA 1D8KA 4K2EA 2NVTJ 3KWRA 2GOXB 2LV2A 4XLCA 2R7XA 4M6VA 2O8XA 4ZYEA 4LIUA 1YJNI 4A3DJ 5KL6A 3EDPA 1Z0XA 2MW8A 1FZPB 1IN6A 2FX0A 2KRCA 1LKXA 2RQPA 2CUFA 1S6LA 1XGOA 4L9TA 5EZGA 2DMQA 3V8LA 4X1EA 1BR2A 1MDMA 2CQXA 3PM1A 4EGYA 4HF1A 2R7TA 4YG2F 4DGWB 2EZKA 3OYLA 2KQRA 1XD7A 2WCC3 3WHCA 1BN5A 2EN8A 2KJBA 3KP5A 4RS8A 2NVYJ 2UUBE 3ECHA 3WTYC 3FX3A 3HM5A 2E1CA 4YHHE 4ANJA 5K7ZA 2JPBA 2VC1A 3NRVA 2VT3A 1YYWA 2J7JA 4JYAE 3PFIA 3T8RA 1UFMA 4BDYA 1DPUA 3MHSC 2PBIA 2WBSA 2IA2A 4P9FA 2NUGA 1ZQ3P 1PUEE 2PRTA 3I58A 4R2CA 5JLWA 4JOMA 3JRGA 1OCPA 2M1BA 5L3DA 3OMLA 1IO2A 1FWZA 3DEWA 1WJFA 1R5GA 5EF6A 2E1MA 4IXAA 3OS0A 2EN6A 2EZLA 3BTLA 1O3SA 3BR2A 2EMZA 3FM5A 5K1YA 4DJAA 1OQYA 2IGMA 2K5CA 3T0YA 2V83A 4F55A 2YU3A 5TRDA 1IXCA 3IRRA 3MCZA 2VRDA 4BH9A 3BTCA 3TW6A 3CCUI 5CVIA 3VSKA 2R7VA 3G4SI 4N9HA 1LFPA 2JN6A 4DYRA 2VQEE 4ENKA 1B9NA 5F0FA 3QYFA 2YTDA 2EMGA 3TO9A 3J7AY 6PAXA 2ICWG 3I4NJ 2F5VA 3N4MA 3AV0A 2Y2ZA 1MH3A 2O03A 3IKTA 1GVJA 3F22A 4O5GA 4XLPF 4LK1F 3JTHA 3OS1A 4E6KG 2DMTA 1S7OA 2VE8A 2FQ3A 2JZYA 2DT6A 3D5LA 4F3QA 2YTNA 4I0BA 1FPQA 4PGHA 2LY9A 3MVPA 1JUSA 3KEYA 1GTKA 2EPOA 3M8EA 1U3EM 2DA5A 2NS7A 3CCLI 2UXXA 2KZGA 3ULQB 1R4NB 3EYIA 4IQJA 4LG0B 1FTTA 4AIDA 2ZJPF 4BAYA 3OSGA 5D5UB 3M8JA 4MQ9F 3IWZA 2FSWA 4MO7A 2NXNB 5IOZA 2M8GX 2LBFA 3HOZJ 3K0LA 2LE2A 1GT0C 2Y31A 1PKPA 1GV2A 1UG2A 2P5KA 2E2JJ 3GWZA 1I94E 3VYTB 3AL0C 3K6QA 1ORKA 5GPCA 2JMWA 4KA4A 4IPAA 4YFNF 4EJTA 3MZHA 2CT1A 4ZC3A 2B9DA 1T4OA 1TWCJ 1OMIA 4XRFA 4BQNA 1NTCA 3FXJA 1X3CA 3JSOA 3GO5A 2CJJA 2UZKA 4EM2A 1QNTA 4KDPA 3HKZA 2EBIA 3S3NA 4B3XA 4TUIA 2R7RA 1FLIA 5F04A 5DD8A 1W36C 3WTWC 2R3SA 3MN2A 1IG7A 2DLLA 3AUZA 1HA8A 2LNBA 4R8OA 2O7OA 2HZDA 2DPDA 3ZQCA 2PMZN 2W48A 5DCMB 3JTGA 4AUXA 3HOYJ 3J7Yp 4BHBA 2RGVA 2EE8A 1W0UA 3IKVA 4C3IJ 2YRHA 2FQ4A 1YHQI 4BQOA 4RAGA 3MQ0A 1FY7A 2E1MC 1OCTC 1CF7B 1S5LC 4WXHA 5TSEA 3S15J 2DA1A 4DNCA 1A6QA 1FBSA 3QPTA 4P96A 1ENHA 3I0TA 1B1BA 3H9QA 4EV0A 3ABMH 3A2KA 3ZXSA 4O3MA 1RETA 1T0FC 2QKMB 2H36X 1V54H 2FJ1A 3TOAA 1IUYA 4EJWA 4B43A 1AKHB 3DKXA 2KLOA 1PUFA 1MZBA 1S8NA 1G2DC 1P7IA 1D1BA 1QVTA 3LAJA 4NZVA 2DRPA 3ZQ7A 3Q0VA 3M9AA 2GBYA 2V1NA 4XKVA 3DBRB 3QU3A 3JR9A 4C2UA 2W7NA 3QRFF 2XC7A 1K4SA 1NCSA 2YPNA 4H0EA 3H3ZA 1E3OC 4F6NA 1YSAC 4DKKA 4WWCA 1K79A 4IHYA 2GIVA 3J7AO 1UILA 2ETHA 3CUQB 2LVHA 4JQFA 4LB6B 2EOOA 4EJUA 1G2HA 4IHSA 1MKMA 3ABKH 5HVQC 2KPMA 4S05A 2R93J 5AIQA 1B8IA 2EPLX 1YG2A 1IQOA 1POGA 2GPIA 3VHTB 3S32A 3M4OJ 2LMZA 4FHTA 4HSTA 2BVMA 5FLXZ 4HDVA 5FRNA 2YR2A 1SMTA 1U0JA 2JTVA 3M07A 1W5SA 3I59A 1ODDA 4IF4A 3WE3A 3W6KB 2LCEA 2BBGA 1ON1A 2VPRA 3BZKA 4L9VA 2FF4A 2OCEA 3ONQA 1BA5A 1RESA 1JK2A 3ASNH 1P4XA 5J6XA 3EUAA 3G6EI 4EJVA 3DPUA 3ML6A 3OIOA 5H6QA 2CPNA 2Z1DA 3C18A 2RNGA 1TQMA 1WFXA 2VC0A 3OYNA 2QENA 3DBHB 3S8PA 2D2WA 1ETKA 2YTPA 2YWQA 1WPKA 3CP8A 3VOEA 3LSPA 1MEYC 2GAUA 1R6RA 5ILUA 4Q47A 2PX9A 3RYPA 2EPRA 3ELKA 2IVMA 2YT4A 2EA4A 3VYSB 4I7HA 2NOGA 4RAYA 4DV6E 1X6FA 1XNRE 1BJAA 5TISC 2JUCA 3HL2A 3F8MA 3LMMA 1DUXC 3S2DJ 5J8CA 3S1NJ 4QLCU 1DPRA 2K85A 4DW6A 4A0YA 3LFUA 1OCRH 1WJ5A 1TBXA 2DA6A 2WAQA 3LWFA 4A6DA 1YJWI 4XSZF 5D5VB 4A3MJ 2LLKA 2FTXB 3OWTA 4AQYE 1USSA 2WWYA 4IHVA 3ZP5A 2RPCA 3E6DA 3WGGA 5DM6F 4LF9E 5H6RA 3ADJA 3OTOE 4HX7A 2DPUA 4BXXJ 4RM3A 3NWSA 1ZRFA 1TN9A 2JK3A 1SFXA 1Y8RB 1YI2I 4KIBA 4BHCA 4QSHA 1WI3A 2AXTC 3G1MA 2VOOA 3AFHA 3IV5A 2HPMA 3JAMZ 1GXQA 1Y0NA 3VODA 3PUBA 1E17A 3FMQA 1W5CC 2BZTA 4E4HA 2MBFA 3GUDA 2STTA 3CCYA 2E5ZA 4R8HA 2EOEA 4DUZE 1T4LB 3CCQI 1X3ZB 2UV1A 3LSKA 1WJCA 3ZMZA 2DQRA 2HQ5A 3DEEA 1Y1WJ 1AOYA 3L2WA 4JP0A 2HTSA 4PDKA 2H27A 4A3JJ 4IEJA 1FSHA 1RKTA 2EN7A 5K7HA 2GA2A 1H88C 1TC3C 2WB1A 1YIOA 1A1FA 5A69A 1YUJA 2HDCA 2ACJA 1MMSA 4Y33A 2OA4A 2PJRA 2ID3A 2EPUA 5BR8E 2UXCE 2CSOA 2Z5UA 2CRGA 3HGYA 5L3FA 2Y30A 2E34A 1KA8A 5L3EA 2DMPA 1LUJB 4CCNA 3PNVA 3X2QH 1JJ8C 2UWMA 3NQOA 4JI7E 2BY2A 1G3SA 2ZKZA 1TT5B 5LHGA 3MKZA 3CMMA 2PQ8A 4JI2E 4F9BB 3BG7A 1J09A 2H6CA 3UR3C 4ETSA 4RH8A 3GTJJ 3T1HE 5E8IA 3SHFA 4AVZA 4Y7NJ 3JRDA 1K83J 1UELB 1ETWA 3QPHA 4V2FA 1PJRA 2X0LA 3Q3SA 1SFEA 3FK6A 4LG3A 1PP7U 2E5LE 2E71A 2L7KA 4FK5C 3K10A 5AC5A 1MD0A 3FDYA 1BC7C 4HLXA 1D1AA 3WGIA 3IC7A 4ZZDA 2EL6A 3OSFA 2VB6A 1SD4A 2M45A 3GCMA 3GEZA 1R1TA 2V1XA 1AA7A 4DV7E 2CQ7A 4HF2A 3IH2A 3P5JA 4HRIA 3RQ4A 3REOA 1PP8F 1YPNA 5A6JA 3ZPLA 2YUSA 3R6SA 3OYKA 2P5VA 2EMAA 2MDRA 3F6VA 4KMFA 2A5YB 4HG2A 1UB9A 1L0OC 2L7FP 1JGGA 2OZUA 1ZARA 1ZLKA 1DP3A 1E3HA 1WH7A 3HOVJ 4M6XA 2KIQA 4BEHB 4F93B 1YJ9I 1JT0A 4OAYA 1SD5A 2LR8A 1Q1HA 2OAZA 1F36A 1Z7UA 2BW3A 4WXCA 5FFXA 3CMEI 4F52A 3GZ5A 2GXGA 2HC5A 3KIOA 1KJKA 1U8BA 5E3OA 3UKGA 2JA2A 4U88A 2K86A 2DOEA 3FF5A 3G1OA 4MTDA 3E6MA 2VODA 1STZA 3F8NA 2VPLA 4HNTA 4RMNA 2M4KA 1OR7A 3GVAA 2A05A 1BOBA 5E79C 4L0YB 1KYQA 3PQJA 4I2OA 2VQLA 1FKAE 1OYWA 2LYCA 1I1SA 4BACA 1DU6A 2HOEA 2FOWA 2LP0A 1P9QC 2BY1A 3CMYA 2CUJA 1JKOC 1HKSA 2LY2A 1IQSA 4IHTA 3I54A 4JBAA 4PJLA 1AH5A 4PJNA 2ESNA 3EPHA 5AONA 2R5ZB 3BR1A 4G12A 5KK1A 3S1MJ 3HPGA 4BS9A 1UG0A 2ZNYA 1P7JA 1EJ9A 4GRIA 5J40A 4OAZA 1YS7A 2UXNA 4AM3A 1X58A 3LA7A 1I5ZA 4RHBB 4PZJA 1VF9A 1IN7A 2HQAA 2EFPA 3H9GA 2KDZA 2EMBA 2MDGA 2F2EA 1VQKI 1PDAA 1U9NA 3BCBA 2K9QA 4G94A 1YTYA 2NAZA 2F4VE 5HS9A 4DV4E 1VQNI 1XMOE 1O3RA 2EINH 2RC4A 1K6OA 3FIWA 3PQKA 1IW7F 1WJDA 4XLFA 4XRSG 1O4XA 4O4KA 1HLVA 1KU7A 3EQ1A 4CHUA 2MD5A 3CDHA 4IRHA 4DYCA 3EUHA 2Y75A 2M7AA 2H09A 3EUKL 5A6BD 1MBHA 2GM4A 1X6EA 2BV6A 3OMYA 4NB5A 5BNGA 1XNQE 1HXDA 2KHXA 4IOAF 1IRZA 3HOSA 3V7CA 5JVGF 4E7JA 3CDLA 3H92A 3C2GA 2LVSA 2XPWA 2RN7A 4DMIA 2MKNA 4EATA 2W24A 2X1EA 5B1BH 2F5DA 5BS6A 2R7DA 5T6JA 4WF2A 2LF8A 1BBGA 2L33A 3GX4X 2KP6A 1W1WE 4XORA 5KAIC 4NBQA 4CXFA 1KGSA 2RQQA 3F21A 3LA3A 5D8KB 3K2ZA 2JWOA 2EM3A 2MH2A 4RAFA 2G9WA 2XPVA 2Z99A 3J80K 1BW5A 2HVRA 4DV2E 1BIAA 1OPCA 2CW0F 4PGGA 1L3LA 1RR8C 4PFOA 2G7UA 2L0KA 1YW9A 1LDKB 3DTIA 4DV5E 1D0YA 5FFZA 1WXRA 2KJCA 3F8CA 4UB8C 4B4CA 4DZJA 4L0ZB 4FX4A 4LG0A 1QHHD 2GIZA 2WY8Q 4LJZF 1XDSA 2QSFX 1FC3A 2EWNA 3BDDA 2M1SA 2M4GA 2ZXJA 4RB3C 3H3UA 4ZDOA 2HDDA 1G8XA 4IRGA 3J80Z 1YIJI 3WTUC 1JK1A 3G71I 5K5OA 2FGGA 2MLGA 2ENAA 4XRSA 5E1WA 3OYBA 3LSHA 4KT6A 1O3QA 4BKXA 3PIPF 2F48A 3HEFA 1IUFA 3M8FA 2VJ5A 2XF6A 5KL5A 1J2XA 4XMYA 1R00A 4NXME 2IPQX 2KISA 2K9MA 3ZN1A 2EMCA 1ZRDA 3VYXA 1IN8A 4R2PA 2EWLA 1Z6RA 2K9LA 3S3MA 2HYFA 5DDGA 4CYCB 1OCZH 3CO7C 1WQ2A 2E19A 2B3TB 4PJMA 3V7SA 4ZYDA 1P2FA 2WBUA 2JSPA 4UB6C 3SDGA 1VFCA 2YZTA 1EA3A 4RGUA 5FO5A 1VQMI 2L9RA 2XVCA 2VUMJ 1U8RA 3ZQFA 1OKRA 2YTJA 3HRUA 3DCFA 2WZOA 4XICA 1JXSA 1TT0A 1SEUA 2X1CA 3B6AA 2HYGD 2V87A 2ISYA 4CICA 2ENCA 5IYBJ 4BY1J 1A1KA 3SXYA 2K7IA 2DMUA 1Y56A 2GLOA 2HI3A 2MD0A 1CF7A 2XGDA 1E2XA 3F0CA 3U21A 1O3TA 3A1YA 4LMYA 3HG9A 3EUHC 3ZGKA 5DD4A 3IAS2 1F4KA 1LFUP 2EOYA 4GXOA 1LVKA 5IT9Z 1J75A 3COAC 5DNYA 1HW2A 2LT7A 4IOCF 2EM0A 3DPTA 5E1XA 3WTTC 4BYYA 2M7BA 2OD5A 3I56I 3GTGJ 4DR7E 4HEIA 4B44A 1UAAA 2H8WA 4B09A 1ZYRF 3CC2I 2LH9A 3FMRA 4Q4ZF 1WI9A 2YTFA 3LA2A 3NEUA 2M4IA 2EN3A 2HXIA 2MYSA 3V8JA 2N3HA 2ZJ2A 3FXKA 1KZHA 2JSCA 5B3SH 1G3TA 2FBIA 3QYEA 5FGMA 3CUQA 4KISA 5LGTA 2W85A 5A6KA 1BI3A 2L9VA 2QM3A 3JRAA 1J9IA 4BC7A 2LBSB 2PI0A 1IN4A 1TWFJ 2A07F 2VI6A 1MBFA 4A3KJ 1WJPA 1PJSA 3RDIA 2LFBA 2CFXA 4YRVA 2BY3A 1SVLA 3I55I 4LFUA 3BROA 3IUOA 3RQIA 2M34A 2DLKA 5HLTA 2K4JA 3CQZJ 1BL0A 1BW6A 1TL8A 1YLFA 2X9DA 2V79A 4PJ0C 1N33E 2H94A 4RM2A 4HLYA 3PO3J 4A2UA 1D3YA 5LGUA 3K70C 3HPZA 1TF6A 4ZYAA 5FLXC 1K7AA 1FOXA 2ZO4A 2XB0X 2H1LA 4G7OF 1XSVA 1P6RA 2JPAA 1WH5A 3BG3A 3DF8A 3DP7A 1MSEC 1KQ8A 1GQEA 1DP7P 2YPRA 2ISZA 4L5IA 4MLVA 2FRHA 4ZDPA 2L4MA 1IMUA 1SVOA 3U2RA 2L2KB 2DBBA 2V85A 2DJNA 4A0XA 4M9ZA 3E6BA 2R4GA 1N78A 3HRMA 2QVOA 2XGCA 2DQLA 2IAIA 1Z05A 1AAYA 3DFGA 4UVBA 5HLGA 3FKJA 2VKVA 4DOZA 1Z91A 2VIXA 3FHZA 5FKNA 1FOWA 1SAUA 4PCQA 3V4GA 2BHYA 3HYIA 2KT0A 4EGZA 2IS4A 3TW7A 3BP8A 1YITI 5CVJA 4QIWN 4R79A 1SR9A 2E35A 2V86A 3D0SA 1BR1A 3R4KA 1A5JA 4HYEA 4FE7A 4M3BA 5AE2A 2I10A 1HKQA 2M7QA 3CLQA 4DV1E 5LBQA 1U78A 2L8TA 3RKYA 3GTPJ 2EJRA 1U5TB 4XONA 5ADZA 3J81Z 3BR0A 2LKXA 1MNDA 2JYAA 4I6ZA 3IWFA 3TDZC 2UXBE 3H5AA 5DUKA 2DYRH 3MMYB 3HZJA 2YRKA 3CF2A 3PFYA 4G7ZF 3BR6A 3WODF 2XAJA 1JJ6C 4M9XA 1JGSA 4FQGA 1QA6A 2HTJA 2NVQJ 2IS1A 3JAMC 3QQAA 1UN6B 4GKKE 1GVDA 1TQIA 4AYBA 3E5UA 4MIMA 1J5YA 5FROA 4CCMA 2LK2A 2V9KA 4RGXA 2EL4A 3AG2H 4KICA 2R7ZJ 2Q2EB 4KUMA 3KFWX 4IZZA 4AWXB 3L2VA 1GV5A 3C1DA 1Y0UA 2IW5A 1S9HA 3HUGB 2AS5F 2Z3YA 2OTJI 3MSWA 2CFOA 2JVAA 1I1GA 4AIKA 4KYWA 4U7DA 3GTMJ 4G7HF 4WXDA 4LF4E 2QGUA 2X6OA 3S17J 4R2DA 1P47A 3QAHA 2M0CA 1ZN2A 3H0DA 2P8TA 1XS9A 5FKKA 1W36D 5IPAA 4ENNA 4LLGF 4E7HA 4L9JA 3GXOA 3K69A 3KZYA 5KCMA 3UNGC 2HQRA 1OJLA 2LO3A 1MMAA 2KKOA 3BPXA 2P81A 4G6TB 3ZQLA 2H8RA 5ILSA 3G2BA 3H09A 1TP4A 4BE0A 1RRJA 2V9VA 3BQZA 1ZAAC 2VL8A 4W97A 4XLAA 4J01A 4ITVA 3S14J 4A5MA 4KITB 9ANTA 3L2CA 4X64E 4QPQA 1ZR2A 2QKLB 2EPCA 2B7TA 1X4OA 2CH0A 3Q5FA 3G73A 2I8DA 1K78B 1T39A 4UUSB 2OQGA 4MGRA 4XOPA 4CDGA 3VPRA 2R5YA 4X8WA 2KDOA 3S16J 5EDNA 5FLVA 4RB2C 3CF5F 1S29A 1XG1A 4EQQA 2KIFA 2EJ4A 3TO7A 2MC6A 2TCTA 4R03A 3V7RA 2FA5A 3FZVA 4BEHA 3HBLA 2OTLI 3KP4A 2EM8A 2EPXA 4R2AA 3DKYA 1TWHJ 1A1HA 2EB7A 1JKQC 2DA2A 2MFZA 4JI5E 3OR1C 3NWTA 1BI0A 1HDPA 2ID6A 4D5FA 1JUMA 3R60A 1XN7A 1EH6A 2HKOA 1DU0A 2ODRD 2ZM6E 4P55A 3RIRA 3A01B 3CJRB 2JY9A 3GFIA 3TEDA 1W7PB 2XV4S 1QHGA 5CKTA 3HRTA 3K9TA 4UV8A 3F72A 2H6BA 1QBJA 2RAEA 1BB8A 2KMUA 2N8GA 2Z9OA 5LL6R 5LRRA 2R5ZA 2W82A 2EM4A 5C44J 1GLNA 1YW8A 5EG0B 2R0QC 1FX7A 1B72B 2EMKA 3VYYA 5EEGA 1STUA 2VE9A 2CV2A 4HOBA 1IZ1A 4XSXF 2ENHA 5ILVA 5HODA 2KONA 4ZZLA 1ZGAA 1VZ0A 1R22A 2XGEA 2HS5A 2JP9A 3PO2J 5E3NA 3JRHA 3KX2A 3JRIA 3L9FA 4Q28A 1LDJA 2EV5A 2EIKH 3JRCA 4YIFA 3TO6A 2GZWA 5EJCA 1UBDC 1WHQA 1N77A 1R23A 3GLXA 3JCUC 5AIPA 2BGCA 3PNTA 3TGNA 5FLXK 4WPYA 5CJ9A 2R1FA 4WYQB 5HDNA 4IRIA 2DA3A 3BG6A 4R2QA 1VQ6I 1D8JA 2ECBA 5B5EC 4ZH4F 2CUEA 4KIFA 3OIQA 2ODRC 3LSMA 1QZZA 4EEFG 2Z2SB 3JTZA 2K9SA 1B6AA 3OL4A 1FMWA 1ON2A 4AU7A 4RA2A 5CYVA 3UK3C 1BJZA 1T56A 2XRNA 3BWGA 1ACIA 4A3EJ 2O8KA 1ZU1A 5FJ8J 2CQKA 5E3MA 3RKQA 3HOXJ 3IH3A 1ZG1A 2EQ3A 2BOLA 2DYSH 1K61A 3FIGA 4QPOA 4LF5E 2B7VA 3HSFA 1VQ8I 1MW7A 1HSTA 5JI6A 2VQGA 2NRAC 2FMYA 4A3LJ 5LRSA 4YELA 2VQCA 1HQCA 2E5NA 1A04A 3TMOA 4U0YA 3H0GJ 2EPNA 5KL2A 3CZ6A 1MMDA 4J19A 4BDZA 2L4AA 3BZCA 5JLXA 2X4HA 5HS8A 5KAFC 5FLMJ 3WTXC 3L2RA 3GTLJ 1H0MA 2JR1A 5F1RA 2EFNA 2LTPA 3KP6A 1B9MA 3ZMVA 1GDTA 1OFCX 1RPWA 5D6FA 3OYFA 2JVGA 4HX8A 2OF7A 5F64A 3OL3A 4LLLA 4A12A 1VQLI 2VLAA 3F9KA 2HQNA 4L5JA 3AG4H 4N4NB 1ZBQA 3E6CC 5KL3A 4ZTJA 2FOKA 4M3GA 2JVHA 3FISA 1PYVA 1VI0A 4L5EA 4Q5SF 2EPAA 4N4OB 3RKXA 3KP2A 3VYRB 2JQ7A 1YX3A 4HNUA 1H9TA 1QZYA 2F4IA 1L4SA 1SD7A 2BXZA 3T1BA 3JAMK 3O8GA 4IS1C 3THNA 4GYIA 3J80C 2DK5A 2OJED 1HOMA 3CC4I 4P7DA 5CQGA 2FNAA 5M5XJ 5C4JJ 2ZBKA 3B73A 3OV8A 2YRMA 2A5WA 3WTZA 4OINF 3WG7H 4CYCA 1FMVA 2HGCA 5IP7J 2BYVE 3KPHA 4HDUA 3AL0B 1KU3A 3TP0A 4A5NA 1XSDA 2PLYA 2EMFA 2DAOA 2HVSA 1YUIA 5GPAA 3MZ8A 4NHJA 3ZMSA 4BJ6C 2LG4A 2L2OA 2M3AA 2K4VA 3ZQGA 4CA0A 1MIJA 1IRGA 3OYJA 2R7FA 5JR3A 3HKZN 3MHHC 3CCSI 2ZFUA 3CCJI 2LSOA 1MBEA 1G2FC 2JOXA 2OCCH 5LMNE 1R49A 2MC5A 4X65E 3T1YE 5JVTA 2YSOA 3IWDA 2F5EA 3DU5A 4QWQA 3C6MA 3IWBA 2ZMEB
chains in the Genus database with same CATH topology
1KU9A 2XROA 1SD6A 4A0ZA 2XAGA 4M71A 1J0RA 4M9SA 4M73A 3F3XA 5D8LB 2MC3A 2P6SA 2MLKA 4EMSA 3W6JB 1OYYA 2ADUA 4U7BA 4BHPA 1ZG3A 4HX4A 1LEAA 2K27A 4MQVA 3HOTA 4L18B 4BXUA 1HW1A 1TTYA 2K02A 3DPLC 4RGRA 4KNYA 1ZREA 4KT5C 3I4PA 4AIHA 4ESBA 1H9GA 2CO5A 2DO7A 1RIOH 4BQAA 3QP6A 4CGZA 2XAHA 3QP5A 5ERIA 2XASA 2IRFG 2IP2A 3E5QA 3DXJF 2AXLA 1LEBA 3KE2A 3ISPA 2ZNZA 3M7GA 1QQIA 2FE3A 3KZZA 3MFKA 3HRSA 4RAZA 5E20A 3Q9VA 2KRFA 4LB5A 1FT9A 2E1NA 3FXRA 2ELHA 3HHHA 4MHGA 3K1PA 2M5WA 4KFCA 2XHKA 3I53A 5BQTA 2GQQA 1DDNA 3IL2A 2M30A 1FYMA 3P9CA 1RUOA 5HDKA 1T2KA 3FWEA 2BEOA 2Q2EA 1P4AA 3ZMDA 1XCBA 2CGPA 3HUGA 2A68F 3BJOA 2IA0A 1YQAA 4S04A 2YSRA 3L00A 1ZHFA 3L09A 2BE5F 1MJAA 1B59A 2VXZA 2XIGA 1USTA 1KU2A 4OU0A 2XKPA 3ROUA 5ICGA 1XMAA 3HSEA 2DI3A 2C6YA 2CWEA 1R5HA 1REPC 1KQ9A 4ESJA 3RPUA 2DU9A 5FD6A 3JW4A 1D5VA 2V1DA 4E70A 2PN6A 5EEHA 1K78A 5BPIA 5K5RA 5BPDA 3DV8A 2GA1A 1TLHB 5CVRA 1F5TA 5L3CA 2NNNA 3GFMA 3KEQA 1WSUA 1VTNC 4UVCA 1YFHA 4O5VA 2OQRA 3K1MA 2E7XA 1W7PA 3WTSC 3M1EA 2Z33A 5IT9K 5DCMA 3WU0A 2DT5A 4KN4X 1X3UA 3ZMTA 2EV0A 3WTVC 1KQ0A 3CLOA 3KEOA 2D1HA 1LDDA 2NNYA 2XGXA 1S3JA 2QBYB 4M72A 5E8GA 3MZYA 3HTSB 1GXPA 3L7WA 3F23A 3P7NA 3HTUA 3HHGA 4M6YA 2VBWA 1JHHA 2WC2A 2O61A 2FBHA 1G3WA 2QWWA 4ZYGA 2GXBA 2V6CA 3LQQA 4KIGA 1OYIA 2EFQA 1XDUA 3CO6C 4MTEA 3MAJA 1AWCA 1BIBA 3WE2A 4HF0A 3MWMA 1F1ZA 1I27A 1KYWA 2ESHA 2OU2A 2LKPA 4IJAA 2ZFWA 4TV7A 2QYOA 2P7VB 5E17F 3JSPA 4U0VA 3J81K 1SAXA 3U9GA 1ZAOA 4G9YA 2L3DA 2DW4A 5JFRA 3F8FA 4EJOA 3DEUA 3GFLA 3WGHA 5D6EA 3R0JA 4FX0A 3ERED 1Z6TA 1WWXA 2VN2A 2O3FA 2M87A 4OOIA 2WTEA 1Z9CA 4RB0A 5ICCA 2A6HF 5HLHA 2F5FA 2ZMEA 4Q48A 3U1DA 3P9IA 3CJNA 4EM0B 1ZGJA 2WV0A 3R61A 1LQ1A 1HBXG 2PFBA 3CUQC 1FNNA 4WX9A 3FXQA 5F6FA 3P9KA 1XCVA 4ON0A 1SMYF 4HW0A 3EETA 4AIJA 1IN5A 2P4WA 1R36A 2W57A 1T0FA 2VBZA 5DEQA 1I6XA 1FOKA 4YFKF 3G3ZA 4NQWA 1TNTA 1PDNC 3TQNA 2A3SA 1MGTA 2HKXA 3KETA 5D4RA 1P4WA 4N0BA 4XBFA 3LQRA 5E18F 2BBYA 1C0WA 1UHMA 2L02A 5DV5A 1MJ9A 2O0YA 2RDPA 3SQNA 1F9NA 3BJAA 4HV5A 4ASNA 2D45A 3I5UA 2PEXA 3FXUA 1U2WA 3T8TA 4HQMA 4I98B 5L3GA 1ZG5A 1ONVA 4I01A 4O6JA 1ZRCA 5KVRA 3S2WA 3Q9SA 1RI7A 2MH9A 3K1NA 3WG9A 5BMZA 4UXNA 1RUNA 2Q0OA 2PMUA 5D4SA 1G3YA 4OIOF 1XSXA 5LGNA 2FU4A 3IRQA 4L9NA 2HZTA 2G7HA 5A2QK 3RI4A 2EFOA 4M74A 1IXSB 1R1VA 2E7WA 1LVAA 5DCFA 3RTRA 4Y13A 3KP3A 1HW5A 5LHHA 1BBYA 1TW2A 2QQBA 5A2QZ 5CVUA 2RVCA 3WU1B 2KIMA 3MEXA 4G8XA 2LF7A 5FB2A 2MA3A 4Z2YA 5HLIA 3KLNA 5HOOA 2B0LA 3I71A 4AD9A 2OZ6A 2JPCA 1WKMA 4UVAA 3C3WA 3LSTA 4BNCA 2ZCWA 2Y0MA 2V1UA 1ZH5A 5D5WB 4N9IA 3ABUA 1TW3A 5ED4A 2XUBA 1V4RA 1G6NA 2VONA 3R0AA 4UV9A 1QGPA 3BJ6A 3FMSA 1UCRA 3EQLF 2HWVA 3RPQA 5ICFA 1RNLA 2DFIA 2VT2A 1MDMB 2YX4A 1LJ9A 3O3KA 4ZYHA 5J8FA 1UHWA 1QO0D 1QPMA 1HKTA 1EH8A 4IVNA 1JE8A 4I09A 1TNSA 3KLOA 1J59A 2RV8A 2J5PA 4RGSA 2CG4A 3QOPA 4MEXF 2QBYA 3SFZA 4ESFA 3OOPA 1FSEA 3LAPA 1IRFA 5TJJA 1FP1D 4LD5A 1HSJA 3FM3A 3E3VA 4HAMA 2Q8KA 1YYVA 1O7LA 2FMLA 2JT1A 4LGWA 2IJLA 2HR3A 3DKWA 2QZ8A 3HIFA 2PG4A 1CGPA 4G6DA 1EH7A 4OIQF 3ECOA 2GWRA 5LLQA 2DTRA 4OMZA 1W5TA 1T6SA 2CYYA 3VEPA 3VFZA 2XAQA 1B4AA 2LDUA 1XB4A 1IF1A 4ENMA 2HFHA 3RJPA 1BI2A 1XGNA 3LFKA 2O6GE 2W25A 3RYRA 1ZLJA 3QU6A 2YX7A 4I0AA 2Y48A 5BOXA 1YW7A 1JHFA 5LHIA 4YFXF 4HQEA 1TQPA 4CO8A 3TDUC 4B8XA 2QLZA 3O2PE 4G6QA 4LK0F 4OIRF 2DK8A 3F6OA 2EV6A 1T38A 3VB2A 1J7KA 1T98A 2FXAA 4HV6A 3ZMUA 3AAFA 5JHUA 1U5TA 4GO1A 2PMHA 4MNUA 2L54A 2QQ9A 1R7JA 4DQ2A 3C7JA 4GYGA 4HA8A 2KIUA 5L3BA 3GF2A 4P9UA 4OIPF 3BPVA 3GYHX 2A69F 1SFUA 3BOQA 2P7CB 4U0WA 2P5LC 4UHTA 4CZZA 4Y15A 3HSRA 3KP7A 1WRJA 4UNOA 3TOBA 2K7LA 1P92A 3I64A 1IXRC 1YS6A 4AVPA 3RKWA 1BOAA 4Y17A 3BY6A 4I02A 3N97A 4F7ZA 1U6GA 2J5OA 4XLNF 5H20A 4A6EA 3GFJA 1FYLA 4CYDA 3O6BB 3I59B 2RNJA 4ENJA 4LLNA 4WCGA 5IT3A 2EA2A 4HZFA 1V3FA 2L01A 3TKYA 2STWA 2RKHA 2IT0A 2W84A 5CLSA 2QUFA 2F5CA 4UUVA 2VBXA 1FYKA 1BC8C 2VBYA 3T5XA 2EK5A 1FBQA 4RB1A 4EM1A 2P6TA 2JRTA 3V8KA 2HEOA 1U5TC 2NYXA 4WK8F 3F8BA 1R58A 2FNPA 3CUOA 2TDXA 5DYMA 4FT8A 1R1UA 5HDGA 2D1VA 3SZTA 2COMA 2IA1A 1LNWA 1XGMA 3E5XA 2FEZA 3GZ6A 2PJPA 1O7FA 3E97A 5K5QA 1XMKA 3KCCA 4R1HA 1YO5C 2FBKA 3ZN0A 4EVIA 4KMUX 1BM9A 2XAFA 5E1ZB 5HS7A 4OMYA 4GCVA 2K4BA 4KN7X 1RZ4A 2QQAA 5ICEA 4D0PA 1FP2A 2A61A 4YIIA 1EV7A 3BZ6A 1W7PD 3EYYA 1IAWA 3B02A 1Z1DA 2OBPA 2M8EA 3CTAA 2A6EF 5CVVA 3IHUA 3GW2A 1LB2A 1GHCA 1S7AA 1FBUA 3ABTA 2VOPA 2NS0A 5FD5A 1ULYA 4HBLA 1XGSA 5D5XB 1W4MA 1G4DA 5DUIA 1MJBA 1KYZA 1NHAA 4GGGA 4MEYF 2EFWA 4P5OA 5LEKA 5LEJA 1BI1A 4JK1X 1O57A 2XKOA 3DQVC 3SZPA 1D8KA 4K2EA 2O8XA 4ZYEA 3EDPA 1FZPB 1IN6A 2RQPA 1S6LA 1XGOA 4L9TA 3V8LA 1MDMA 4EGYA 4HF1A 4YG2F 1XD7A 1BN5A 2KJBA 3KP5A 4RS8A 3ECHA 3WTYC 3FX3A 2E1CA 2JPBA 2VC1A 3NRVA 2VT3A 3PFIA 3T8RA 1UFMA 1DPUA 2PBIA 2IA2A 4P9FA 1PUEE 3I58A 2M1BA 5L3DA 1FWZA 1R5GA 4IXAA 1O3SA 3FM5A 5K1YA 3T0YA 2YU3A 5TRDA 1IXCA 3IRRA 3MCZA 4BH9A 5CVIA 4N9HA 4ENKA 1B9NA 3TO9A 6PAXA 3N4MA 3IKTA 2O03A 1GVJA 3F22A 4XLPF 4LK1F 3JTHA 1S7OA 2VE8A 2FQ3A 2JZYA 3D5LA 4I0BA 1FPQA 4PGHA 3M8EA 1U3EM 2UXXA 3ULQB 3EYIA 4LG0B 4BAYA 5D5UB 4MQ9F 3IWZA 2FSWA 3K0LA 2P5KA 3GWZA 4KA4A 4IPAA 4YFNF 4EJTA 3MZHA 1OMIA 4XRFA 3JSOA 3GO5A 2UZKA 4EM2A 1QNTA 4KDPA 1FLIA 5DD8A 3WTWC 2R3SA 2DLLA 2LNBA 2DPDA 5DCMB 3JTGA 4BHBA 2RGVA 3IKVA 3MQ0A 1FY7A 1CF7B 4WXHA 4DNCA 1FBSA 4P96A 3QPTA 3I0TA 1B1BA 4EV0A 4O3MA 3TOAA 1IUYA 4EJWA 1MZBA 1S8NA 3LAJA 3ZQ7A 3M9AA 3QU3A 3QRFF 4H0EA 3H3ZA 4WWCA 1K79A 2GIVA 3J7AO 2ETHA 3CUQB 4JQFA 4LB6B 4EJUA 4IHSA 1MKMA 5HVQC 4S05A 5AIQA 1YG2A 4FHTA 5FLXZ 4HDVA 2YR2A 1SMTA 2JTVA 1W5SA 3I59A 1ODDA 4IF4A 3WE3A 3W6KB 1ON1A 4L9VA 2FF4A 1P4XA 5J6XA 4EJVA 3ML6A 5H6QA 3C18A 1TQMA 2VC0A 2QENA 2D2WA 3VOEA 2GAUA 5ILUA 4Q47A 3RYPA 3ELKA 2IVMA 2EA4A 4I7HA 4RAYA 1BJAA 3F8MA 1DUXC 5J8CA 4QLCU 1DPRA 4A0YA 1TBXA 4A6DA 3LWFA 4XSZF 5D5VB 1USSA 2WWYA 3ZP5A 3E6DA 3WGGA 5H6RA 4HX7A 2DPUA 1ZRFA 1SFXA 4KIBA 4BHCA 2VOOA 3JAMZ 1GXQA 3VODA 1E17A 3FMQA 2MBFA 3GUDA 2STTA 4R8HA 3ZMZA 2DQRA 1AOYA 2HTSA 4PDKA 2H27A 1FSHA 2GA2A 1YIOA 2HDCA 2ACJA 2OA4A 2CSOA 2Z5UA 5L3FA 1KA8A 5L3EA 2UWMA 3NQOA 1G3SA 2ZKZA 5LHGA 2PQ8A 2H6CA 4ETSA 5E8IA 3SHFA 3QPHA 2X0LA 1SFEA 1PP7U 1MD0A 1BC7C 4HLXA 3WGIA 3IC7A 4ZZDA 1SD4A 2M45A 3GEZA 1R1TA 2V1XA 4HF2A 3REOA 1PP8F 3ZPLA 3R6SA 2P5VA 3F6VA 4KMFA 2A5YB 1UB9A 1L0OC 2OZUA 1ZARA 1ZLKA 4M6XA 5FFXA 1SD5A 1Q1HA 2OAZA 4WXCA 1Z7UA 3GZ5A 2GXGA 4U88A 2K86A 3FF5A 4MTDA 3E6MA 2VODA 1STZA 3F8NA 3GVAA 1OR7A 4L0YB 3PQJA 4I2OA 1OYWA 1I1SA 2HOEA 1HKSA 4IHTA 3I54A 4JBAA 2ESNA 5AONA 5KK1A 2ZNYA 1YS7A 2UXNA 3LA7A 1I5ZA 4PZJA 1IN7A 2EFPA 2F2EA 4G94A 1YTYA 2NAZA 5HS9A 1O3RA 2RC4A 1K6OA 3PQKA 1IW7F 1KU7A 4CHUA 2MD5A 3CDHA 4IRHA 3EUHA 2Y75A 2H09A 2BV6A 4NB5A 1HXDA 3HOSA 3V7CA 3H92A 2RN7A 2W24A 2F5DA 5BS6A 2R7DA 4WF2A 2LF8A 3GX4X 4CXFA 1KGSA 3F21A 3LA3A 5D8KB 3K2ZA 2MH2A 2G9WA 2Z99A 3J80K 1BIAA 1OPCA 2CW0F 4PGGA 1L3LA 2G7UA 1YW9A 1LDKB 5FFZA 2KJCA 3F8CA 4L0ZB 4FX4A 4LG0A 4LJZF 1XDSA 3BDDA 1FC3A 2EWNA 2ZXJA 4RB3C 3H3UA 3J80Z 4IRGA 3WTUC 5K5OA 2MLGA 5E1WA 1O3QA 3M8FA 1J2XA 1R00A 2IPQX 3ZN1A 1ZRDA 1IN8A 1Z6RA 2HYFA 5DDGA 3CO7C 1WQ2A 3V7SA 4ZYDA 1P2FA 5FO5A 4RGUA 2XVCA 1U8RA 1OKRA 3HRUA 1JXSA 2HYGD 2ISYA 4CICA 3SXYA 1CF7A 1E2XA 1O3TA 4LMYA 5DD4A 1F4KA 4GXOA 5IT9Z 1J75A 3COAC 1HW2A 3DPTA 5E1XA 3WTTC 4BYYA 2OD5A 4B09A 1ZYRF 4Q4ZF 3FMRA 1WI9A 3LA2A 3NEUA 3V8JA 2ZJ2A 2JSCA 1G3TA 2FBIA 5FGMA 3CUQA 5LGTA 2W85A 1BI3A 2QM3A 1J9IA 2PI0A 1IN4A 2A07F 3RDIA 2CFXA 4LFUA 3BROA 2K4JA 1YLFA 2V79A 2H94A 4HLYA 4A2UA 1D3YA 5LGUA 1K7AA 2ZO4A 4G7OF 1XSVA 1P6RA 3DF8A 3DP7A 1KQ8A 1DP7P 2YPRA 2ISZA 4L5IA 2FRHA 2L4MA 3U2RA 2DBBA 4A0XA 4M9ZA 3E6BA 3HRMA 2QVOA 2DQLA 1Z05A 3DFGA 4UVBA 5HLGA 1Z91A 3FHZA 4PCQA 3V4GA 3HYIA 4EGZA 3BP8A 5CVJA 4R79A 3D0SA 3R4KA 4HYEA 1HKQA 5LBQA 1U78A 3RKYA 2EJRA 1U5TB 3J81Z 3IWFA 3TDZC 5DUKA 4G7ZF 3WODF 2XAJA 4M9XA 1JGSA 2HTJA 1TQIA 3E5UA 1J5YA 4RGXA 4KICA 4KUMA 3KFWX 4AWXB 3C1DA 1Y0UA 2IW5A 2AS5F 2Z3YA 1I1GA 4AIKA 4KYWA 4U7DA 4G7HF 4WXDA 3QAHA 1ZN2A 2P8TA 4ENNA 4LLGF 4L9JA 3GXOA 3K69A 3KZYA 2HQRA 2KKOA 3BPXA 5ILSA 2V9VA 4A5MA 3L2CA 3Q5FA 3G73A 1K78B 1T39A 2OQGA 4MGRA 4CDGA 4RB2C 1S29A 4EQQA 2KIFA 3TO7A 3V7RA 2FA5A 3FZVA 3KP4A 2EB7A 1BI0A 3R60A 1XN7A 1EH6A 2HKOA 4P55A 3RIRA 3GFIA 1W7PB 2XV4S 3HRTA 3K9TA 4UV8A 3F72A 2H6BA 1QBJA 2Z9OA 5LRRA 1YW8A 1FX7A 5EEGA 2VE9A 4HOBA 1IZ1A 4XSXF 5ILVA 4ZZLA 1ZGAA 1R22A 2HS5A 3L9FA 1LDJA 2EV5A 4YIFA 3TO6A 2GZWA 1R23A 3GLXA 5AIPA 5FLXK 2BGCA 3TGNA 5CJ9A 5HDNA 4IRIA 1D8JA 4ZH4F 4KIFA 1QZZA 1B6AA 1ON2A 5CYVA 2XRNA 3BWGA 2CQKA 1ZG1A 3HSFA 5JI6A 1HSTA 2NRAC 2FMYA 5LRSA 1HQCA 1A04A 4U0YA 2L4AA 5HS8A 2X4HA 3WTXC 1H0MA 5F1RA 2EFNA 3KP6A