2RSIA

Solution structures of the dna-binding domains of immune-related zinc-finger protein zfat
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
GSSGSSGKPYKCPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLIKHIRDAHDPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Zinc finger protein ZFAT
publication title Solution structures of the DNA-binding domains of immune-related zinc-finger protein ZFAT
rcsb
source organism Homo sapiens
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13909 zf-H2C2_5 C2H2-type zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rsiA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rsiA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rsiA03
4M9VC 2EOEA 2DLQA 2EOHA 2YU8A 5KL7A 1BBOA 4X9JA 2YTGA 1X5WA 1NCSA 2EMAA 2EN6A 2J7JA 2EOMA 1Z1BA 1UBDC 2EL5A 4F6NA 1MEYC 4F6MA 1YUJA 2EOJA 4FK5C 2EMFA 2EMGA 2YSPA 2WCC3 2EMCA 3VHTB 3EPKA 1JK1A 2ELZA 3EPJA 2BB8A 3EPLA 2EMKA 2MKDA 2YSOA 2EM9A 2NABA 2VRDA 1TF3A 1X6HA 2EN8A 2EMIA 1F2IG 1RMDA 2WBUA 2GHFA 2EPPA 2EM3A 2EMLA 2YTIA 2EN1A 2EM8A 1ZU1A 2LV2A 3M99B 2WBSA 2EPAA 2A25A 2EL4A 1A1HA 4R2EA 5KL4A 1A1JA 2YRKA 3UK3C 2EMXA 2EPZA 2JPAA 2YTOA 2EOXA 1DGCA 2EM7A 2EOYA 2EM2A 2EM6A 2PRTA 2EOIA 2YTNA 1ZAAC 2ELYA 4R2DA 1A1LA 2YTDA 4R2AA 2EMYA 2YTJA 2LVHA 2EM4A 2EOQA 2EN3A 2EOSA 2YTFA 4R2CA 2E72A 2EPRA 2EN7A 2YU5A 5KL6A 1G2FC 2DMIA 2CSHA 2ENAA 2HGHA 2ADRA 2R1FA 4WSGA 4GZNC 4R2PA 2MKNA 1ZR9A 2EORA 4IS1C 5KL5A 2EOZA 1A1GA 2D9HA 2CTDA 2YTPA 1P47A 1X6EA 2EOOA 2MDGA 5KL2A 2YRHA 2EQ3A 1WJPA 1AAYA 1UN6B 2ENCA 1BB8A 5KL3A 2GLIA 2ENHA 2M9AA 2RSIA 2EN4A 2CT1A 2DLKA 3MHSC 2EOFA 1X3CA 2EQ0A 1B69A 2JP9A 2YTQA 2DGCA 2EPCA 2RPCA 4R2SA 2WBTA 3EPHA 2EN2A 2YTEA 2EM5A 2EPUA 2EPXA 2DRPA 1A1FA 4IJDA 1G2DC 2EE8A 1A1KA 4R2RA 1YSAC 1TF6A 1YUIA 2EMHA 1A1IA 2EP3A 2LO3A 2EQ1A 4F2JC 2LT7A 1KJKA 2LCEA 1LLMC 2EMBA 2I13A 2EJ4A 2EMWA 2EL6A 3MHHC 4R2QA 2EM0A 2YRMA 1JK2A 1TN9A 2EMZA 1X6FA
chains in the Genus database with same CATH superfamily
1WXRA 5KL7A 3AV0A 4DV0E 3HPZA 2EN6A 2LTRA 2EPMX 1XMOE 4F54A 2L3CA 5A69A 1YZ9A 1J26A 1YUJA 2YT4A 2FGGA 2N8XA 3C4BA 3HXLA 2EMFA 3VHTB 2BBGA 4DMIA 3JTZA 4YY3E 4M30A 3EPLA 3VYYA 2EMKA 1YPNA 2B9DA 2NABA 2VRDA 3HPSA 3ADIA 2EMIA 2LE2A 4WFTA 5TSEA 2EM3A 5AE2A 2YTIA 1FJGE 2EM8A 3C6MA 4JI7E 3IWDA 1WHQA 2G7HA 2N3GA 3K6QA 1DQ3A 1XNRE 2F8BA 3OTOE 4ZYDA 4LF4E 3DJWA 2EPZA 2JPAA 1N36E 5LMNE 2E5LE 4X66E 2EM2A 2PRTA 1ZAAC 2ELYA 1A1LA 2KOUA 2M4IA 3VK6A 4AQYE 3F6GA 1ZBTA 5KL6A 5AE1A 2RS7A 2HGHA 2MKNA 3MSWA 1X48A 4IS1C 5KL5A 1A1GA 4GKJE 5LMUE 4JI3E 4O4KA 4X65E 1PDAA 4BC9A 2ODRC 3THNA 2HJJA 1UN6B 5AC4A 2ENCA 1GTKA 2ZM6E 2ENHA 2GLIA 2RSIA 2EN4A 2YZTA 4NZVA 3EQ1A 2EQ0A 1B69A 2KONA 2WBTA 2YTEA 5IWAE 2DRPA 4IJDA 1G2DC 2M7QA 5LL6R 4B3SE 4WSPA 2JOBA 1HNWE 4O24A 2JWOA 1EH8A 1XMQE 1N33E 1N34E 4KHPE 4N4RB 2EPKX 2L8TA 4P7DA 3C4TA 1I94E 2I13A 2EMWA 4LTYA 2N3HA 4DV7E 1IBME 2V89A 1EKZA 3BF2A 4M9VC 2EOEA 2DLQA 2DSYA 3T1YE 2DIXA 1BBOA 2YTGA 1HR0E 4LF9E 4KWYA 3J7AG 3ADJA 2JYAA 5DNYA 2JR1A 3ADGA 2EOMA 2UXDE 2EPOA 2VQFE 5T6JA 2EL5A 2V83A 5IT9C 4BC7A 1MEYC 1EH6A 2ODRD 4F6MA 4JV5E 4X64E 2WCC3 2NUEA 2EMCA 2V85A 3AUZA 2L2MA 3EPJA 2F4VE 1WRJA 4NXME 2EM9A 2JY9A 4Q35B 2LMZA 1X6HA 2LTSA 2E1MA 2EPPA 4GKKE 2EN1A 1PJTA 2LV2A 1IQSA 4JI0E 2EPNA 2A25A 2EL4A 1A1HA 4R2EA 5KL4A 5A2QC 2YRKA 3UK3C 2EMXA 2UXBE 1N3GA 2EOXA 4DV1E 2EM7A 4HEIA 2EOIA 2LVHA 4F9BB 4ZYGA 1HNZE 2GPIA 5AE3A 4X8WA 2ENAA 2L3JA 2ADRA 4NXNE 3HTXA 2EORA 2B7TA 1QNTA 4I8OA 2CPNA 2EOZA 3L00A 2L2KB 2CTDA 2YWQA 3FIGA 4B3TE 1DI2A 1X6EA 5KL2A 2LUQA 2JOXA 2EQ3A 1EH7A 1YYKA 1WJPA 2NA2A 1SFEA 1BB8A 1GQEA 4LU9A 1WHNA 3VYXA 1T4OA 1X49A 1BBGA 2B3TB 4JI2E 2DLKA 3MHSC 1YFHA 4LF5E 4BHCA 2JP9A 2DGCA 4DR4E 1J5EE 4R2SA 3EPHA 2EPUA 4OX9E 1A1KA 4GEQB 4X62E 1TF6A 5A6BD 4DV2E 2EP3A 2LO3A 2VF1A 1HNXE 4F2JC 2UUCE 4JI4E 2FV4B 2JVAA 1L4SA 2EMBA 2LUPB 2FTXB 2YRMA 2EMZA 4DUYE 1X5WA 3IWCA 3ECRA 1UILA 2J7JA 1X47A 1Z1BA 1T4NA 1UBDC 2EWLA 4L5NC 3T1HE 4F6NA 2LJUA 2H36X 2K4VA 2EOJA 4FK5C 1ZBQA 2EMGA 1AH5A 3LMLA 4WYQB 3QG5C 3EPKA 1JK1A 2UU9E 1XNQE 4LFAE 1IBLE 2V88A 1IMUA 2LBSB 4TUGA 2DMYA 2EN8A 4ZYEA 1F2IG 2WBUA 2GHFA 3BGHA 2EMLA 2VE7C 2I9IA 5A6KA 2WBSA 2EPAA 2HHHE 1T38A 4P78A 3THOB 1T39A 1FKAE 2V87A 4L8NA 4JI5E 2YTOA 4DKKA 4DV3E 4DV5E 1T4LB 4WX9A 1DGCA 3BBGA 2RS6A 3JU0A 2EM6A 2MDRA 4J8ZA 4R2DA 2Q8UA 4DV6E 4R2AA 2EMYA 2YTJA 1RC7A 2WZOA 2EM4A 2EOQA 2YPNA 4R8OA 4BHBA 4JI6E 2EOSA 2YTFA 4R2CA 2E72A 2EPRA 1SR9A 2EN7A 1IQOA 1G2FC 2CSHA 2R1FA 4WSGA 4R2PA 5IV8B 3LLHA 2M1SA 4K0KE 2VQEE 2D9HA 3RMPA 1P47A 2EOOA 2MDGA 2B7VA 1PJQA 2YRHA 4F9AB 5AASA 4JI8E 1AAYA 5KL3A 4BBYA 2M9AA 4BMJA 5FLXC 2CT1A 3KZZA 1KYQA 2EOFA 2YTQA 2EPCA 4KZSA 4LF8E 2EN2A 2L33A 2EM5A 2EPXA 1A1FA 2NUFA 4R2RA 4JYAE 1A1IA 1PKPA 1MGTA 4WPYA 2EQ1A 4M0VA 2LT7A 4M2ZA 3P1XA 3J81C 5A6JA 1LLMC 2EJ4A 2EL6A 4R2QA 2EM0A 1JK2A 4F9CB 1UHZA 5ADZA 1TN9A 4DR3E 2EOHA 2YU8A 2MC6A 2RTXA 3OMLA 4NHRA 2EMAA 1NCSA 5AC5A 4X9JA 3JAMC 4WXDA 2UUBE 3ADLA 4TUIA 4DR1E 2HC5A 2LRSA 5BR8E 4DR2E 2NUGA 3F6HA 4BS9A 2YSPA 4B3RE 4Q28A 1YYWA 4LFBE 3J80C 4R03A 3HQ1A 2ELZA 4OOGC 2BB8A 2MKDA 2YSOA 4RH8A 5LLQA 1TF3A 1O0WA 1N32E 4LF6E 1RMDA 2MC5A 5A6AA 5A6BA 1GZ6A 5F3WA 2LJHA 1RQ0A 1ZU1A 4BCAA 3M99B 1QU6A 1IBKE 1YYOA 1A1JA 4JI1E 2UUAE 3DF6A 3KZYA 2EOYA 4DUZE 3KWRA 4MLVA 2YTNA 3BIDA 2YTDA 3IWBA 2EPLX 2EN3A 2YU5A 2DB2A 2JXPA 2DMIA 4DR7E 4GZNC 1ZR9A 4LFCE 1NEIA 2EZ6A 4MLQA 3C6KA 3H09A 2YTPA 2L6MA 4DR5E 5CFFE 4O5GA 4RHBB 2RQLA 4O43A 3TQMA 1STUA 3J7Yp 1X3CA 1PJSA 4HTGA 2RPCA 4WXCA 5IXMB 4DR6E 4DV4E 2V8QB 4ZYHA 2EE8A 1YSAC 1YUIA 2KHXA 4LF7E 2EMHA 2L92A 2L2NA 3ZOQB 1KJKA 4B3ME 2LCEA 2R76A 4YHHE 2UXCE 2RSMA 3MHHC 2K7IA 2IHR1 2V86A 1X6FA
chains in the Genus database with same CATH topology
4M9VC 2EOEA 2DLQA 2EOHA 2YU8A 5KL7A 1BBOA 4X9JA 2YTGA 1X5WA 1NCSA 2EMAA 2EN6A 2J7JA 2EOMA 1Z1BA 1UBDC 2EL5A 4F6NA 1MEYC 4F6MA 1YUJA 2EOJA 4FK5C 2EMFA 2EMGA 2YSPA 2WCC3 2EMCA 3VHTB 3EPKA 1JK1A 2ELZA 3EPJA 2BB8A 3EPLA 2EMKA 2MKDA 2YSOA 2EM9A 2NABA 2VRDA 1TF3A 1X6HA 2EN8A 2EMIA 1F2IG 1RMDA 2WBUA 2GHFA 2EPPA 2EM3A 2EMLA 2YTIA 2EN1A 2EM8A 1ZU1A 2LV2A 3M99B 2WBSA 2EPAA 2A25A 2EL4A 1A1HA 4R2EA 5KL4A 1A1JA 2YRKA 3UK3C 2EMXA 2EPZA 2JPAA 2YTOA 2EOXA 1DGCA 2EM7A 2EOYA 2EM2A 2EM6A 2PRTA 2EOIA 2YTNA 1ZAAC 2ELYA 4R2DA 1A1LA 2YTDA 4R2AA 2EMYA 2YTJA 2LVHA 2EM4A 2EOQA 2EN3A 2EOSA 2YTFA 4R2CA 2E72A 2EPRA 2EN7A 2YU5A 5KL6A 1G2FC 2DMIA 2CSHA 2ENAA 2HGHA 2ADRA 2R1FA 4WSGA 4GZNC 4R2PA 2MKNA 1ZR9A 2EORA 4IS1C 5KL5A 2EOZA 1A1GA 2D9HA 2CTDA 2YTPA 1P47A 1X6EA 2EOOA 2MDGA 5KL2A 2YRHA 2EQ3A 1WJPA 1AAYA 1UN6B 2ENCA 1BB8A 5KL3A 2GLIA 2ENHA 2M9AA 2RSIA 2EN4A 2CT1A 2DLKA 3MHSC 2EOFA 1X3CA 2EQ0A 1B69A 2JP9A 2YTQA 2DGCA 2EPCA 2RPCA 4R2SA 2WBTA 3EPHA 2EN2A 2YTEA 2EM5A 2EPUA 2EPXA 2DRPA 1A1FA 4IJDA 1G2DC 2EE8A 1A1KA 4R2RA 1YSAC 1TF6A 1YUIA 2EMHA 1A1IA 2EP3A 2LO3A 2EQ1A 4F2JC 2LT7A 1KJKA 2LCEA 1LLMC 2EMBA 2I13A 2EJ4A 2EMWA 2EL6A 3MHHC 4R2QA 2EM0A 2YRMA 1JK2A 1TN9A 2EMZA 1X6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9V C;  2EOE A;  2DLQ A;  2EOH A;  2YU8 A;  5KL7 A;  1BBO A;  4X9J A;  2YTG A;  1X5W A;  1NCS A;  2EMA A;  2EN6 A;  2J7J A;  2EOM A;  1Z1B A;  1UBD C;  2EL5 A;  4F6N A;  1MEY C;  4F6M A;  1YUJ A;  2EOJ A;  4FK5 C;  2EMF A;  2EMG A;  2YSP A;  2WCC 3;  2EMC A;  3VHT B;  3EPK A;  1JK1 A;  2ELZ A;  3EPJ A;  2BB8 A;  3EPL A;  2EMK A;  2MKD A;  2YSO A;  2EM9 A;  2NAB A;  2VRD A;  1TF3 A;  1X6H A;  2EN8 A;  2EMI A;  1F2I G;  1RMD A;  2WBU A;  2GHF A;  2EPP A;  2EM3 A;  2EML A;  2YTI A;  2EN1 A;  2EM8 A;  1ZU1 A;  2LV2 A;  3M99 B;  2WBS A;  2EPA A;  2A25 A;  2EL4 A;  1A1H A;  4R2E A;  5KL4 A;  1A1J A;  2YRK A;  3UK3 C;  2EMX A;  2EPZ A;  2JPA A;  2YTO A;  2EOX A;  1DGC A;  2EM7 A;  2EOY A;  2EM2 A;  2EM6 A;  2PRT A;  2EOI A;  2YTN A;  1ZAA C;  2ELY A;  4R2D A;  1A1L A;  2YTD A;  4R2A A;  2EMY A;  2YTJ A;  2LVH A;  2EM4 A;  2EOQ A;  2EN3 A;  2EOS A;  2YTF A;  4R2C A;  2E72 A;  2EPR A;  2EN7 A;  2YU5 A;  5KL6 A;  1G2F C;  2DMI A;  2CSH A;  2ENA A;  2HGH A;  2ADR A;  2R1F A;  4WSG A;  4GZN C;  4R2P A;  2MKN A;  1ZR9 A;  2EOR A;  4IS1 C;  5KL5 A;  2EOZ A;  1A1G A;  2D9H A;  2CTD A;  2YTP A;  1P47 A;  1X6E A;  2EOO A;  2MDG A;  5KL2 A;  2YRH A;  2EQ3 A;  1WJP A;  1AAY A;  1UN6 B;  2ENC A;  1BB8 A;  5KL3 A;  2GLI A;  2ENH A;  2M9A A;  2RSI A;  2EN4 A;  2CT1 A;  2DLK A;  3MHS C;  2EOF A;  1X3C A;  2EQ0 A;  1B69 A;  2JP9 A;  2YTQ A;  2DGC A;  2EPC A;  2RPC A;  4R2S A;  2WBT A;  3EPH A;  2EN2 A;  2YTE A;  2EM5 A;  2EPU A;  2EPX A;  2DRP A;  1A1F A;  4IJD A;  1G2D C;  2EE8 A;  1A1K A;  4R2R A;  1YSA C;  1TF6 A;  1YUI A;  2EMH A;  1A1I A;  2EP3 A;  2LO3 A;  2EQ1 A;  4F2J C;  2LT7 A;  1KJK A;  2LCE A;  1LLM C;  2EMB A;  2I13 A;  2EJ4 A;  2EMW A;  2EL6 A;  3MHH C;  4R2Q A;  2EM0 A;  2YRM A;  1JK2 A;  1TN9 A;  2EMZ A;  1X6F A; 
#chains in the Genus database with same CATH topology
 1WXR A;  5KL7 A;  3AV0 A;  4DV0 E;  3HPZ A;  2EN6 A;  2LTR A;  2EPM X;  1XMO E;  4F54 A;  2L3C A;  5A69 A;  1YZ9 A;  1J26 A;  1YUJ A;  2YT4 A;  2FGG A;  2N8X A;  3C4B A;  3HXL A;  2EMF A;  3VHT B;  2BBG A;  4DMI A;  3JTZ A;  4YY3 E;  4M30 A;  3EPL A;  3VYY A;  2EMK A;  1YPN A;  2B9D A;  2NAB A;  2VRD A;  3HPS A;  3ADI A;  2EMI A;  2LE2 A;  4WFT A;  5TSE A;  2EM3 A;  5AE2 A;  2YTI A;  1FJG E;  2EM8 A;  3C6M A;  4JI7 E;  3IWD A;  1WHQ A;  2G7H A;  2N3G A;  3K6Q A;  1DQ3 A;  1XNR E;  2F8B A;  3OTO E;  4ZYD A;  4LF4 E;  3DJW A;  2EPZ A;  2JPA A;  1N36 E;  5LMN E;  2E5L E;  4X66 E;  2EM2 A;  2PRT A;  1ZAA C;  2ELY A;  1A1L A;  2KOU A;  2M4I A;  3VK6 A;  4AQY E;  3F6G A;  1ZBT A;  5KL6 A;  5AE1 A;  2RS7 A;  2HGH A;  2MKN A;  3MSW A;  1X48 A;  4IS1 C;  5KL5 A;  1A1G A;  4GKJ E;  5LMU E;  4JI3 E;  4O4K A;  4X65 E;  1PDA A;  4BC9 A;  2ODR C;  3THN A;  2HJJ A;  1UN6 B;  5AC4 A;  2ENC A;  1GTK A;  2ZM6 E;  2ENH A;  2GLI A;  2RSI A;  2EN4 A;  2YZT A;  4NZV A;  3EQ1 A;  2EQ0 A;  1B69 A;  2KON A;  2WBT A;  2YTE A;  5IWA E;  2DRP A;  4IJD A;  1G2D C;  2M7Q A;  5LL6 R;  4B3S E;  4WSP A;  2JOB A;  1HNW E;  4O24 A;  2JWO A;  1EH8 A;  1XMQ E;  1N33 E;  1N34 E;  4KHP E;  4N4R B;  2EPK X;  2L8T A;  4P7D A;  3C4T A;  1I94 E;  2I13 A;  2EMW A;  4LTY A;  2N3H A;  4DV7 E;  1IBM E;  2V89 A;  1EKZ A;  3BF2 A;  4M9V C;  2EOE A;  2DLQ A;  2DSY A;  3T1Y E;  2DIX A;  1BBO A;  2YTG A;  1HR0 E;  4LF9 E;  4KWY A;  3J7A G;  3ADJ A;  2JYA A;  5DNY A;  2JR1 A;  3ADG A;  2EOM A;  2UXD E;  2EPO A;  2VQF E;  5T6J A;  2EL5 A;  2V83 A;  5IT9 C;  4BC7 A;  1MEY C;  1EH6 A;  2ODR D;  4F6M A;  4JV5 E;  4X64 E;  2WCC 3;  2NUE A;  2EMC A;  2V85 A;  3AUZ A;  2L2M A;  3EPJ A;  2F4V E;  1WRJ A;  4NXM E;  2EM9 A;  2JY9 A;  4Q35 B;  2LMZ A;  1X6H A;  2LTS A;  2E1M A;  2EPP A;  4GKK E;  2EN1 A;  1PJT A;  2LV2 A;  1IQS A;  4JI0 E;  2EPN A;  2A25 A;  2EL4 A;  1A1H A;  4R2E A;  5KL4 A;  5A2Q C;  2YRK A;  3UK3 C;  2EMX A;  2UXB E;  1N3G A;  2EOX A;  4DV1 E;  2EM7 A;  4HEI A;  2EOI A;  2LVH A;  4F9B B;  4ZYG A;  1HNZ E;  2GPI A;  5AE3 A;  4X8W A;  2ENA A;  2L3J A;  2ADR A;  4NXN E;  3HTX A;  2EOR A;  2B7T A;  1QNT A;  4I8O A;  2CPN A;  2EOZ A;  3L00 A;  2L2K B;  2CTD A;  2YWQ A;  3FIG A;  4B3T E;  1DI2 A;  1X6E A;  5KL2 A;  2LUQ A;  2JOX A;  2EQ3 A;  1EH7 A;  1YYK A;  1WJP A;  2NA2 A;  1SFE A;  1BB8 A;  1GQE A;  4LU9 A;  1WHN A;  3VYX A;  1T4O A;  1X49 A;  1BBG A;  2B3T B;  4JI2 E;  2DLK A;  3MHS C;  1YFH A;  4LF5 E;  4BHC A;  2JP9 A;  2DGC A;  4DR4 E;  1J5E E;  4R2S A;  3EPH A;  2EPU A;  4OX9 E;  1A1K A;  4GEQ B;  4X62 E;  1TF6 A;  5A6B D;  4DV2 E;  2EP3 A;  2LO3 A;  2VF1 A;  1HNX E;  4F2J C;  2UUC E;  4JI4 E;  2FV4 B;  2JVA A;  1L4S A;  2EMB A;  2LUP B;  2FTX B;  2YRM A;  2EMZ A;  4DUY E;  1X5W A;  3IWC A;  3ECR A;  1UIL A;  2J7J A;  1X47 A;  1Z1B A;  1T4N A;  1UBD C;  2EWL A;  4L5N C;  3T1H E;  4F6N A;  2LJU A;  2H36 X;  2K4V A;  2EOJ A;  4FK5 C;  1ZBQ A;  2EMG A;  1AH5 A;  3LML A;  4WYQ B;  3QG5 C;  3EPK A;  1JK1 A;  2UU9 E;  1XNQ E;  4LFA E;  1IBL E;  2V88 A;  1IMU A;  2LBS B;  4TUG A;  2DMY A;  2EN8 A;  4ZYE A;  1F2I G;  2WBU A;  2GHF A;  3BGH A;  2EML A;  2VE7 C;  2I9I A;  5A6K A;  2WBS A;  2EPA A;  2HHH E;  1T38 A;  4P78 A;  3THO B;  1T39 A;  1FKA E;  2V87 A;  4L8N A;  4JI5 E;  2YTO A;  4DKK A;  4DV3 E;  4DV5 E;  1T4L B;  4WX9 A;  1DGC A;  3BBG A;  2RS6 A;  3JU0 A;  2EM6 A;  2MDR A;  4J8Z A;  4R2D A;  2Q8U A;  4DV6 E;  4R2A A;  2EMY A;  2YTJ A;  1RC7 A;  2WZO A;  2EM4 A;  2EOQ A;  2YPN A;  4R8O A;  4BHB A;  4JI6 E;  2EOS A;  2YTF A;  4R2C A;  2E72 A;  2EPR A;  1SR9 A;  2EN7 A;  1IQO A;  1G2F C;  2CSH A;  2R1F A;  4WSG A;  4R2P A;  5IV8 B;  3LLH A;  2M1S A;  4K0K E;  2VQE E;  2D9H A;  3RMP A;  1P47 A;  2EOO A;  2MDG A;  2B7V A;  1PJQ A;  2YRH A;  4F9A B;  5AAS A;  4JI8 E;  1AAY A;  5KL3 A;  4BBY A;  2M9A A;  4BMJ A;  5FLX C;  2CT1 A;  3KZZ A;  1KYQ A;  2EOF A;  2YTQ A;  2EPC A;  4KZS A;  4LF8 E;  2EN2 A;  2L33 A;  2EM5 A;  2EPX A;  1A1F A;  2NUF A;  4R2R A;  4JYA E;  1A1I A;  1PKP A;  1MGT A;  4WPY A;  2EQ1 A;  4M0V A;  2LT7 A;  4M2Z A;  3P1X A;  3J81 C;  5A6J A;  1LLM C;  2EJ4 A;  2EL6 A;  4R2Q A;  2EM0 A;  1JK2 A;  4F9C B;  1UHZ A;  5ADZ A;  1TN9 A;  4DR3 E;  2EOH A;  2YU8 A;  2MC6 A;  2RTX A;  3OML A;  4NHR A;  2EMA A;  1NCS A;  5AC5 A;  4X9J A;  3JAM C;  4WXD A;  2UUB E;  3ADL A;  4TUI A;  4DR1 E;  2HC5 A;  2LRS A;  5BR8 E;  4DR2 E;  2NUG A;  3F6H A;  4BS9 A;  2YSP A;  4B3R E;  4Q28 A;  1YYW A;  4LFB E;  3J80 C;  4R03 A;  3HQ1 A;  2ELZ A;  4OOG C;  2BB8 A;  2MKD A;  2YSO A;  4RH8 A;  5LLQ A;  1TF3 A;  1O0W A;  1N32 E;  4LF6 E;  1RMD A;  2MC5 A;  5A6A A;  5A6B A;  1GZ6 A;  5F3W A;  2LJH A;  1RQ0 A;  1ZU1 A;  4BCA A;  3M99 B;  1QU6 A;  1IBK E;  1YYO A;  1A1J A;  4JI1 E;  2UUA E;  3DF6 A;  3KZY A;  2EOY A;  4DUZ E;  3KWR A;  4MLV A;  2YTN A;  3BID A;  2YTD A;  3IWB A;  2EPL X;  2EN3 A;  2YU5 A;  2DB2 A;  2JXP A;  2DMI A;  4DR7 E;  4GZN C;  1ZR9 A;  4LFC E;  1NEI A;  2EZ6 A;  4MLQ A;  3C6K A;  3H09 A;  2YTP A;  2L6M A;  4DR5 E;  5CFF E;  4O5G A;  4RHB B;  2RQL A;  4O43 A;  3TQM A;  1STU A;  3J7Y p;  1X3C A;  1PJS A;  4HTG A;  2RPC A;  4WXC A;  5IXM B;  4DR6 E;  4DV4 E;  2V8Q B;  4ZYH A;  2EE8 A;  1YSA C;  1YUI A;  2KHX A;  4LF7 E;  2EMH A;  2L92 A;  2L2N A;  3ZOQ B;  1KJK A;  4B3M E;  2LCE A;  2R76 A;  4YHH E;  2UXC E;  2RSM A;  3MHH C;  2K7I A;  2IHR 1;  2V86 A;  1X6F A; 
#chains in the Genus database with same CATH homology
 4M9V C;  2EOE A;  2DLQ A;  2EOH A;  2YU8 A;  5KL7 A;  1BBO A;  4X9J A;  2YTG A;  1X5W A;  1NCS A;  2EMA A;  2EN6 A;  2J7J A;  2EOM A;  1Z1B A;  1UBD C;  2EL5 A;  4F6N A;  1MEY C;  4F6M A;  1YUJ A;  2EOJ A;  4FK5 C;  2EMF A;  2EMG A;  2YSP A;  2WCC 3;  2EMC A;  3VHT B;  3EPK A;  1JK1 A;  2ELZ A;  3EPJ A;  2BB8 A;  3EPL A;  2EMK A;  2MKD A;  2YSO A;  2EM9 A;  2NAB A;  2VRD A;  1TF3 A;  1X6H A;  2EN8 A;  2EMI A;  1F2I G;  1RMD A;  2WBU A;  2GHF A;  2EPP A;  2EM3 A;  2EML A;  2YTI A;  2EN1 A;  2EM8 A;  1ZU1 A;  2LV2 A;  3M99 B;  2WBS A;  2EPA A;  2A25 A;  2EL4 A;  1A1H A;  4R2E A;  5KL4 A;  1A1J A;  2YRK A;  3UK3 C;  2EMX A;  2EPZ A;  2JPA A;  2YTO A;  2EOX A;  1DGC A;  2EM7 A;  2EOY A;  2EM2 A;  2EM6 A;  2PRT A;  2EOI A;  2YTN A;  1ZAA C;  2ELY A;  4R2D A;  1A1L A;  2YTD A;  4R2A A;  2EMY A;  2YTJ A;  2LVH A;  2EM4 A;  2EOQ A;  2EN3 A;  2EOS A;  2YTF A;  4R2C A;  2E72 A;  2EPR A;  2EN7 A;  2YU5 A;  5KL6 A;  1G2F C;  2DMI A;  2CSH A;  2ENA A;  2HGH A;  2ADR A;  2R1F A;  4WSG A;  4GZN C;  4R2P A;  2MKN A;  1ZR9 A;  2EOR A;  4IS1 C;  5KL5 A;  2EOZ A;  1A1G A;  2D9H A;  2CTD A;  2YTP A;  1P47 A;  1X6E A;  2EOO A;  2MDG A;  5KL2 A;  2YRH A;  2EQ3 A;  1WJP A;  1AAY A;  1UN6 B;  2ENC A;  1BB8 A;  5KL3 A;  2GLI A;  2ENH A;  2M9A A;  2RSI A;  2EN4 A;  2CT1 A;  2DLK A;  3MHS C;  2EOF A;  1X3C A;  2EQ0 A;  1B69 A;  2JP9 A;  2YTQ A;  2DGC A;  2EPC A;  2RPC A;  4R2S A;  2WBT A;  3EPH A;  2EN2 A;  2YTE A;  2EM5 A;  2EPU A;  2EPX A;  2DRP A;  1A1F A;  4IJD A;  1G2D C;  2EE8 A;  1A1K A;  4R2R A;  1YSA C;  1TF6 A;  1YUI A;  2EMH A;  1A1I A;  2EP3 A;  2LO3 A;  2EQ1 A;  4F2J C;  2LT7 A;  1KJK A;  2LCE A;  1LLM C;  2EMB A;  2I13 A;  2EJ4 A;  2EMW A;  2EL6 A;  3MHH C;  4R2Q A;  2EM0 A;  2YRM A;  1JK2 A;  1TN9 A;  2EMZ A;  1X6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...