5LLQA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119f variant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPFHRVIAENGIGGYSRGVKLKRALLELEGVKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Interdomain interactions rearrangements control the reaction steps of a thermostable DNA alkyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain atcc 35092 / dsm 1617 / jcm 11322 / p2)
total genus 43
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5llqA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 5llqA01
3IKTA 2IP2A 4U7BA 2DFIA 3MCZA 4I0AA 4XRFA 1P4AA 2EK5A 2JPBA 4BNCA 2DW4A 2XROA 2J5PA 1LNWA 1TQPA 2UXNA 2ZNYA 4HBLA 2KIFA 1L0OC 2AXLA 4A6DA 1VTNC 2R7FA 2O8XA 2H27A 5HLHA 4Q5SF 3RKYA 3D5LA 1QZYA 2HZTA 4KIFA 5ICCA 1XB4A 3FHZA 1U3EM 1ULYA 3HHGA 4KIGA 1STZA 4JQFA 1DDNA 2A6EF 1J5YA 4A6EA 3I53A 5FLXZ 2PQ8A 3FMSA 4IHTA 2PG4A 2CYYA 2YPRA 3I0TA 2YX7A 1S8NA 1T0FA 4G7ZF 2R7DA 4EQQA 4D0PA 1ZG3A 3WTZA 1UHMA 5LHHA 3FM3A 5D4SA 3I59B 4Y17A 1R1UA 4P9UA 3KETA 3KP7A 1QO0D 3DXJF 2OQGA 3W6KB 1X3UA 5J8CA 1TW2A 2TDXA 2QUFA 4RB0A 4HYEA 3FMQA 1U5TB 4OU0A 4RGSA 5CYVA 4FT8A 2KKOA 2XAJA 1B9MA 4HF1A 4MEYF 5BS6A 1J0RA 1DPUA 1LVAA 4A2UA 1IN4A 5E8IA 5F64A 2DLLA 2RNJA 5ICGA 3MAJA 1TQIA 2W84A 4I01A 3LA7A 2Q8KA 4DNCA 2VC0A 3QRFF 4MNUA 2DI3A 2ESHA 1XSDA 1TW3A 4OMYA 3T8RA 4ZH4F 1TTYA 1XCBA 2CO5A 3KLNA 1R00A 5IT9K 2RC4A 1B1BA 5DYMA 5E18F 1ONVA 3JAMZ 5J8FA 5HS9A 2B0LA 1GVJA 2RN7A 2L01A 1ZRFA 1PP8F 3NEUA 4S05A 3BWGA 1S3JA 5HDGA 4PZJA 5D5UB 2V79A 4LD5A 1BJAA 4RB1A 2Z3YA 3C1DA 4ESFA 5LGNA 3WTTC 1JXSA 1K7AA 2VBYA 3SHFA 3J80Z 2P5VA 3I71A 3P9CA 4GYGA 2FOKA 1UHWA 4EJTA 3VOEA 2ACJA 3ZMZA 4G7OF 3F6OA 2L3DA 1V4RA 3WU1B 1JHFA 4XLNF 2GZWA 2L54A 2BE5F 2HOEA 5KVRA 1BIAA 4FX0A 3HSRA 1XN7A 3L9FA 3BOQA 1KU2A 3C7JA 3MQ0A 5CLSA 5CVVA 1U2WA 4LLNA 2BYVE 1YS6A 2FMLA 2DAOA 3U1DA 3IRQA 3WTXC 2FSWA 2Z9OA 1QPMA 2EFPA 3N4MA 5JR3A 1MD0A 3ZPLA 4IVNA 1ZLJA 5DCMB 2NS0A 1WSUA 4P55A 3K1MA 3K2ZA 2A68F 4WX9A 1MDMA 1QQIA 1IN5A 4BQAA 2Y48A 3IL2A 3GLXA 4Q47A 2STTA 3SZTA 1YIOA 4LG0A 3IRRA 3F23A 1OMIA 4QLCU 3KCCA 1XDSA 1BC8C 2CWEA 1D8JA 3BPXA 4Z2YA 4WCGA 2P6SA 2WWYA 2VT2A 1S29A 2VBWA 5HLIA 3CUQB 3CO7C 1R7JA 3I58A 5J6XA 5HOOA 4R8HA 5K5RA 1R23A 1MGTA 2DTRA 4PCQA 4DQ2A 4N9HA 4IF4A 3ECOA 3F8CA 4P9FA 2Z99A 4M9XA 1XCVA 2M1BA 3BPVA 3WG9A 3L2CA 2A07F 1F5TA 2YX4A 2JPCA 2QQ9A 5D4RA 3KEQA 5BMZA 2IA2A 3FX3A 2M30A 2EWNA 4YFNF 5TRDA 4KA4A 1CF7A 2DO7A 1TNTA 2LNBA 4MTDA 1E17A 4UV9A 2GIVA 3ELKA 5LEKA 1G3SA 2KJCA 3QOPA 5CVJA 2EFNA 4PGGA 4O6JA 4OOIA 4PDKA 1FC3A 2VXZA 2LF8A 2XV4S 4AVPA 4HX7A 1G3YA 4HW0A 2XKPA 1YO5C 5ICEA 3R0AA 1UCRA 1XSVA 5FD6A 3F8MA 4WK8F 1BI1A 1LEAA 2D1VA 1ZRCA 3S2WA 3OOPA 1KGSA 2CW0F 1OKRA 3NRVA 2VODA 2EA2A 1SD6A 1FT9A 1BIBA 1FPQA 2P7CB 1ZRDA 5CVUA 2XASA 1O7LA 5H20A 3TDZC 1HKQA 3GW2A 4U7DA 1KA8A 3JSOA 1KQ8A 1Y0UA 4KMUX 4MHGA 5ERIA 3I5UA 2L4MA 1EH8A 1MJ9A 1WI9A 3MWMA 2NNNA 1ZLKA 3GXOA 2RQPA 5IT3A 4ZZDA 2OQRA 3WTVC 1BM9A 2CQKA 1H9GA 4B09A 4G6QA 3FXQA 4R79A 4OINF 2MH9A 2LKPA 4U0YA 3F72A 3FZVA 2MH2A 4HA8A 2OZUA 4CHUA 1U5TA 4ENNA 1J75A 1WKMA 3BY6A 3RTRA 3KP5A 1SFEA 1K78B 1BBYA 2HS5A 3TKYA 4EJUA 1KQ0A 5DDGA 1IXSB 4EJWA 4AIJA 2CGPA 1FBSA 5L3BA 4WWCA 1BC7C 1YW8A 1XD7A 1LEBA 3FXUA 2GXGA 2A69F 2DU9A 1IXCA 1GHCA 2Q2EA 5TJJA 1IZ1A 3Q5FA 3WGHA 2K4JA 3GEZA 2Z5UA 4GO1A 2A6HF 5LEJA 2QLZA 3TO7A 3M8EA 2VBXA 4IRHA 1SAXA 3GFJA 4BHPA 1H0MA 1E2XA 1U6GA 2LF7A 1DUXC 2GQQA 3KE2A 3KP3A 2CFXA 5JI6A 4IHSA 4KMFA 3GFIA 2XUBA 4HLYA 5HS8A 4HV6A 1B59A 3HRUA 2QBYB 1TQMA 3JW4A 3RYPA 2DPDA 1XMAA 1EH6A 3R0JA 4UUVA 1T39A 2QYOA 4FX4A 3FXRA 1U78A 2PBIA 3M7GA 1L3LA 2F5DA 4BHBA 4QWQA 2L02A 3GO5A 5E1WA 2NAZA 1W4MA 3HRSA 3ZN1A 3E6MA 1ZYRF 2FU4A 3N97A 1R22A 3LAJA 2STWA 4XSZF 1IN7A 1G4DA 4LK0F 2KIUA 3KZZA 3DPTA 4IXAA 1HKSA 4G9YA 1GXPA 3E6BA 2V1XA 1FZPB 4A12A 2EV5A 5D6FA 1W5TA 4CYDA 1Z7UA 3ZN0A 3RPUA 5FFZA 4LLLA 1YYVA 3JAMK 2A61A 3HSEA 3WE2A 1QBJA 3CUOA 3F6VA 3ZQ7A 3CUQC 5DD4A 5HS7A 5DEQA 2QZ8A 1FYLA 2YU3A 2HYGD 4A5MA 5F6FA 4KNYA 2H94A 1YS7A 4WF2A 5E17F 2Z33A 2H6CA 5DD8A 2XGXA 3GWZA 4HAMA 1IN8A 4S04A 2JTVA 2GWRA 3E3VA 3VB2A 3PQJA 1WRJA 3ROUA 1DP7P 3J80K 1B6AA 3CTAA 2D2WA 3H3UA 2PMHA 3MFKA 3V8JA 4HV5A 1SFXA 1O3QA 4TV7A 3BDDA 2HKOA 3LA3A 3IKVA 4KIBA 5CJ9A 4P96A 5ILVA 2FQ3A 2M45A 2OU2A 1ZG5A 3GYHX 1HW5A 3EYIA 4RB3C 1D5VA 2COMA 3HTSB 5CVIA 4H0EA 2WC2A 3GFMA 2W25A 1OPCA 2HQRA 2X0LA 4IPAA 4EVIA 3U9GA 4XSXF 3T8TA 2P7VB 2DQLA 5D6EA 4CXFA 2UXXA 3FF5A 2GXBA 3JTHA 3CJNA 2KJBA 5FGMA 1SD7A 1ZHFA 2O61A 4ZYDA 4IRIA 4L9JA 2IA0A 5A2QZ 1P6RA 4KN4X 1F1ZA 3HOSA 1B9NA 4RGUA 1KYZA 1YQAA 2KRFA 3EQLF 4ESBA 3ZMDA 2HFHA 3H3ZA 1IRFA 5EEGA 1OYYA 3RKXA 3TDUC 1ZH5A 2O3FA 3KP4A 1T2KA 1YTYA 3ABTA 2FEZA 3HRTA 2DPUA 1YLFA 3CO6C 4ETSA 1K79A 4O5VA 1D3YA 2WV0A 4XLPF 5ED4A 1ZREA 4ENKA 1XGMA 3MEXA 5L3FA 3QPTA 4U0WA 4I09A 1TBXA 3SXYA 4UHTA 3QP6A 2IPQX 2P8TA 1HW1A 1O57A 4BH9A 1RUOA 4HDVA 2PJPA 1FX7A 2HGCA 3QAHA 2NRAC 2FE3A 5K5OA 1R1VA 4L0YB 5LBQA 4P5OA 3WGIA 5AONA 4EJVA 2F2EA 4UVBA 3G73A 1SFUA 1K78A 2PI0A 4RGXA 1BOAA 2VT3A 3J81K 4LB5A 5HVQC 2MC3A 5H6RA 4R1HA 1TNSA 4ZYHA 1RNLA 4M6XA 1IXRC 1HSTA 4OIQF 1IRGA 4HX4A 1O3RA 3HUGA 2XRNA 2XVCA 3TQNA 3WODF 3KFWX 4MTEA 4CZZA 4NB5A 1HKTA 5JVTA 2ZMEB 4K2EA 4HQEA 1R58A 1I6XA 3TOBA 2HKXA 2OAZA 3KP6A 1Z91A 2NYXA 1YW7A 5LRRA 2NNYA 3SZPA 2ESNA 5FFXA 4ZZLA 2IT0A 3K9TA 2P6TA 2P5KA 4U88A 4BYYA 1ZARA 2IJLA 5E20A 4JK1X 4AIHA 4HQMA 3JTGA 2ELHA 4RB2C 2FF4A 4GYIA 4GGGA 3MZHA 2FNAA 4EJOA 1IUYA 1FWZA 1REPC 4NHJA 6PAXA 1R36A 1A04A 4CGZA 4LMYA 1YFHA 4L0ZB 1Z05A 1B4AA 4UNOA 2AS5F 4AIKA 2ZBKA 2OBPA 3DV8A 4A5NA 3DQVC 1HXDA 2IRFG 4GXOA 2ZJ2A 3BJAA 3T0YA 5JHUA 3HIFA 1FYMA 3T1BA 3Q9SA 2O6GE 5K1YA 3GZ5A 4KUMA 3TOAA 3LSTA 1ZG1A 2DT5A 2ZKZA 3IC7A 1FBUA 4EMSA 1KQ9A 3ABUA 2IA1A 4F7ZA 3HRMA 5DV5A 5DUIA 4EM1A 2FRHA 4Y13A 1FNNA 4L5JA 2W85A 2V6CA 3QU3A 4KN7X 1S6LA 4G94A 2E1CA 3I59A 3HHHA 4G8XA 4ZYGA 4AWXB 3WU0A 1S7AA 2K4BA 2E7XA 3HSFA 1BI3A 1RIOH 3MZYA 1JGSA 4N0BA 3E6DA 4PGHA 1MDMB 2MLGA 1LDJA 5JFRA 3I4PA 3QP5A 4MQVA 4LLGF 2G9WA 2C6YA 3R60A 5EEHA 4LG0B 1OYWA 3RI4A 4OMZA 4RAYA 3LFKA 3F3XA 1IAWA 4ENJA 4M71A 2Q0OA 3GUDA 3FM5A 4B8XA 4BXUA 3JSPA 1KU3A 1ZGJA 2K02A 4KYWA 3V8LA 4JBAA 5LHIA 3K1NA 2HR3A 2X4HA 1HBXG 3V4GA 1EH7A 1D8KA 4MQ9F 3Q9VA 4ASNA 3KEOA 2XHKA 5DCFA 4NQWA 3RKWA 4I0BA 4ENMA 3RDIA 2ZCWA 3J7AO 3V7CA 5BQTA 5L3GA 2P5LC 5DUKA 4YIIA 1I1GA 3FMRA 3RJPA 2L4AA 3GF2A 1W7PB 4EGYA 1XMKA 3RYRA 2HDCA 4O3MA 1ODDA 5FLXK 2CSOA 3R4KA 2A3SA 1CF7B 2BEOA 4L9VA 3ZMVA 3F21A 1P2FA 3ZMUA 2MLKA 3K1PA 3LQQA 3O3KA 3SFZA 2RDPA 1OR7A 3E5QA 4YFKF 2VE8A 5H6QA 3BJOA 2PLYA 5AIQA 1KU9A 2LDUA 2QQAA 1JHHA 4I98B 2M8EA 3LQRA 4M6YA 4RAZA 5E8GA 2M5WA 3AAFA 2ETHA 5F1RA 2EFWA 3WTUC 3K69A 1EV7A 2XAHA 3TO6A 4YFXF 2H6BA 3P9KA 3OV8A 5FO5A 3GZ6A 4EV0A 3O2PE 1TLHB 4L5IA 2HEOA 1LDKB 4WXHA 2CG4A 5LGTA 4ZYEA 2PFBA 2E1NA 4LK1F 3ISPA 5DCMA 2ZXJA 4LFUA 3PFIA 4KT5C 1XSXA 1I5ZA 2K86A 4E70A 3I54A 3L00A 3FWEA 1Z9CA 5D5VB 4CDGA 3ERED 4RGRA 2MA3A 4L18B 1BI0A 4HDUA 4HF2A 1PUEE 4CICA 2VC1A 1YG2A 2KIMA 2FNPA 4LJZF 1Z6TA 1F9NA 2EFQA 3M8FA 1XGNA 1RZ4A 3ULQB 1FOKA 1G3TA 1Z1DA 3ZP5A 3PQKA 3CUQA 3E6CC 1FY7A 3DKWA 3HYIA 4M74A 2HWVA 3BP8A 1YW9A 4BAYA 4U0VA 4AD9A 3ZMSA 2PMUA 3K0LA 1O7FA 2MBFA 4KICA 2H09A 2ZMEA 1I27A 2XAFA 1USTA 5A2QK 2QQBA 3H92A 2VONA 2G7UA 2BGCA 2G7HA 2ZO4A 4G7HF 3DPLC 2FBKA 4L9TA 3F8NA 4IJAA 1PDNC 3HTUA 4I2OA 3BZ6A 5ICFA 3WTWC 2QM3A 5FD5A 4N9IA 1KU7A 2LSOA 4A0ZA 4KFCA 1J9IA 4A0YA 1UB9A 2UZKA 1ZGAA 4HF0A 3WE3A 3M9AA 5AIPA 2RVCA 1AOYA 2W24A 1Z6RA 1QNTA 5BPIA 1LQ1A 4M72A 5FB2A 1J2XA 3IWZA 3M1EA 1FSHA 2F5FA 1BI2A 3T5XA 1K6OA 1SMTA 2F5CA 3EUHA 3DP7A 5BPDA 2DK8A 2GA2A 4YIFA 2PEXA 2QVOA 5K5QA 4KDPA 4G6DA 3WTYC 2VN2A 3P7NA 2JT1A 4UVCA 1FSEA 2D1HA 2XKOA 1IF1A 4WXCA 5IT9Z 5D5XB 1U8RA 1FYKA 2YSRA 3EDPA 4CO8A 1R5GA 1QZZA 2R3SA 2V9VA 5HDNA 3B73A 2ISZA 1RUNA 3L09A 1Q1HA 2JZYA 4HLXA 5LLQA 2OA4A 1J7KA 4Q4ZF 3REOA 5HDKA 3DEUA 3F8BA 2JRTA 5LGUA 3P9IA 1AWCA 4EGZA 3V7SA 2BBYA 2QENA 3GFLA 3TGNA 1FLIA 4GCVA 1S7OA 2DK5A 4HOBA 1ZAOA 2GAUA 2O03A 4OIPF 1WWXA 2PN6A 1LDDA 2XAQA 5ILSA 4A0XA 3EETA 3RIRA 3LWFA 2ISYA 1P4XA 4BHCA 2UWMA 3B02A 4IRGA 1ZN2A 5L3EA 2EFOA 2XAGA 3SQNA 2VBZA 1SD5A 1HQCA 4UXNA 2QWWA 3VODA 1H9TA 3G3ZA 2VE9A 1OYIA 3E5XA 1HW2A 4OIOF 1ON1A 2ADUA 2DBBA 3WTSC 3U2RA 2HYFA 1O3TA 4HX8A 4OIRF 2A5YB 2FMYA 3KZYA 1P4WA 1C0WA 1FP1D 2EA4A 4Y15A 4HZFA 1J59A 5KK1A 3V8KA 3RPQA 3LAPA 1KYWA 1T98A 4UVAA 4WXDA 3R6SA 4ON0A 1IW7F 4M9ZA 2EV6A 2YR2A 1R1TA 3ML6A 3CLOA 3C3WA 1XGOA 1W7PA 1QGPA 2E7WA 1GXQA 5BOXA 2QBYA 3KLOA 3J81Z 2P4WA 1ON2A 3GX4X 2ZFWA 2MD5A 3LA2A 3IWFA 5D8LB 1MZBA 3ECHA 1JE8A 1NHAA 2OZ6A 3F22A 3C18A 1F4KA 1O3SA 2EV0A 1G3WA 4M73A 2XIGA 2FBHA 3CDHA 3QPHA 4FHTA 3HOTA 3VFZA 2EJRA 3TO9A 2O0YA 1G6NA 2K7LA 4ESJA 3BJ6A 2WTEA 2BV6A 2RV8A 1T6SA 3WGGA 5D8KB 2K27A 1SMYF 2FXAA 5HLGA 4YG2F 3O6BB 1HSJA 1CGPA 3BROA 4L9NA 2J5OA 3D0SA 4MGRA 2VOOA 1RI7A 3I64A 1R5HA 2VOPA 5L3DA 1FBQA 2DQRA 1P92A 4RS8A 5ILUA 5CVRA 1XDUA 2W57A 3V7RA 3E97A 2HTJA 1MJAA 4EM0B 1WQ2A 4UV8A 2IW5A 3ZMTA 4M9SA 2HTSA 1USSA 2HQNA 1SD4A 2IVMA 5LRSA 3F8FA 3KP2A 5L3CA 1U5TC 2V1UA 1W5SA 3EYYA 4XBFA 1MJBA 3COAC 2GA1A 2Y0MA 1BN5A 2FA5A 4Q48A 3R61A 3IHUA 3L7WA 1PP7U 4I02A 3VEPA 1LJ9A 2JSCA 1DPRA 2Y75A 1LB2A 5D5WB 1UFMA 1XGSA 1V3FA 1MKMA 1IN6A 4I7HA 3E5UA 3DFGA 2V1DA 3NQOA 2F5EA 2RKHA 1W7PD 1FP2A 5E1XA 1I1SA 4LGWA 1T38A 4LB6B 2OD5A 2M87A 2EB7A 2FBIA 3QU6A 3DF8A 3W6JB 2ZNZA 2D45A 5E1ZB 5LHGA 4MEXF 2RGVA 4EM2A 3GVAA
chains in the Genus database with same CATH superfamily
3IKTA 3K70D 3DKXA 2IP2A 4U7BA 2VQGA 1N36E 2EOQA 2E1MB 3ZQIA 2DFIA 3MCZA 4BDZA 4W97A 3CQZJ 2LBFB 3HOWJ 1G2DC 4I0AA 4XRFA 3AUZA 1P4AA 1GDTA 4IEJA 2XPVA 2EK5A 2JPBA 5IWAE 4BNCA 2R93J 2DW4A 2XROA 1NCSA 2FD5A 2J5PA 3TBIA 4E7ZA 5FROA 5M5WJ 1LNWA 2DT7B 3FK7A 1TQPA 2UXNA 1A1GA 5M5YJ 2KDZA 3S16J 4LF7E 2DOAA 2VQHA 4GKKE 1JJ8C 2ZNYA 1PJSA 1Z1BA 4HBLA 2XF6A 2FV4B 2KIFA 1WPKA 3TP3A 2GOMA 2EQ3A 4F54A 2A6TA 3Q0VA 4A93J 2B7VA 2M9HA 3BR3A 1T8IA 1L0OC 2NVXJ 2AXLA 4A6DA 1ENHA 5DM7F 3J80C 2OC6A 1VTNC 2R7FA 3RZOJ 4TUGA 2O8XA 2H27A 4JI0E 5HLHA 3HOZJ 2GLIA 4Q5SF 3RKYA 3D5LA 2JPAA 1YYKA 2DA2A 4HTGA 1QZYA 2HZTA 2ZB9A 2ZXIA 4KIFA 5ICCA 1XB4A 2W7NA 2BY0A 3G1LA 3FHZA 1ZR4A 2JRMA 5EJCA 4M3BA 1U3EM 2O8KA 2YU8A 1ULYA 4CCLA 1DQUA 2K9NA 3FXLA 2EPLX 2LY1A 3HHGA 3JR9A 4KIGA 3OYIA 2EMZA 4NC6A 3ADIA 1STZA 1B72A 3IAS2 4JQFA 2CPNA 4LTYA 1XX5A 3G1MA 1DDNA 3BG5A 3C4BA 1FMVA 3TQMA 2UXBE 4XLAA 2LREA 4XK4A 2A6EF 5A6KA 4BC9A 2M0MA 1J5YA 2EN3A 4A6EA 3I53A 1B8IB 5FLXZ 2PQ8A 3FMSA 4IHTA 2PG4A 1A1HA 2ENHA 1OJLA 2CYYA 2YPRA 1WJ5A 3I0TA 4XOTA 3DEWA 2YX7A 3S8PA 1S8NA 4B47A 1W5CC 2Z1DA 1T0FA 2DIXA 4G7ZF 4HEIA 3JRAA 4E7JA 1Y8RB 4CSWA 2HGHA 2R7DA 4EQQA 4D0PA 1N3GA 2RQLA 1ZG3A 1K61A 5IYCJ 3WTZA 1UHMA 5LHHA 2JA6J 3FM3A 2LVSA 1QU6A 5D4SA 3I59B 1R71A 3L1PA 4Y17A 1R1UA 2DMQA 3UNGC 2YTPA 2GBYA 4P9UA 1QRYA 1ETKA 3IH4A 3KETA 4DYRA 3KP7A 5FLMJ 3PIOF 1QO0D 3DXJF 2R4GA 2OQGA 3W6KB 2CMPA 4HG2A 1X3UA 5J8CA 2HC5A 1TW2A 2TDXA 2DMYA 2QUFA 1LE8A 4Q28A 4RB0A 4XL9A 1ZTRA 4HYEA 2COBA 3FMQA 5M3FJ 2I8DA 1Y8QB 5IV8B 3LSPA 1U5TB 4ZTFA 4OU0A 1YE9A 4EATA 4RGSA 2OCCH 3BG9A 5CYVA 4FT8A 2EPOA 2KKOA 1BR1A 2XAJA 2WBTA 1B9MA 4HF1A 3WU2C 1WH7A 4MEYF 5BS6A 1J0RA 1DPUA 1LVAA 2JMWA 2EPRA 4M0VA 4A2UA 1IN4A 5M3MJ 5E8IA 5F64A 4DV1E 2DLLA 4UUTA 3ZQHA 2V87A 3ERMA 4YEJA 2RNJA 3IH3A 2F48A 5ICGA 4E7LA 4XOPA 3MAJA 1TQIA 5EEAA 2W84A 3HL2A 1D5YA 4HSRA 1E0EA 2RPCA 3VWBA 2EMLA 2XC7A 2R5ZB 1UHZA 1MMNA 4CH7A 1X1BA 4I01A 2LE2A 3ECRA 3LA7A 2Q2EB 2LOOA 2Q8KA 4DNCA 2LLKA 3A0HC 2VC0A 3QRFF 1YSAC 5A6AA 4MNUA 2BHZA 4JX6A 2EPMX 2DI3A 2ESHA 1XSDA 1TW3A 4OMYA 3T8RA 3CESA 4ZH4F 1TTYA 2L3CA 1XCBA 2CO5A 3GLLA 2E19A 1R00A 3KLNA 3OL3A 2RC4A 3VYTB 5IT9K 4X62E 1IBME 1B1BA 5DYMA 5E18F 2N8XA 2HHHE 1ONVA 3DWLE 3OOUA 3JAMZ 3NARA 5J8FA 4LFCE 3IV5A 3OYBA 1CQTA 1TC3C 3G6EI 5HS9A 3SYTA 2B0LA 3BT9A 4J8ZA 1GVJA 3BTCA 1D0XA 1EA3A 2K9SA 2RN7A 3FK6A 2L01A 1FEXA 4AC0A 5KL5A 1RKWA 4E7KA 1PP8F 3NEUA 1ZRFA 4S05A 4DIQA 3BWGA 2Y9ZA 1S3JA 5HDGA 4OAYA 2UUCE 4IJDA 5K7ZA 2KZVA 4PZJA 1WHNA 2KIQA 3KYLA 1MBFA 5D5UB 2JUGA 2V79A 4LD5A 1JKPC 4BUPA 1BJAA 4RB1A 2EMBA 2Z3YA 3QOEA 3C1DA 2DOFA 2ICWG 1S7EA 2DA4A 4ESFA 5LGNA 1D1BA 3WTTC 1G2FC 2EM3A 3J81C 5JLWA 1JXSA 1K7AA 2RAEA 4JI8E 2VBYA 3SHFA 3J80Z 5FKLA 2P5VA 3I71A 2LY9A 9ANTA 4XIDA 2ME6A 4ZJZA 3CP8A 3P9CA 4GYGA 3L2QA 5LD2C 2FOKA 1YHQI 1UHWA 2WB1A 4EJTA 1ETQA 1SANA 2XGEA 3VOEA 3OYNA 3BZCA 2ACJA 3ZMZA 4G7OF 4LU9A 5EF6A 2YU9J 2YS9A 2HOTA 5HNFA 4GZNC 3F6OA 3FKIJ 2L3DA 4PFPA 1V4RA 2DMIA 5C44J 3WU1B 1JHFA 2LRSA 4XLNF 2MKNA 2KL4A 1GVDA 1EJ9A 4HNTA 2GZWA 2L54A 2BE5F 3PSFA 2IBDA 2HOEA 5J3LA 4NBQA 3P1XA 5KVRA 1BIAA 4A69C 1MBGA 4FX0A 2WB1N 3HSRA 3LSKA 2BW3A 3ONQA 2NVTJ 5A69A 1XN7A 3L9FA 3BOQA 1KU2A 1N25A 3C7JA 3MQ0A 4DV5E 5CLSA 4DV2E 2CRGA 1AH5A 3QPLA 1HLVA 5FRNA 2W1OA 5CVVA 1U2WA 4LLNA 3H9JA 4RHBB 2BYVE 3OWTA 4XKVA 4C3IJ 1YS6A 2E34A 2FMLA 2DAOA 3U1DA 1JUSA 3IRQA 2EMWA 3HQ1A 2V1NA 5F0HA 2VQLA 4LF6E 2CT1A 4IZZA 3WTXC 2O5RA 1RC9A 4A3CJ 3A4CA 2ZXHA 3LLHA 3QG5C 2VRDA 3S32A 2FSWA 2DOEA 2Z9OA 4P7DA 5F3WA 2L2KB 1QPMA 2EFPA 2PJRB 2JVHA 3N4MA 5JR3A 1D0YA 4D5FA 1MD0A 3F6HA 3ZPLA 2H1KA 4IVNA 4BEHA 5AE1A 1PKPA 1PJTA 2QCOA 2WADA 4FE7A 3BLYA 1ZLJA 5DCMB 2ODRC 5IP9J 2NS0A 1WSUA 1WI3A 3LSMA 4P55A 2BHYA 2B7TA 1QHHD 3K1MA 2A68F 3K2ZA 4WX9A 1MDMA 1X1DA 4OX9E 3BG7A 3CF2A 4XRSG 3E1SA 5IOYA 5J4VA 1I94E 3OYLA 1QQIA 4JV5E 2F6CA 1IN5A 4BQAA 2EORA 2Y48A 2X6WA 3IL2A 1JUPA 3GLXA 3QODA 4Q47A 2STTA 3SZTA 2YTDA 4V19K 1YIOA 3BR2A 3DBHB 2VQEE 4LG0A 3CC7I 3IRRA 5TISC 2MGQA 3F23A 1OMIA 4OWRB 5GPAA 2KDOA 2CW8A 3UR3C 4QLCU 5IP7J 2EPNA 3KCCA 1XDSA 3OS1A 3M07A 1BC8C 2CWEA 1D8JA 3BPXA 4Z2YA 2EMXA 4WCGA 2EOEA 2F4IA 2P6SA 2DB2A 1X3WB 2WWYA 4Y3OA 3GTKJ 1SEUA 4PJMA 4CCOA 2VT2A 1ETOA 4FCYA 1S29A 1DI2A 2VBWA 3X2QH 4BDYA 5HLIA 3OSGA 2XB0X 3CUQB 3CO7C 2KMUA 1R7JA 3I58A 4Z6YA 1VQMI 3D5SC 2LBSB 5J6XA 2HDDA 2DJNA 5HOOA 4R8HA 3CZ6A 5K5RA 4JI1E 1R23A 2R76A 1MGTA 2DTRA 4PCQA 4GDFA 4DQ2A 4N9HA 3J7AY 2EM8A 2XGDA 4N4RB 4IF4A 3F9KA 1MNMC 4R8OA 3ECOA 4C3JJ 2EOOA 1MBJA 3RQ4A 2EOFA 1IV8A 2L2OA 4ZDPA 3F8CA 4NDLA 5KNLA 4P9FA 5J4YA 1LKXA 1VF9A 5GTIC 1X49A 1ZBQA 2Z99A 4M9XA 1XCVA 2M1BA 3BPVA 3WG9A 4MLVA 3L2CA 3CCEI 4DV7E 3CJTB 3G4SI 2A07F 3LL7A 2XRLA 5E3OA 1F5TA 2JQ7A 2YX4A 4P1WA 2JPCA 2EOXA 3MN2A 2QQ9A 2BOLA 4JX5A 4B3XA 4IOCF 3CJQB 5D4RA 4II3A 3KEQA 4E6KG 2BVLA 5BMZA 2IA2A 3FX3A 1ZKGA 5KAFC 2NXNB 2M30A 2QQ8A 2MG4A 2EZLA 3DTEA 5EDNA 3H09A 3DBRB 2EWNA 1X6HA 1MBEA 4YFNF 4L5NC 5TRDA 4KA4A 3TMOA 1CF7A 2DO7A 2E1MC 1TNTA 5FKMA 4B43A 3THNA 4DJAA 2LNBA 2L7MP 4MTDA 1E17A 4UV9A 2GIVA 3MSWA 4G12A 3ELKA 4F6MA 5LEKA 1G3SA 3OMLA 2KJCA 3G1OA 3QOPA 3SEZA 5EGOB 2LBFA 5CVJA 5J1YA 2EFNA 4NNJA 2EPCA 4M30A 4FE4A 4O6JA 4OOIA 4PGGA 4V2GA 4PDKA 3S17J 2K9QA 1FC3A 1GT0C 2VXZA 2LF8A 1LUJB 1TWHJ 2XV4S 4P78A 1W0TA 2L2NA 4V2FA 4LF5E 4AVPA 1VFCA 4HX7A 3H5AA 1G3YA 2V9KA 4HW0A 2M3AA 1ETWA 2XKPA 5ICEA 1YO5C 3R0AA 1X6EA 3DTKA 3JTZA 1UCRA 1XSVA 5FD6A 3F8MA 4WK8F 2R5YB 1BI1A 2DYSH 1LEAA 2IS1A 3MHHC 1WJCA 2ME0A 1T08B 4KITB 2WBUA 2D1VA 3BR6A 1ZRCA 2ECCA 3OY9A 2V9PA 3S2WA 1S72I 3OOPA 2MC4A 4C2MJ 2MKDA 1KGSA 3I9V2 2CW0F 1OKRA 5EYRA 4KHPE 3NRVA 2VODA 2EA2A 1SD6A 1UILA 1FT9A 5FLVA 1BIBA 1FPQA 2P7CB 2CQQA 3M8JA 2FX0A 1ZRDA 5CVUA 2XASA 1O7LA 4XRMA 3J7YJ 1HR0E 3VYXA 3F6GA 1HDPA 5H20A 2BY3A 3TDZC 2CUJA 2BBGA 1BW6A 2HYJA 1HKQA 4MO7A 1DGCA 3GW2A 4U7DA 1X19A 1KA8A 3JSOA 1KQ8A 1Y0UA 3DU5A 4KMUX 4MHGA 3K4NA 5ERIA 1I3QJ 3I5UA 2L4MA 1A6IA 1EH8A 2YTEA 1GV5A 4Y4RA 3CJRB 3CCUI 1MJ9A 1WI9A 3MWMA 3A01B 4R2AA 3ABKH 2NNNA 3LNQA 2L0KA 1ZLKA 1YI2I 4BC7A 3GXOA 2RQPA 3W3CA 5FLXC 5IT3A 4ZZDA 5DTDA 3SDGA 2F5VA 2OQRA 3WTVC 3B6CA 2Y31A 1BM9A 2CQKA 1H9GA 2EM5A 4B09A 2X9DA 2LG4A 4G6QA 2HI3A 4FETA 3JRCA 1OISA 3CLQA 4BY1J 1ORKA 4F2JC 2KP6A 4B3ME 3FXQA 4A3KJ 2R7WA 3Q0UA 2X48A 4OINF 2HPIA 4R79A 2MH9A 2LKPA 3HJEA 4U0YA 3F72A 3TL4X 1EF4A 3FZVA 4BKXA 1HNXE 2I5UA 5IOZA 2L33A 2MH2A 4HA8A 1TWAJ 1LFBA 2GOXB 3HZJA 1FOYA 1TT5B 1STUA 2OZUA 4CHUA 1PDAA 3HKZA 1U5TA 4ENNA 1IDZA 1J75A 1WKMA 2AHQA 3BY6A 4BACA 2R7RA 3RTRA 2EMCA 3KP5A 4CZCA 4NC8A 3RSNA 1TF3A 1SFEA 1JKOC 5F0CA 1K78B 1OCOH 3V42A 1BBYA 4MLOA 4A3BJ 2HS5A 3TKYA 3CCVI 4EJUA 1KQ0A 5DDGA 1IXSB 3FKJA 4EJWA 4AIJA 2CGPA 4C2UA 2XF5A 2ELKA 1FBSA 5L3BA 2E71A 4WWCA 1BC7C 5B1AH 4M3GA 4NXNE 4UY8I 2MW8A 2NVYJ 2IGMA 3HUGB 1YW8A 3EUKL 3MKLA 1XD7A 4C30A 3O8HA 1LEBA 3FXUA 3VK6A 2GXGA 4Y7NJ 2R5ZA 2R7ZJ 2A69F 2DU9A 3RQIA 1IXCA 3S15J 1GHCA 4B48A 2Q2EA 1FTZA 3BF2A 2YPNA 5TJJA 1UHSA 1IZ1A 3Q5FA 3S3NA 3WGHA 1A1FA 2K4JA 3BQYA 2DMUA 2L8TA 2EIMH 3GEZA 2Z5UA 2EINH 3GZNB 2VUMJ 2DDBA 1SVLA 1FTTA 3K4CA 3W2WA 1AHDP 3DLLF 3MVPA 3O8GA 4GO1A 3E7LA 5AE2A 2KONA 2CW7A 1SVOA 2LP0A 2XGCA 3OSFA 2A6HF 5A6BA 1TZLA 5LEJA 2QLZA 3KYCB 4R03A 3TO7A 1AKHB 3M8EA 5E3LA 3CCMI 2VBXA 4LFBE 4IRHA 1SAXA 3GFJA 1SAUA 2B7EA 2XPWA 4BHPA 2YT4A 3VYRB 1H0MA 2D5VA 1E2XA 4B3AA 1Z21A 3RCOA 1U6GA 2LF7A 3HEFA 2B3TB 1DUXC 2GQQA 1ZAAC 1NG6A 3KE2A 4M3DA 1QPIA 2EBIA 2M1SA 3ZOBA 1G59A 1X6FA 3KP3A 2CFXA 5JI6A 4IHSA 2DYRH 2KFDA 4KMFA 3GFIA 4PFOA 2XUBA 3JRHA 3BR0A 4HLYA 3MMYB 2EILH 1MW7A 2VLAA 5HS8A 4HV6A 3QYEA 1B59A 3I55I 3GTMJ 3HRUA 2QBYB 1TQMA 4ABZA 3JW4A 1OR7C 5KHDA 2XSJC 2QEXI 4RMNA 4Y33A 2YSPA 3RYPA 2DPDA 3S2DJ 1Y1WJ 2JA8J 2XF7A 1ZU1A 2CQXA 2X6XA 2BY2A 1XMAA 1EH6A 2BZTA 3R0JA 4UUVA 2EN4A 1T39A 4FTHA 2QYOA 4FX4A 5IY5H 1P47A 3H9GA 2XSDC 4B4CA 3FXRA 1U78A 3BC8A 1UJ8A 1PUFA 4M3FA 5GPCA 3C6KA 2L9VA 1HF0A 2PBIA 2LCEA 3M7GA 4BQOA 5A2QC 1MMSA 2BXZA 1L3LA 1E3OC 4BQNA 4DBRA 2F5DA 4RH8A 3LOCA 4MLQA 1A1IA 4BHBA 4QWQA 2L02A 3GO5A 2CQNA 5E1WA 2KOUA 5BR8E 1DU6A 2NAZA 2EM9A 1W4MA 2JK3A 2LKSA 3HRSA 1I3AA 4KZSA 4D9JA 2OTJI 3ZN1A 3E6MA 1ZYRF 3U21A 1LFPA 2FU4A 2K40A 4HEA2 3N97A 2HJJA 1R22A 3LAJA 2STWA 4JI6E 3FXMA 2EOJA 4XSZF 1IN7A 4DW6A 1G4DA 4I76A 5AC4A 3KIOA 2HQ5A 4CYCB 3CMYA 2OV7A 4LK0F 3BG3A 2KIUA 3OYAA 3KZZA 4A3EJ 1V55H 4F92B 3DPTA 2CUZA 4IXAA 2GM4A 1HKSA 3PIPF 3WHCA 2LK2A 4G9YA 4RLFA 3ZGKA 2EM7A 1GXPA 3E6BA 2IS4A 1LVKA 2V1XA 1ETYA 4R2DA 1FZPB 3KYDB 4GEQB 4ITVA 4A12A 2EV5A 1NEIA 1R5ID 5D6FA 1POGA 1W5TA 1A31A 5FKNA 4KWYA 4CYDA 2E2HJ 1Z7UA 1A6QA 2A25A 3ZN0A 2FGGA 3RPUA 3SFIA 3OYMA 1ZBTA 4K0KE 5FFZA 1V54H 3PNTA 3ADLA 5E3NA 4LLLA 1YYVA 3KWRA 4PUSA 2H8WA 3JAMK 3ASNH 2HQAA 3CMAI 4X64E 1OFCX 1QZEA 2A61A 3HSEA 3WE2A 1QBJA 3FXOA 2M4KA 4GFBA 4PSXA 3CUOA 3F6VA 3PSIA 3ZQ7A 3CUQC 4IHWA 1B69A 5DD4A 2IEKA 4L8NA 3BQZA 5HS7A 3LSHA 1QHGA 1WJAA 3ADGA 5DEQA 2L7KA 2QZ8A 1FYLA 3PUFA 3HC7A 2YU3A 1FIAA 2HYGD 4A5MA 4WFTA 4LIVA 2JUCA 5F6FA 4KNYA 2H94A 2EN2A 1YS7A 1VQ9I 3CCQI 3S1NJ 4WF2A 5E17F 1YUJA 2Z33A 2H6CA 5DD8A 5FKKA 3M1CA 2E2JJ 2OTLI 1R4NB 3AL0B 2XGXA 3GWZA 4HAMA 1A1JA 2VE7C 4ZC3A 1IN8A 4S04A 2JTVA 4X6AJ 2GWRA 3E3VA 3BIDA 1MBHA 3H0GJ 4PJ0C 3K6QA 5EG0B 4F93B 3VB2A 4AYBA 3W2AA 5A6BD 3PQJA 1WRJA 3DPUA 1VQ6I 3VDXA 1AU7A 3ROUA 5C4XJ 2CQ7A 1DP7P 2WCC3 4CCKA 3J80K 2LY2A 1YRNB 1VQ8I 2W4SA 1RQ0A 1YYOA 1B6AA 1BR2A 2D2WA 3CTAA 5KCMA 4X0GA 3QYFA 4QPQA 5AE3A 1T4LB 3H3UA 2ADRA 4X8WA 2PRTA 2PMHA 2QF7A 3MFKA 1RC7A 3V8JA 3GTGJ 3C2HA 4HV5A 1SFXA 3HPZA 1Q1VA 2ZXWH 2EOHA 1W36D 1O3QA 4TV7A 3BDDA 1GV2A 1F36A 2HKOA 2M2EA 4AYBN 3LA3A 5K7FA 3IKVA 3K4BA 4KIBA 5CJ9A 3MKWB 1IG7A 4C2TA 4DYQA 2EMAA 4UB8C 1FOWA 1MH4A 2Y0SA 4P96A 4B3RE 2K85A 2JOBA 2HNHA 4NQWB 1LLMC 5ILVA 2FQ3A 5C4JJ 2M45A 2OU2A 2VASA 1ZG5A 3GYHX 1HW5A 2OPTA 2QSFX 1QU3A 4NUBA 3EYIA 2ENCA 2CUEA 2DMNA 4RB3C 1XMXA 2COMA 3HTSB 5CVIA 1D5VA 1U9OA 1R6RA 3DKYA 3K7AJ 3OYGA 4H0EA 3CF5F 2YTFA 2WC2A 3GFMA 2W25A 1OPCA 2HQRA 2X0LA 4IPAA 4DBQA 4EVIA 2DXIA 2JP9A 3U9GA 4XSXF 1FIPA 3T8TA 2P7VB 2M7AA 2DQLA 1R4MB 3ZR8X 5D6EA 1JTYA 4XLEA 2H1LA 2UXXA 4CXFA 3FF5A 2GXBA 1IC8A 1WVRA 1FJLA 2GIZA 3L2WA 2P81A 1PJQA 1F2IG 1IBKE 2Y0SN 3JTHA 3CJNA 2GHFA 2KJBA 5FRMA 5FGMA 1Z7LA 3CD6I 1QVTA 3MD2A 4X66E 1SD7A 3ABLH 3EUHC 1N78A 1HCRA 1ZHFA 4R2CA 4LFAE 2H8RA 2O61A 4FASD 4ZYDA 4IRIA 2KQRA 4L9JA 1OLTA 1F43A 2QSHX 2IA0A 4CCMA 2VKEA 5J1RA 3NWTA 1SC7A 5A2QZ 4KJZA 2JXPA 2EZIA 2WV1A 1JKQC 1P6RA 4DMIA 1UG2A 3M4OJ 1A35A 3HPSA 2YSOA 4KN4X 1F1ZA 3T1YE 3HOSA 4XNFA 1B9NA 4RGUA 2IHR1 1KYZA 1YQAA 2KRFA 3EQLF 2LFBA 3AG1H 4N4OB 4BU2A 4DV6E 3HOXJ 4ESBA 3ZMDA 4BMJA 2HFHA 3EPLA 3H3ZA 1ETXA 4M9VC 4D7MA 3VSKA 1IRFA 5EEGA 4IQ4A 2L2MA 1SFOJ 3H36A 3IAM2 3H1CA 2EM6A 1OYYA 3C2GA 3RKXA 3TDUC 1ZH5A 2O3FA 1AA7A 4XKCA 1ZGWA 3KP4A 4BXFA 2WAQA 1IBLE 1T2KA 4F55A 5GTHC 1YTYA 2X1CA 3ABTA 2FEZA 5IYBJ 1VQOI 3HRTA 2DPUA 1YLFA 3CO6C 3JRFA 4ETSA 3EPZA 3G71I 1K79A 4O5VA 1X2NA 1D3YA 4AIDA 4B1RA 2WV0A 2JN6A 4HSTA 4RM2A 4BBRJ 4E4HA 2DA6A 4XLPF 2HPMA 5ED4A 1ZREA 1PVEA 4CA0A 3OYJA 1V5EA 4ENKA 2A5WA 3RPUD 3A01A 3I4NJ 1XGMA 3MEXA 5HODA 4DR2E 5L3FA 3QPTA 2JR1A 2WZOA 3PNVA 4U0WA 1B72B 3CC4I 4WPYA 1ZR2A 2H36X 4I09A 1TBXA 3SXYA 2QSGX 5IYDJ 4UHTA 2OJED 2YRHA 2TRTA 1X1AA 2LMZA 3QP6A 2IPQX 2MABA 1NH3A 3QWLA 2CU7A 2P8TA 3SZGA 2LTPA 3S3OA 5ADZA 1HW1A 2JVAA 2V83A 2MYSA 1I6HJ 1O57A 2EPPA 2VKDA 2M0CA 4BH9A 3FIGA 1RUOA 2CFOA 2MSYA 1UG0A 4HDVA 2PJPA 1FX7A 2HGCA 3QAHA 2NRAC 2FE3A 1E3HA 5K5OA 2HU9A 3LFUA 3ASOH 1OCTC 2QA4I 4A3JJ 4HNUA 1MIJA 1R1VA 4L0YB 5DNYA 1WH5A 1JK1A 5LBQA 4N4NB 4P5OA 3PM1A 4C9YA 3WGIA 2VPRA 5AONA 4EJVA 2F2EA 4UVBA 1WJPA 3G73A 2R7TA 2HOSA 1SFUA 5BNGA 1K78A 2PI0A 3HPHA 4AM3A 4WSPA 5AASA 1A36A 4RGXA 1BOAA 2VT3A 3J81K 3OYFA 5HVQC 3H9QA 4LB5A 2N8GA 2MC3A 5H6RA 4E7SA 5GP9A 2M4IA 4R1HA 2BY1A 1TNSA 4ZYHA 1V5GA 1RNLA 3K6GA 2M8GX 1Y6IA 4M6XA 4IS1C 1IXRC 1HSTA 4OIQF 4J19A 1IRGA 4D5CA 1S9HA 4HX4A 1LE8B 1I50J 1O3RA 3HUGA 2JJ7A 2NS8A 1KYQA 2EPXA 2XRNA 2XVCA 1W0UA 3TQNA 3WODF 1TWCJ 3KFWX 5DS9A 4MTEA 5KL6A 3VSLA 3LSRA 4CZZA 3CCRI 1IMUA 2ZJRF 2IAIA 4NB5A 1HKTA 2FUG2 4BY7J 5JVTA 2DCEA 2ZMEB 1YJNI 1WGXA 2F4OB 2DA7A 3K4LA 4II2A 4K2EA 3OS2A 4HQEA 1R58A 2L92A 2YTJA 1I6XA 2CS3A 3FBIB 2EMYA 3I3LA 3ZQLA 3TOBA 2HKXA 2EM4A 3LSGA 1G2HA 2OAZA 4DKKA 5IPAA 3KP6A 2RSMA 1Z0XA 1BOBA 1Z91A 2NYXA 1YW7A 3H35A 4JP0A 5LRRA 3SZPA 2NNYA 2YZTA 2HXOA 2ESNA 5FFXA 4ZZLA 1JT6A 4F9AB 2E5LE 4DR6E 2IT0A 3IUOA 4XMYA 3IP4B 3K9TA 2P6TA 3DEEA 2EQRA 1YPNA 1TWFJ 2P5KA 4U88A 4XLFA 4BYYA 1VQPI 1ZARA 2IGKA 2M7BA 3FBNB 3ZCOA 4J00A 4A3IJ 4R2SA 2IJLA 2LJHA 5E20A 2ZC2A 3BCAA 3PNYA 3AG3H 4JK1X 2YRKA 4AIHA 1APLC 1P9QC 3FIWA 4HQMA 3JTGA 2W48A 2E1MA 1TN9A 3N05A 3WHBA 2AQFA 1OQYA 1WCMJ 2ELHA 4RB2C 3KX2A 2AQEA 2FF4A 3K4KA 4GYIA 2NVUB 4GGGA 3MZHA 1XTAA 2V26A 4O24A 2FNAA 4EJOA 1IUYA 3AG4H 1FWZA 1REPC 4NHJA 6PAXA 1R36A 2K4VA 1A04A 3P5JA 4CGZA 4LMYA 2YU5A 1YFHA 4L0ZB 4BCAA 4IX7A 1Z05A 1B4AA 4BE2A 4UNOA 4JI2E 2L9SA 2AS5F 5CFFE 4R2RA 2ZBKA 4AIKA 2HXIA 2OBPA 3DV8A 1U9NA 4A5NA 3K70C 1BA5A 1HOMA 3ZXSA 2KPMA 1XNQE 1KONA 3DQVC 1HXDA 1PJRA 2IRFG 4GXOA 2JYAA 2ZJ2A 3BJAA 1VQ7I 1DP3A 3S14J 3IWBA 3T0YA 5JHUA 3HIFA 4R2EA 1YX3A 3GTOJ 3HTXA 1FYMA 3T1BA 2EMKA 3Q9SA 5CQGA 2X6YA 2R92J 1EKEA 5J1UA 2O6GE 5K1YA 2DT6A 2EN1A 2M34A 1VQ5I 2CJJA 3GZ5A 2EIJH 2KT0A 4KUMA 3TOAA 2DFEA 3LSTA 3GTLJ 2F8BA 1ZG1A 5AC5A 4XQFA 2DT5A 2IGOA 1A5JA 2NA2A 2ZKZA 4IOAF 2DRPA 3H3VK 1B8IA 2GXAA 3QPSA 3IC7A 2CUFA 1FBUA 1ZELA 5B5EC 3JREA 2BW3B 1YX5A 4EMSA 1YIJI 1KQ9A 3ABUA 2IA1A 4F7ZA 3HRMA 1VNDA 1X3ZB 1KZHA 5DV5A 5DUIA 3H0DA 3JRBA 3CDIA 4EM1A 2ODRD 1UBDC 2FRHA 3CC2I 4Y13A 1FNNA 4L5JA 4AU7A 2W85A 3TW6A 2RNGA 2V6CA 2DLKA 2VB6A 3QU3A 4KN7X 2M9AA 3PJRA 1S6LA 4G94A 2E1CA 1ZR9A 3I59A 2EPKX 1SVMA 5KL3A 3HDDA 2LYCA 2B9SA 3HHHA 4JX4A 1UMQA 4G8XA 1RRJA 4F9CB 2UU9E 1N34E 2WAEA 2NUEA 2BXYA 4ZYGA 2K7IA 4AWXB 3WU0A 1P7IA 2DMTA 1S7AA 2K4BA 2E7XA 4BEHB 3UK3C 1FJGE 4A3DJ 2L9NA 3HSFA 5HLTA 2L3JA 1BI3A 2X1EA 1RIOH 2RSIA 1HDDC 3T1HE 3H5RA 3DBLB 1P7JA 3GMEA 3MZYA 1JGSA 2E72A 4N0BA 3AL0C 4W1UA 2R0QC 1JJ6C 3E6DA 4PGHA 1MDMB 2MC5A 2MLGA 1LDJA 2VJ5A 4RAFA 2HVSA 3JCUC 5JFRA 4JI5E 3I4PA 5F1JA 1RKTA 1I39A 1RPWA 3QP5A 4MQVA 4LLGF 3EPHA 3VPRA 2G9WA 2C6YA 3R60A 4F91B 1GUUA 2V89A 1J26A 2LT7A 5EEHA 4LG0B 5T6JA 1OYWA 2QKMB 4AUXA 5E79C 2EN8A 2N3GA 3RI4A 4LF9E 4OMZA 4G6TB 4RAYA 3HKZN 3LFKA 3F3XA 1IAWA 4BJ6C 4Q35B 3J7Yp 2V85A 1IO2A 1N75A 4ENJA 1YRNA 1IGNA 4KISA 5IP6A 4I8OA 3PO3J 2LUQA 5KAIC 4M71A 1XNRE 2EOSA 2FTXB 3OS0A 2WY8Q 2Q0OA 1K4TA 3GUDA 3FM5A 4B8XA 1H8AC 4CCNA 4BXUA 3JSPA 2ELJA 1KU3A 1TWGJ 1ZGJA 2K02A 4KYWA 3V8LA 4JBAA 5EZHA 5LHIA 3K1NA 2HR3A 4ZDLA 2X4HA 4U87A 2IGNA 3V4GA 2ZJQF 1HBXG 1EH7A 1D8KA 1LPQA 3D1NI 2QGUA 4MQ9F 2EZHA 3Q9VA 4ASNA 1RETA 3KEOA 2XHKA 5DCFA 4NQWA 4PJJA 3RKWA 4I0BA 4ENMA 1MNEA 3BR5A 4LF4E 3RDIA 2IS6A 2ZCWA 3J7AO 3V7CA 3ESWB 4ZDOA 5BQTA 3I4MJ 5L3GA 2R7UA 4DYCA 2P5LC 4O4KA 5DUKA 2WA0A 1R9TJ 3FMRA 1I1GA 2VJJA 2F4MB 4YIIA 3RJPA 2KISA 2MDRA 4OAZA 4JI3E 1ITYA 5E3MA 2L4AA 3GF2A 1W7PB 4EGYA 1XMKA 3RYRA 2HDCA 4O3MA 1X47A 1ODDA 4B3TE 1UELB 2ZJPF 5FLXK 2CSOA 3R4KA 2A3SA 3DJWA 2CH0A 3OR1C 3OIPA 1CF7B 3L2RA 1FOXA 1GTKA 2BEOA 4L9VA 3ZMVA 3F21A 2RTXA 4AVZA 1P2FA 2EPAA 3ZMUA 2MLKA 4DOZA 3K1PA 3LQQA 3O3KA 2EL4A 3DF6A 3SFZA 2I13A 1BL0A 5TSEA 2K3FA 2RDPA 2LRDA 4F9BB 2LVHA 1X3CA 2EPUA 1OR7A 3E5QA 1IRXA 4YFKF 2VE8A 4WSGA 1L4SA 3WG7H 5H6QA 1DQ3A 1N33E 2N3HA 1DU0A 2EOYA 3BJOA 1AAYA 2RS7A 1K83J 4JOMA 2DTZA 4XLHA 5AIQA 2PLYA 1KU9A 3VHTB 2LDUA 2QQAA 2EN7A 1JHHA 4I98B 2M8EA 2AXTC 4HPQA 3ZRGA 4IHYA 3OYEA 3LQRA 3BTJA 4M6YA 4CCJA 4RAZA 5E8GA 5GAHJ 1BR4A 4I6ZA 2EMHA 2M5WA 1H88C 4A3LJ 4UUSB 5KL4A 1HC8A 1T95A 2ETHA 5CPRB 3AAFA 3RMPA 2YWQA 5F1RA 2LUPB 2L7FP 2ID6A 4BJTA 2R7SA 4MFEA 2EFWA 3SEQA 3WTUC 4O43A 4NZVA 3K69A 1EV7A 3L2UA 3EQ1A 2XAHA 3TO6A 4YFXF 1RR7A 4XORA 3C2BA 2H6BA 3P9KA 2R7XA 2DGCA 2M4GA 1QA6A 3OV8A 5IT9C 3U1KA 3C6MA 3Q3SA 5FO5A 3GZ6A 1M1EB 2D9HA 4DV0E 5GAEJ 4EV0A 2DFHA 2MFZA 3O2PE 2PJRA 3PO2J 1TLHB 3S1MJ 1JT0A 4YY3E 4L5IA 1XC5A 2HEOA 1LDKB 4PJNA 4IHXA 3IWCA 4WXHA 1X2MA 2CG4A 2EP3A 5LGTA 4ZYEA 3CP2A 2PFBA 1HNWE 1QVUA 4X65E 2E1NA 2K3PA 3TW7A 2EMIA 1S5LC 2JWTA 4LK1F 3ISPA 1T0FC 2ZXJA 5DCMA 2Y2ZA 2ELYA 4LFUA 3MKYB 2EN6A 1BW5A 3PFIA 1ZQ3P 4BBSJ 2V86A 1IQOA 5C3EJ 1Z77A 4KT5C 1RR8C 1XSXA 1I5ZA 3B6AA 4RAGA 2K86A 4E70A 4R2QA 3I54A 2VQFE 3L00A 3FWEA 2FJ1A 1Z9CA 5D5VB 4A3GJ 4CDGA 2LO3A 4M2ZA 4NXME 3ERED 4RGRA 5DM6F 2DJIA 2MA3A 3K4MA 2CV2A 1MMAA 3HGGA 2LMDA 4L18B 5F04A 2Y69H 1BI0A 4HDUA 4HF2A 1PUEE 4CICA 1YYWA 3IH2A 2VC1A 3OIOA 1YG2A 2LR8A 2KIMA 4I99C 3MHSC 1W1WE 2FNPA 1OCRH 1Z6TA 4LJZF 1X5WA 1F9NA 4QSHA 1GQEA 3OYCA 2LC2A 5IXMB 2ZM6E 2EFQA 3M8FA 1SFKA 1XGNA 2E1OA 2E36A 1RZ4A 3QQAA 1WJDA 1G3TA 4YELA 3ULQB 1FOKA 1Z1DA 1GZ6A 2UXCE 3ZP5A 3PQKA 3CUQA 3E6CC 4DZPA 4UB6C 3HPGA 1VQLI 3L2VA 3S3MA 1FY7A 3DKWA 4GRIA 2MC6A 2NUFA 1BJZA 3HYIA 4M74A 5JVGF 1VQ4I 2I10A 2HWVA 3BP8A 2ZMEC 4OOGC 1YW9A 4BAYA 4U0VA 4BQQA 2DLQA 2L5QA 4AD9A 2KRCA 3ZMSA 3NAUA 2PMUA 3CCJI 3K0LA 1O7FA 4XRSA 4EEFG 2O9LA 2MBFA 4KICA 2H09A 2ZMEA 5F08A 4IKFA 2LD5A 1I27A 2XAFA 1USTA 5A2QK 4RLQA 1Y39A 1ETVA 5LMUE 2QQBA 1IDYA 5K7HA 1JKRC 2WBSA 2FQ4A 3BZKA 3OMYA 3H92A 2VONA 3AFHA 2G7UA 3E0JB 2UV1A 4L5EA 2BGCA 2G7HA 5KL7A 1BBGA 1T4NA 2ZO4A 4G7HF 1RESA 3DPLC 2I9IA 2XB5A 1TT0A 1NK2P 2FBKA 4L9TA 1NTCA 3SDBA 3F8NA 4IJAA 1WZ2A 1PDNC 3HTUA 3OYKA 2DDAA 3PL8A 1V5FA 3MKZA 4I2OA 1VQNI 2LTRA 3BZ6A 4S0HB 5ICFA 5CKTA 3WTWC 3A2KA 3ADJA 1MMDA 3OL4A 2QM3A 5FD5A 3EPJA 4N9IA 2VI6A 1KU7A 2LSOA 1N32E 4A0ZA 4KFCA 2EIKH 2DA5A 1J9IA 4XM3A 4A0YA 1UB9A 3LSIA 2UZKA 4DR3E 4F6NA 1ZGAA 2BVMA 4HF0A 2EQ1A 3WE3A 1T56A 2V7FA 3M9AA 1G8XA 2RVCA 5AIPA 5EGOA 4RBOA 2B9DA 3LSJA 1AOYA 2W24A 3J7ZI 5JLXA 1Z6RA 1QNTA 5BPIA 1NK3P 2YTGA 2ELZA 2TCTA 3W6VA 3NWSA 1LQ1A 2EH3A 2ECBA 2L6MA 4M72A 5FB2A 1J2XA 2G0EA 3IWZA 2ENAA 5TGTA 5F0FA 1UN6B 3M1EA 4BGDA 1FSHA 2F5FA 1BI2A 3T5XA 4XR6A 1K6OA 1VI0A 3SJMA 3OIQA 1SMTA 2F5CA 2WBMA 2R5YA 3EUHA 2BB8A 1WFXA 1K4SA 3DP7A 1YJ9I 5BPDA 2DK8A 2NS7A 4QPOA 2GA2A 4YIFA 2PEXA 2QVOA 5K5QA 1Y1VJ 4KDPA 4G6DA 3WTYC 2VN2A 4AQYE 1X4PA 3P7NA 2JT1A 3BCBA 4BJ5C 1J09A 4LG3A 1TP4A 1X4OA 5JHFA 4UVCA 4YRVA 4ZTJA 1FSEA 2D1HA 2XKOA 4D7NA 2Y9YA 4QIWN 1O4XA 1IF1A 2XPUA 4WXCA 5IT9Z 5D5XB 1WHUA 4XLCA 4DR5E 1U8RA 2EPFA 1FYKA 2YSRA 2W00A 5B1BH 3EDPA 4CO8A 2L7ZA 2X85A 3M99B 2OUMA 4FQGA 1R5GA 2LH9A 1QZZA 2R3SA 2V9VA 4BL0B 3B73A 5HDNA 1PUFB 4RDUA 2ISZA 2NUGA 4BXXJ 1RUNA 2M7QA 3L09A 1Q1HA 2JZYA 2K9LA 4HLXA 1DGRM 4MIMA 2VL8A 3QYBA 5LLQA 2V6EA 4E7IA 2KHMA 1H89C 2OA4A 1J7KA 4Q4ZF 3REOA 5B3SH 2NABA 3K2AA 5HDKA 1ACIA 1XMQE 3DEUA 3F8BA 3G2BA 4J01A 3DTIA 1BBOA 2JRTA 5LGUA 1XPXA 3ZQFA 2K9MA 4IHVA 1IJWC 2E5NA 3FDYA 1MNDA 4HNVA 3P9IA 1AWCA 4X9JA 1D1CA 4EGZA 4A3FJ 1SR9A 3GCMA 2WAQN 3V7SA 2OCEA 2VF1A 4XKWA 2BBYA 3PFYA 2QKLB 2QENA 3GFLA 2JY9A 3TGNA 1FLIA 2HDWA 3F0CA 3BTIA 4GCVA 2VIXA 3PUBA 4LF8E 2HVQA 4LOCA 1S7OA 3BG6A 2DK5A 4DUZE 3EUAA 3S1QJ 4HOBA 2DA1A 1ZAOA 2NOJB 2GAUA 5KL2A 2O03A 4OIPF 1WWXA 2PN6A 2V88A 5J47A 1LDDA 3ZQQA 5LL6R 2XAQA 5ILSA 3FXKA 4FK5C 4A0XA 4R2PA 5GAGJ 1FMWA 3EETA 3RIRA 4B44A 1VQKI 3LWFA 2ISYA 1WJFA 2LV2A 5B66C 2IS2A 1P4XA 4GKJE 4H4KC 4BHCA 1BB8A 4CUGA 1XMOE 3ZQCA 2UWMA 4A3MJ 3B02A 4IRGA 1ZN2A 4LIUA 2ZFUA 3BBGA 2KRHA 5L3EA 2EFOA 4DZJA 2XAGA 3SQNA 2VBZA 1SD5A 1HQCA 4X1EA 1Y0NA 1PYVA 1WJEA 3AKZA 1D1AA 4UXNA 2QWWA 3VODA 1H9TA 4ANJA 3G3ZA 2OF7A 4MFDA 2VE9A 1OYIA 2VKHA 3E5XA 1HW2A 3S2HJ 2VQCA 3CMEI 2CTDA 4OIOF 2EMFA 2Q8UA 1ON1A 2ADUA 3FXJA 2DBBA 3A03A 2EOZA 1KJKA 1GLNA 2JVGA 3HBLA 2YTIA 1UZCA 3WTSC 3KEYA 3U2RA 2JWOA 2X1DA 2AO9A 2E2IJ 2HYFA 2CV1A 2Z2SB 5LMNE 3CCLI 2KZGA 1O3TA 3M3YJ 2NOGA 3Q0WA 4HX8A 5HNHA 4OIRF 1RMDA 2A5YB 2Y30A 2FMYA 3KZYA 1P4WA 1C0WA 1FP1D 2EA4A 1AKHA 1WXRA 3HGYA 4Y15A 3A02A 4HZFA 1J59A 3HOYJ 5KK1A 3V8KA 3RPQA 3LAPA 1KYWA 4BS9A 1T98A 4UVAA 4QTRA 4PJLA 4WXDA 3R6SA 1HA8A 3K4JA 4ON0A 3HM5A 3TP0A 1IW7F 2UXDE 2ID3A 4M9ZA 2NVQJ 2R7VA 1MSFC 4PK4A 2EV6A 1YITI 3HXLA 2YR2A 1R1TA 4DV4E 4D1QA 4WYQB 3ML6A 3CLOA 4IL6C 2E5ZA 3C3WA 4F3QA 1XGOA 2J7JA 3KZIC 5H2FC 1JK2A 2GLOA 1W7PA 1T33A 1O0WA 1TL8A 3JRIA 1QGPA 2MD0A 1T4OA 4DR4E 2E7WA 1GXQA 2EZKA 3DU6A 5BOXA 2QBYA 1J5EE 3KLOA 2LTSA 3J81Z 2P4WA 1ON2A 4XN3A 3GX4X 2ZFWA 3EPKA 2MD5A 2XDVA 2EL6A 4XKBA 1Z67A 3HOVJ 4JYKA 3LA2A 3VYSB 3IWFA 1IUFA 4KT6A 5D8LB 4PSWA 1MZBA 3GTJJ 3ECHA 2R1FA 2Q1ZB 1NHAA 2OZ6A 3F22A 1JE8A 1MMGA 4YHHE 3C18A 3OR2C 1F4KA 4M6VA 2EWLA 4DGWB 4YIRX 4IQJA 1O3SA 3A1YA 3BTLA 2EV0A 2YTQA 1G3WA 3OTOE 1JTXA 2E35A 4M73A 2XIGA 1YOVB 1MEYC 2GPIA 2ZSIB 5M5XJ 2FBHA 3CDHA 4ZYAA 2XAUA 3QPHA 4FHTA 2UUAE 5LFAA 2DMPA 5FJ8J 3HOTA 4UUSA 2X6OA 3VFZA 3VYUB 1YJWI 2EJ4A 2EJRA 1DGWY 2X51A 2O0YA 1G6NA 2K7LA 3TO9A 4F52A 3BJ6A 1OCPA 3A0BC 3D5RC 4BE0A 4ESJA 1FKAE 4DR7E 3GTQJ 2JA2A 4JI7E 4Y52J 3DCFA 1K6YA 2WTEA 2BV6A 1JGGA 1HNZE 2RV8A 1T6SA 3WGGA 1NG7A 2F4VE 4JI4E 5F27A 1X48A 5D8KB 3I56I 1IQSA 2MDGA 1ZK8A 2K27A 1SMYF 4CYCA 2FXAA 5HLGA 4DR1E 4YG2F 1XG1A 3O6BB 1HSJA 2V4JC 1N77A 1CGPA 2EZ6A 3BROA 3J7AG 4L9NA 1D0ZA 3S93A 4XICA 2JOXA 4DUYE 2J5OA 3FISA 2EM0A 3D0SA 2DA3A 2RREA 4MGRA 2EL5A 2DFFA 2W82A 1U8BA 2VOOA 1RI7A 1WHQA 3I64A 1OCCH 3HB9A 2KLOA 1R5HA 2EM2A 2VOPA 5L3DA 1FBQA 1A1LA 2EOIA 1R49A 2RQQA 2DQRA 1P92A 3ABMH 4RS8A 2HZDA 5ILUA 4FISA 5CVRA 1XDUA 2W57A 1VZ0A 2EE8A 3V7RA 4BE1A 3E97A 2PX9A 2K5CA 4RM3A 2HTJA 4XONA 2VPLA 3TEDA 2KHXA 2IXSA 4TUIA 3KPHA 1MJAA 4EM0B 2HOAA 3THOB 1WQ2A 4UV8A 2WY7Q 4E7HA 2R7OA 1OCZH 1WJBA 2IW5A 3ZMTA 4M9SA 2HTSA 1USSA 2DN0A 2HQNA 5EZGA 1SD4A 3IWDA 3C4TA 2UUBE 1Z3YA 3FHNA 3GTPJ 3UKGA 2IVMA 5LRSA 3F8FA 2CV0A 2HVRA 3KP2A 5L3CA 4NC7A 2P0WA 3HOUJ 1U5TC 2L9RA 1Z3XA 2V1UA 1W5SA 3EYYA 1X1CA 4XBFA 1YUIA 4HRIA 1MJBA 1Y56A 3COAC 1XS9A 1UAAA 2GA1A 2RS6A 2Y0MA 3JU0A 2O7OA 1BN5A 3OYHA 2LKXA 2YRMA 2FA5A 4Q48A 3R61A 3ZQGA 5EG0A 1A1KA 3IHUA 3JRGA 2JSPA 3OYDA 3L7WA 2JA7J 1MBKA 3S1RJ 3CCSI 2DSYA 1PP7U 2LJUA 1MH3A 4I02A 3VEPA 2V8QB 2YTNA 1TF6A 2ZSHB 1LJ9A 4C3HJ 1YZ9A 3K10A 2JSCA 2B63J 1X1PA 5GADJ 4IO9F 3LMLA 1DPRA 2Y75A 3RZDJ 2PMZA 4M3EA 5J40A 5D5WB 1UFMA 1XGSA 1LB2A 1V3FA 3W2VA 2FOWA 1ERDA 3LMMA 5FKOA 1MKMA 2EOMA 3H5NA 1IN6A 4I7HA 1X58A 3E5UA 2YUSA 3DFGA 2V1DA 5CQEA 3DLAA 3NQOA 3MZ8A 2F5EA 2RKHA 1W7PD 1JI8A 2VKVA 1FP2A 3CDLA 1IRZA 5E1XA 2CSHA 1I1SA 3ZOQB 2VJIA 4JYAE 2PMZN 1EKZA 2R7QA 4NHRA 3AV0A 2YTOA 4LGWA 2JA5J 4BBYA 1T38A 4LB6B 2OD5A 4DV3E 2M87A 3BR1A 2EB7A 1JUMA 5A6JA 2VJ4A 3CCYA 3RKQA 2VXDA 1MSEC 3BGHA 2FBIA 4O5GA 1IV6A 4B3SE 2UUZA 2A05A 1LFUP 1W36C 3QU6A 2EMGA 2E60A 3DF8A 4LITA 2WAFA 3W6JB 3JRDA 2EPZA 1E3PA 2ZNZA 2DODA 2D45A 2EQ0A 3AG2H 5E1ZB 4XN0A 5LHGA 3GBGA 4RA2A 2RGVA 4MEXF 4EM2A 3VYYA 3JAMC 3GVAA 3CMMA 2Z16A 3HG9A 1U0JA
chains in the Genus database with same CATH topology
3IKTA 2IP2A 4U7BA 2DFIA 3MCZA 4I0AA 4XRFA 1P4AA 2EK5A 2JPBA 4BNCA 2DW4A 2XROA 2J5PA 1LNWA 1TQPA 2UXNA 2ZNYA 4HBLA 2KIFA 1L0OC 2AXLA 4A6DA 1VTNC 2R7FA 2O8XA 2H27A 5HLHA 4Q5SF 3RKYA 3D5LA 1QZYA 2HZTA 4KIFA 5ICCA 1XB4A 3FHZA 1U3EM 1ULYA 3HHGA 4KIGA 1STZA 4JQFA 1DDNA 2A6EF 1J5YA 4A6EA 3I53A 5FLXZ 2PQ8A 3FMSA 4IHTA 2PG4A 2CYYA 2YPRA 3I0TA 2YX7A 1S8NA 1T0FA 4G7ZF 2R7DA 4EQQA 4D0PA 1ZG3A 3WTZA 1UHMA 5LHHA 3FM3A 5D4SA 3I59B 4Y17A 1R1UA 4P9UA 3KETA 3KP7A 1QO0D 3DXJF 2OQGA 3W6KB 1X3UA 5J8CA 1TW2A 2TDXA 2QUFA 4RB0A 4HYEA 3FMQA 1U5TB 4OU0A 4RGSA 5CYVA 4FT8A 2KKOA 2XAJA 1B9MA 4HF1A 4MEYF 5BS6A 1J0RA 1DPUA 1LVAA 4A2UA 1IN4A 5E8IA 5F64A 2DLLA 2RNJA 5ICGA 3MAJA 1TQIA 2W84A 4I01A 3LA7A 2Q8KA 4DNCA 2VC0A 3QRFF 4MNUA 2DI3A 2ESHA 1XSDA 1TW3A 4OMYA 3T8RA 4ZH4F 1TTYA 1XCBA 2CO5A 3KLNA 1R00A 5IT9K 2RC4A 1B1BA 5DYMA 5E18F 1ONVA 3JAMZ 5J8FA 5HS9A 2B0LA 1GVJA 2RN7A 2L01A 1ZRFA 1PP8F 3NEUA 4S05A 3BWGA 1S3JA 5HDGA 4PZJA 5D5UB 2V79A 4LD5A 1BJAA 4RB1A 2Z3YA 3C1DA 4ESFA 5LGNA 3WTTC 1JXSA 1K7AA 2VBYA 3SHFA 3J80Z 2P5VA 3I71A 3P9CA 4GYGA 2FOKA 1UHWA 4EJTA 3VOEA 2ACJA 3ZMZA 4G7OF 3F6OA 2L3DA 1V4RA 3WU1B 1JHFA 4XLNF 2GZWA 2L54A 2BE5F 2HOEA 5KVRA 1BIAA 4FX0A 3HSRA 1XN7A 3L9FA 3BOQA 1KU2A 3C7JA 3MQ0A 5CLSA 5CVVA 1U2WA 4LLNA 2BYVE 1YS6A 2FMLA 2DAOA 3U1DA 3IRQA 3WTXC 2FSWA 2Z9OA 1QPMA 2EFPA 3N4MA 5JR3A 1MD0A 3ZPLA 4IVNA 1ZLJA 5DCMB 2NS0A 1WSUA 4P55A 3K1MA 3K2ZA 2A68F 4WX9A 1MDMA 1QQIA 1IN5A 4BQAA 2Y48A 3IL2A 3GLXA 4Q47A 2STTA 3SZTA 1YIOA 4LG0A 3IRRA 3F23A 1OMIA 4QLCU 3KCCA 1XDSA 1BC8C 2CWEA 1D8JA 3BPXA 4Z2YA 4WCGA 2P6SA 2WWYA 2VT2A 1S29A 2VBWA 5HLIA 3CUQB 3CO7C 1R7JA 3I58A 5J6XA 5HOOA 4R8HA 5K5RA 1R23A 1MGTA 2DTRA 4PCQA 4DQ2A 4N9HA 4IF4A 3ECOA 3F8CA 4P9FA 2Z99A 4M9XA 1XCVA 2M1BA 3BPVA 3WG9A 3L2CA 2A07F 1F5TA 2YX4A 2JPCA 2QQ9A 5D4RA 3KEQA 5BMZA 2IA2A 3FX3A 2M30A 2EWNA 4YFNF 5TRDA 4KA4A 1CF7A 2DO7A 1TNTA 2LNBA 4MTDA 1E17A 4UV9A 2GIVA 3ELKA 5LEKA 1G3SA 2KJCA 3QOPA 5CVJA 2EFNA 4PGGA 4O6JA 4OOIA 4PDKA 1FC3A 2VXZA 2LF8A 2XV4S 4AVPA 4HX7A 1G3YA 4HW0A 2XKPA 1YO5C 5ICEA 3R0AA 1UCRA 1XSVA 5FD6A 3F8MA 4WK8F 1BI1A 1LEAA 2D1VA 1ZRCA 3S2WA 3OOPA 1KGSA 2CW0F 1OKRA 3NRVA 2VODA 2EA2A 1SD6A 1FT9A 1BIBA 1FPQA 2P7CB 1ZRDA 5CVUA 2XASA 1O7LA 5H20A 3TDZC 1HKQA 3GW2A 4U7DA 1KA8A 3JSOA 1KQ8A 1Y0UA 4KMUX 4MHGA 5ERIA 3I5UA 2L4MA 1EH8A 1MJ9A 1WI9A 3MWMA 2NNNA 1ZLKA 3GXOA 2RQPA 5IT3A 4ZZDA 2OQRA 3WTVC 1BM9A 2CQKA 1H9GA 4B09A 4G6QA 3FXQA 4R79A 4OINF 2MH9A 2LKPA 4U0YA 3F72A 3FZVA 2MH2A 4HA8A 2OZUA 4CHUA 1U5TA 4ENNA 1J75A 1WKMA 3BY6A 3RTRA 3KP5A 1SFEA 1K78B 1BBYA 2HS5A 3TKYA 4EJUA 1KQ0A 5DDGA 1IXSB 4EJWA 4AIJA 2CGPA 1FBSA 5L3BA 4WWCA 1BC7C 1YW8A 1XD7A 1LEBA 3FXUA 2GXGA 2A69F 2DU9A 1IXCA 1GHCA 2Q2EA 5TJJA 1IZ1A 3Q5FA 3WGHA 2K4JA 3GEZA 2Z5UA 4GO1A 2A6HF 5LEJA 2QLZA 3TO7A 3M8EA 2VBXA 4IRHA 1SAXA 3GFJA 4BHPA 1H0MA 1E2XA 1U6GA 2LF7A 1DUXC 2GQQA 3KE2A 3KP3A 2CFXA 5JI6A 4IHSA 4KMFA 3GFIA 2XUBA 4HLYA 5HS8A 4HV6A 1B59A 3HRUA 2QBYB 1TQMA 3JW4A 3RYPA 2DPDA 1XMAA 1EH6A 3R0JA 4UUVA 1T39A 2QYOA 4FX4A 3FXRA 1U78A 2PBIA 3M7GA 1L3LA 2F5DA 4BHBA 4QWQA 2L02A 3GO5A 5E1WA 2NAZA 1W4MA 3HRSA 3ZN1A 3E6MA 1ZYRF 2FU4A 3N97A 1R22A 3LAJA 2STWA 4XSZF 1IN7A 1G4DA 4LK0F 2KIUA 3KZZA 3DPTA 4IXAA 1HKSA 4G9YA 1GXPA 3E6BA 2V1XA 1FZPB 4A12A 2EV5A 5D6FA 1W5TA 4CYDA 1Z7UA 3ZN0A 3RPUA 5FFZA 4LLLA 1YYVA 3JAMK 2A61A 3HSEA 3WE2A 1QBJA 3CUOA 3F6VA 3ZQ7A 3CUQC 5DD4A 5HS7A 5DEQA 2QZ8A 1FYLA 2YU3A 2HYGD 4A5MA 5F6FA 4KNYA 2H94A 1YS7A 4WF2A 5E17F 2Z33A 2H6CA 5DD8A 2XGXA 3GWZA 4HAMA 1IN8A 4S04A 2JTVA 2GWRA 3E3VA 3VB2A 3PQJA 1WRJA 3ROUA 1DP7P 3J80K 1B6AA 3CTAA 2D2WA 3H3UA 2PMHA 3MFKA 3V8JA 4HV5A 1SFXA 1O3QA 4TV7A 3BDDA 2HKOA 3LA3A 3IKVA 4KIBA 5CJ9A 4P96A 5ILVA 2FQ3A 2M45A 2OU2A 1ZG5A 3GYHX 1HW5A 3EYIA 4RB3C 1D5VA 2COMA 3HTSB 5CVIA 4H0EA 2WC2A 3GFMA 2W25A 1OPCA 2HQRA 2X0LA 4IPAA 4EVIA 3U9GA 4XSXF 3T8TA 2P7VB 2DQLA 5D6EA 4CXFA 2UXXA 3FF5A 2GXBA 3JTHA 3CJNA 2KJBA 5FGMA 1SD7A 1ZHFA 2O61A 4ZYDA 4IRIA 4L9JA 2IA0A 5A2QZ 1P6RA 4KN4X 1F1ZA 3HOSA 1B9NA 4RGUA 1KYZA 1YQAA 2KRFA 3EQLF 4ESBA 3ZMDA 2HFHA 3H3ZA 1IRFA 5EEGA 1OYYA 3RKXA 3TDUC 1ZH5A 2O3FA 3KP4A 1T2KA 1YTYA 3ABTA 2FEZA 3HRTA 2DPUA 1YLFA 3CO6C 4ETSA 1K79A 4O5VA 1D3YA 2WV0A 4XLPF 5ED4A 1ZREA 4ENKA 1XGMA 3MEXA 5L3FA 3QPTA 4U0WA 4I09A 1TBXA 3SXYA 4UHTA 3QP6A 2IPQX 2P8TA 1HW1A 1O57A 4BH9A 1RUOA 4HDVA 2PJPA 1FX7A 2HGCA 3QAHA 2NRAC 2FE3A 5K5OA 1R1VA 4L0YB 5LBQA 4P5OA 3WGIA 5AONA 4EJVA 2F2EA 4UVBA 3G73A 1SFUA 1K78A 2PI0A 4RGXA 1BOAA 2VT3A 3J81K 4LB5A 5HVQC 2MC3A 5H6RA 4R1HA 1TNSA 4ZYHA 1RNLA 4M6XA 1IXRC 1HSTA 4OIQF 1IRGA 4HX4A 1O3RA 3HUGA 2XRNA 2XVCA 3TQNA 3WODF 3KFWX 4MTEA 4CZZA 4NB5A 1HKTA 5JVTA 2ZMEB 4K2EA 4HQEA 1R58A 1I6XA 3TOBA 2HKXA 2OAZA 3KP6A 1Z91A 2NYXA 1YW7A 5LRRA 2NNYA 3SZPA 2ESNA 5FFXA 4ZZLA 2IT0A 3K9TA 2P6TA 2P5KA 4U88A 4BYYA 1ZARA 2IJLA 5E20A 4JK1X 4AIHA 4HQMA 3JTGA 2ELHA 4RB2C 2FF4A 4GYIA 4GGGA 3MZHA 2FNAA 4EJOA 1IUYA 1FWZA 1REPC 4NHJA 6PAXA 1R36A 1A04A 4CGZA 4LMYA 1YFHA 4L0ZB 1Z05A 1B4AA 4UNOA 2AS5F 4AIKA 2ZBKA 2OBPA 3DV8A 4A5NA 3DQVC 1HXDA 2IRFG 4GXOA 2ZJ2A 3BJAA 3T0YA 5JHUA 3HIFA 1FYMA 3T1BA 3Q9SA 2O6GE 5K1YA 3GZ5A 4KUMA 3TOAA 3LSTA 1ZG1A 2DT5A 2ZKZA 3IC7A 1FBUA 4EMSA 1KQ9A 3ABUA 2IA1A 4F7ZA 3HRMA 5DV5A 5DUIA 4EM1A 2FRHA 4Y13A 1FNNA 4L5JA 2W85A 2V6CA 3QU3A 4KN7X 1S6LA 4G94A 2E1CA 3I59A 3HHHA 4G8XA 4ZYGA 4AWXB 3WU0A 1S7AA 2K4BA 2E7XA 3HSFA 1BI3A 1RIOH 3MZYA 1JGSA 4N0BA 3E6DA 4PGHA 1MDMB 2MLGA 1LDJA 5JFRA 3I4PA 3QP5A 4MQVA 4LLGF 2G9WA 2C6YA 3R60A 5EEHA 4LG0B 1OYWA 3RI4A 4OMZA 4RAYA 3LFKA 3F3XA 1IAWA 4ENJA 4M71A 2Q0OA 3GUDA 3FM5A 4B8XA 4BXUA 3JSPA 1KU3A 1ZGJA 2K02A 4KYWA 3V8LA 4JBAA 5LHIA 3K1NA 2HR3A 2X4HA 1HBXG 3V4GA 1EH7A 1D8KA 4MQ9F 3Q9VA 4ASNA 3KEOA 2XHKA 5DCFA 4NQWA 3RKWA 4I0BA 4ENMA 3RDIA 2ZCWA 3J7AO 3V7CA 5BQTA 5L3GA 2P5LC 5DUKA 4YIIA 1I1GA 3FMRA 3RJPA 2L4AA 3GF2A 1W7PB 4EGYA 1XMKA 3RYRA 2HDCA 4O3MA 1ODDA 5FLXK 2CSOA 3R4KA 2A3SA 1CF7B 2BEOA 4L9VA 3ZMVA 3F21A 1P2FA 3ZMUA 2MLKA 3K1PA 3LQQA 3O3KA 3SFZA 2RDPA 1OR7A 3E5QA 4YFKF 2VE8A 5H6QA 3BJOA 2PLYA 5AIQA 1KU9A 2LDUA 2QQAA 1JHHA 4I98B 2M8EA 3LQRA 4M6YA 4RAZA 5E8GA 2M5WA 3AAFA 2ETHA 5F1RA 2EFWA 3WTUC 3K69A 1EV7A 2XAHA 3TO6A 4YFXF 2H6BA 3P9KA 3OV8A 5FO5A 3GZ6A 4EV0A 3O2PE 1TLHB 4L5IA 2HEOA 1LDKB 4WXHA 2CG4A 5LGTA 4ZYEA 2PFBA 2E1NA 4LK1F 3ISPA 5DCMA 2ZXJA 4LFUA 3PFIA 4KT5C 1XSXA 1I5ZA 2K86A 4E70A 3I54A 3L00A 3FWEA 1Z9CA 5D5VB 4CDGA 3ERED 4RGRA 2MA3A 4L18B 1BI0A 4HDUA 4HF2A 1PUEE 4CICA 2VC1A 1YG2A 2KIMA 2FNPA 4LJZF 1Z6TA 1F9NA 2EFQA 3M8FA 1XGNA 1RZ4A 3ULQB 1FOKA 1G3TA 1Z1DA 3ZP5A 3PQKA 3CUQA 3E6CC 1FY7A 3DKWA 3HYIA 4M74A 2HWVA 3BP8A 1YW9A 4BAYA 4U0VA 4AD9A 3ZMSA 2PMUA 3K0LA 1O7FA 2MBFA 4KICA 2H09A 2ZMEA 1I27A 2XAFA 1USTA 5A2QK 2QQBA 3H92A 2VONA 2G7UA 2BGCA 2G7HA 2ZO4A 4G7HF 3DPLC 2FBKA 4L9TA 3F8NA 4IJAA 1PDNC 3HTUA 4I2OA 3BZ6A 5ICFA 3WTWC 2QM3A 5FD5A 4N9IA 1KU7A 2LSOA 4A0ZA 4KFCA 1J9IA 4A0YA 1UB9A 2UZKA 1ZGAA 4HF0A 3WE3A 3M9AA 5AIPA 2RVCA 1AOYA 2W24A 1Z6RA 1QNTA 5BPIA 1LQ1A 4M72A 5FB2A 1J2XA 3IWZA 3M1EA 1FSHA 2F5FA 1BI2A 3T5XA 1K6OA 1SMTA 2F5CA 3EUHA 3DP7A 5BPDA 2DK8A 2GA2A 4YIFA 2PEXA 2QVOA 5K5QA 4KDPA 4G6DA 3WTYC 2VN2A 3P7NA 2JT1A 4UVCA 1FSEA 2D1HA 2XKOA 1IF1A 4WXCA 5IT9Z 5D5XB 1U8RA 1FYKA 2YSRA 3EDPA 4CO8A 1R5GA 1QZZA 2R3SA 2V9VA 5HDNA 3B73A 2ISZA 1RUNA 3L09A 1Q1HA 2JZYA 4HLXA 5LLQA 2OA4A 1J7KA 4Q4ZF 3REOA 5HDKA 3DEUA 3F8BA 2JRTA 5LGUA 3P9IA 1AWCA 4EGZA 3V7SA 2BBYA 2QENA 3GFLA 3TGNA 1FLIA 4GCVA 1S7OA 2DK5A 4HOBA 1ZAOA 2GAUA 2O03A 4OIPF 1WWXA 2PN6A 1LDDA 2XAQA 5ILSA 4A0XA 3EETA 3RIRA 3LWFA 2ISYA 1P4XA 4BHCA 2UWMA 3B02A 4IRGA 1ZN2A 5L3EA 2EFOA 2XAGA 3SQNA 2VBZA 1SD5A 1HQCA 4UXNA 2QWWA 3VODA 1H9TA 3G3ZA 2VE9A 1OYIA 3E5XA 1HW2A 4OIOF 1ON1A 2ADUA 2DBBA 3WTSC 3U2RA 2HYFA 1O3TA 4HX8A 4OIRF 2A5YB 2FMYA 3KZYA 1P4WA 1C0WA 1FP1D 2EA4A 4Y15A 4HZFA 1J59A 5KK1A 3V8KA 3RPQA 3LAPA 1KYWA 1T98A 4UVAA 4WXDA 3R6SA 4ON0A 1IW7F 4M9ZA 2EV6A 2YR2A 1R1TA 3ML6A 3CLOA 3C3WA 1XGOA 1W7PA 1QGPA 2E7WA 1GXQA 5BOXA 2QBYA 3KLOA 3J81Z 2P4WA 1ON2A 3GX4X 2ZFWA 2MD5A 3LA2A 3IWFA 5D8LB 1MZBA 3ECHA 1JE8A 1NHAA 2OZ6A 3F22A 3C18A 1F4KA 1O3SA 2EV0A 1G3WA 4M73A 2XIGA 2FBHA 3CDHA 3QPHA 4FHTA 3HOTA 3VFZA 2EJRA 3TO9A 2O0YA 1G6NA 2K7LA 4ESJA 3BJ6A 2WTEA 2BV6A 2RV8A 1T6SA 3WGGA 5D8KB 2K27A 1SMYF 2FXAA 5HLGA 4YG2F 3O6BB 1HSJA 1CGPA 3BROA 4L9NA 2J5OA 3D0SA 4MGRA 2VOOA 1RI7A 3I64A 1R5HA 2VOPA 5L3DA 1FBQA 2DQRA 1P92A 4RS8A 5ILUA 5CVRA 1XDUA 2W57A 3V7RA 3E97A 2HTJA 1MJAA 4EM0B 1WQ2A 4UV8A 2IW5A 3ZMTA 4M9SA 2HTSA 1USSA 2HQNA 1SD4A 2IVMA 5LRSA 3F8FA 3KP2A 5L3CA 1U5TC 2V1UA 1W5SA 3EYYA 4XBFA 1MJBA 3COAC 2GA1A 2Y0MA 1BN5A 2FA5A 4Q48A 3R61A