2RSIA

Solution structures of the dna-binding domains of immune-related zinc-finger protein zfat
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
GSSGSSGKPYKCPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLIKHIRDAHDPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the DNA-binding domains of immune-related zinc-finger protein ZFAT
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Zinc finger protein ZFAT
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13909 zf-H2C2_5 C2H2-type zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rsiA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rsiA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rsiA03
2EPXA 2EN7A 4R2RA 1RMDA 1P47A 1DGCA 1F2IG 2YSOA 2EM4A 2EN6A 2YTEA 2ELYA 2YU8A 2EE8A 1A1JA 1B69A 2CSHA 2EPPA 2LO3A 2EP3A 2LCEA 2EMLA 2EOFA 3M99B 1G2FC 2NABA 1NCSA 2WBUA 2WBSA 2WBTA 3EPLA 2EM2A 2ENCA 1TF3A 2ADRA 2EMGA 2EPCA 2EQ1A 2M9AA 4R2SA 2EOIA 1KJKA 1YSAC 2EM0A 1A1FA 2EOZA 2EORA 2YTDA 1A1HA 2EN3A 2YTFA 2ENAA 2MKNA 2EOYA 2YTPA 2WCC3 3UK3C 4GZNC 2EMFA 2EOJA 2EN1A 2EMCA 1TF6A 5KL4A 2CTDA 2JPAA 2EMKA 3MHSC 5KL5A 2EMHA 4R2CA 4R2QA 2EMIA 2R1FA 2RSIA 5KL6A 2ELZA 1WJPA 4R2EA 2JP9A 2PRTA 1TN9A 2DGCA 4FK5C 2YTQA 2YU5A 2LT7A 2EPRA 4WSGA 1LLMC 2YTGA 2EM8A 2EL6A 1A1KA 1BB8A 2YRKA 2YTNA 3VHTB 4IS1C 2MDGA 2YRHA 2I13A 1ZR9A 2EMAA 2DRPA 1UN6B 3EPKA 1BBOA 2D9HA 2EOMA 4F2JC 1ZU1A 2MKDA 2BB8A 2EL4A 2ENHA 2EOSA 1JK1A 1X3CA 2EM9A 4X9JA 4F6MA 2EM3A 2EMXA 4R2DA 2DLKA 2EL5A 2HGHA 2EOHA 2EOOA 4M9VC 2EQ0A 1X6EA 3EPHA 2DMIA 1MEYC 2EN4A 2EOQA 1X6FA 2EM6A 2YTIA 1Z1BA 1AAYA 2DLQA 2EM7A 3MHHC 2EPAA 2EMZA 2YRMA 2YSPA 1A1GA 1JK2A 1G2DC 1X6HA 2RPCA 1A1IA 2EMWA 1A1LA 2GHFA 1YUIA 2EN2A 2YTOA 2EPZA 2EMYA 2CT1A 2EMBA 4F6NA 2EJ4A 5KL7A 1X5WA 2EPUA 2VRDA 1ZAAC 2A25A 4IJDA 2J7JA 2YTJA 2EQ3A 2EOEA 5KL2A 4R2AA 2EOXA 4R2PA 2E72A 1YUJA 2LVHA 5KL3A 2EM5A 3EPJA 2EN8A 1UBDC 2GLIA 2LV2A
chains in the Genus database with same CATH superfamily
2LRSA 1RMDA 5CFFE 5T6JA 1DGCA 2DMYA 2DIXA 2EM4A 1YYWA 3J7AG 4GKKE 4X62E 2EPNA 2RS7A 4JI1E 3VK6A 4NHRA 2LO3A 2EPKX 5A6BD 3ZOQB 5F3WA 4BS9A 2UUCE 1DQ3A 2LJHA 2LTSA 3C6MA 4RH8A 2WBSA 2JVAA 2ENCA 1N34E 2EPCA 1HNZE 2RQLA 1PJTA 5A2QC 1HNWE 2EOIA 1KJKA 2EM0A 4LF7E 2EOZA 3F6HA 4NXNE 2YTFA 1SR9A 3AV0A 5DNYA 4WYQB 1YZ9A 2KOUA 2EMFA 1TF6A 2JPAA 2CTDA 3HQ1A 4LFBE 2YZTA 4R2QA 5IV8B 3C4TA 4R2EA 4FK5C 4X65E 5LMUE 4LFAE 4JYAE 2YRKA 1X49A 1X48A 2YWQA 2E1MA 1I94E 4AQYE 1UN6B 1ZR9A 2EMAA 2DRPA 3EPKA 2DB2A 5FLXC 4BMJA 3LMLA 2G7HA 4BBYA 4ZYGA 1IQOA 4M0VA 4OX9E 2EL4A 2ENHA 2EOSA 3BIDA 1JK1A 2V88A 2EMXA 1ZBQA 2R76A 4JV5E 1EH7A 2EOHA 2EOOA 4BC9A 1IBKE 1EH8A 1MEYC 1RQ0A 2GPIA 1X6FA 2L8TA 4LF5E 2YTIA 3KWRA 5AE2A 1AAYA 2EM7A 4J8ZA 2EMZA 4MLQA 5A6KA 2FV4B 5IXMB 2B7TA 1YYOA 4LF4E 2RPCA 1A1IA 2N3GA 1YUIA 4L8NA 2FGGA 2CT1A 2EMBA 3TQMA 3ADLA 2UXBE 1X5WA 2JXPA 2EPLX 1XNQE 4IJDA 4WPYA 3JAMC 2EOEA 4R2AA 4B3SE 1N33E 2K7IA 3P1XA 5AE3A 1EKZA 1WRJA 5KL3A 1XMQE 1XMOE 2EN8A 4R2RA 2EN7A 4M2ZA 3J7Yp 1WXRA 5A69A 2EN6A 4K0KE 2ELYA 3OTOE 2YU8A 2LUQA 3BGHA 2EE8A 4TUIA 4F9AB 4WXCA 1PJQA 3HXLA 4DV2E 1G2FC 2NABA 4KWYA 1NCSA 2WBUA 1FKAE 2EPMX 1O0WA 2VQEE 3IWBA 2EZ6A 4DKKA 1XNRE 2I9IA 2ADRA 1YYKA 4R2SA 2K4VA 1YSAC 4MLVA 1RC7A 4P78A 2YTDA 3H09A 2L2NA 2LMZA 2YTPA 4DV4E 2WCC3 2M1SA 3ECRA 1HNXE 4LF6E 5KL4A 3MHSC 5KL5A 2EMHA 2RSIA 1QNTA 1WJPA 2PRTA 1PJSA 4DR3E 2YTQA 5LMNE 1IBLE 1WHNA 1T4OA 2EPRA 1LLMC 4DMIA 3BF2A 4KHPE 2V87A 1AH5A 1BB8A 3ADJA 1BBGA 1WHQA 4DUZE 3VHTB 2I13A 4I8OA 1N36E 2EOMA 4F2JC 4JI7E 2M4IA 2LBSB 1DI2A 1GQEA 2KHXA 2ZM6E 2UUAE 1X3CA 2EM9A 4X9JA 1YFHA 4F6MA 4B3TE 4BCAA 2DLKA 4LF9E 2EL5A 4ZYEA 2HGHA 4M9VC 4M30A 3IWCA 1X6EA 2DMIA 2EM6A 4YHHE 3T1HE 2Q8UA 4N4RB 2MDRA 1Z1BA 4NZVA 2EPAA 2L2MA 2YRMA 1A1GA 1JK2A 1G2DC 1X6HA 4DV0E 2EN2A 1UILA 2B9DA 4DV5E 3T1YE 2EPZA 5TSEA 1MGTA 5KL7A 1PDAA 2VRDA 2J7JA 2YTJA 3DJWA 5KL2A 4R2PA 2YPNA 2E72A 1KYQA 2LVHA 5A6JA 1FJGE 1STUA 3EPJA 2GLIA 2LV2A 1P47A 4LU9A 4JI5E 2ODRC 1ZBTA 2JR1A 4O4KA 1PKPA 4DR6E 1GZ6A 2RSMA 2E5LE 2F8BA 2V89A 1A1JA 2NUEA 2CSHA 2EPPA 1T4NA 2JOBA 4DR4E 5AC4A 2EOFA 3M99B 1T4LB 2UUBE 3J80C 1TF3A 2EMGA 1IBME 1QU6A 2M9AA 2RTXA 3IWDA 2L33A 2IHR1 4L5NC 1A1FA 3C6KA 4B3ME 2EN3A 2UXDE 2EOYA 5A6AA 3UK3C 2KONA 4DR7E 3BBGA 2EOJA 2EN1A 2EMKA 2M7QA 3JTZA 2EMIA 2R1FA 3JU0A 3MSWA 1X47A 2BBGA 2YU5A 1YPNA 4F54A 4JI8E 2LT7A 4WSGA 2YTGA 1A1KA 2L3JA 4O24A 1HR0E 4O43A 4IS1C 2MDGA 1BBOA 3J81C 3AUZA 4B3RE 1ZU1A 2RS6A 2JOXA 2L92A 2BB8A 2EPOA 2V83A 2V8QB 2CPNA 1J26A 4WX9A 4WSPA 2V85A 4DR5E 3EPHA 1IMUA 2EN4A 2EOQA 4DV7E 2HJJA 2B3TB 2DLQA 3MHHC 4DR1E 3THNA 2N8XA 2YSPA 5A6BA 1L4SA 1GTKA 3LLHA 2B7VA 4HTGA 4X66E 2LE2A 2GHFA 2L2KB 2YTOA 4X8WA 2EMYA 5AE1A 1ZAAC 4GKJE 2LJUA 3K6QA 2N3HA 2EQ3A 4F9CB 1YUJA 2YT4A 2EM5A 3FIGA 3C4BA 1UBDC 5AC5A 2EPXA 4JI4E 2WZOA 2HHHE 1EH6A 1F2IG 2YSOA 2YTEA 4HEIA 5AASA 4NXME 5BR8E 5IWAE 4Q28A 4F9BB 2VE7C 1B69A 2EP3A 2HC5A 2JYAA 2LCEA 2EMLA 2UXCE 4JI0E 4OOGC 4YY3E 4GEQB 4LFCE 4R03A 1N3GA 2WBTA 3EPLA 2EM2A 2VF1A 4BHBA 2EQ1A 4R8OA 5LLQA 1IQSA 2F4VE 2EORA 1A1HA 1NEIA 3HPZA 2ENAA 4KZSA 3OMLA 2MKNA 3EQ1A 1N32E 4GZNC 4DV6E 2EMCA 2NUFA 2MC5A 3RMPA 4R2CA 2L6MA 5KL6A 2ELZA 4BHCA 4LF8E 2JP9A 3VYXA 1TN9A 2DGCA 2UU9E 3HTXA 2V86A 4JI3E 4P7DA 2LUPB 2EM8A 2EL6A 3L00A 2YTNA 4BC7A 4TUGA 1T39A 2YRHA 4O5GA 2D9HA 4Q35B 3ADGA 3KZZA 3F6GA 3DF6A 2MKDA 4ZYHA 3ADIA 4WFTA 2L3CA 2EM3A 4R2DA 1SFEA 2EWLA 2EQ0A 2LTRA 3KZYA 4JI6E 4LTYA 2FTXB 3QG5C 3VYYA 4DUYE 4ZYDA 2NUGA 2VQFE 2ODRD 2JWOA 3HPSA 2EMWA 5IT9C 3THOB 1A1LA 1J5EE 2H36X 2NA2A 1T38A 4F6NA 2EJ4A 2JY9A 5LL6R 2EPUA 1UHZA 2A25A 4RHBB 2MC6A 4WXDA 4DV1E 4DV3E 2EOXA 4X64E 4JI2E 5ADZA 4DR2E 2DSYA
chains in the Genus database with same CATH topology
2EPXA 2EN7A 4R2RA 1RMDA 1P47A 1DGCA 1F2IG 2YSOA 2EM4A 2EN6A 2YTEA 2ELYA 2YU8A 2EE8A 1A1JA 1B69A 2CSHA 2EPPA 2LO3A 2EP3A 2LCEA 2EMLA 2EOFA 3M99B 1G2FC 2NABA 1NCSA 2WBUA 2WBSA 2WBTA 3EPLA 2EM2A 2ENCA 1TF3A 2ADRA 2EMGA 2EPCA 2EQ1A 2M9AA 4R2SA 2EOIA 1KJKA 1YSAC 2EM0A 1A1FA 2EOZA 2EORA 2YTDA 1A1HA 2EN3A 2YTFA 2ENAA 2MKNA 2EOYA 2YTPA 2WCC3 3UK3C 4GZNC 2EMFA 2EOJA 2EN1A 2EMCA 1TF6A 5KL4A 2CTDA 2JPAA 2EMKA 3MHSC 5KL5A 2EMHA 4R2CA 4R2QA 2EMIA 2R1FA 2RSIA 5KL6A 2ELZA 1WJPA 4R2EA 2JP9A 2PRTA 1TN9A 2DGCA 4FK5C 2YTQA 2YU5A 2LT7A 2EPRA 4WSGA 1LLMC 2YTGA 2EM8A 2EL6A 1A1KA 1BB8A 2YRKA 2YTNA 3VHTB 4IS1C 2MDGA 2YRHA 2I13A 1ZR9A 2EMAA 2DRPA 1UN6B 3EPKA 1BBOA 2D9HA 2EOMA 4F2JC 1ZU1A 2MKDA 2BB8A 2EL4A 2ENHA 2EOSA 1JK1A 1X3CA 2EM9A 4X9JA 4F6MA 2EM3A 2EMXA 4R2DA 2DLKA 2EL5A 2HGHA 2EOHA 2EOOA 4M9VC 2EQ0A 1X6EA 3EPHA 2DMIA 1MEYC 2EN4A 2EOQA 1X6FA 2EM6A 2YTIA 1Z1BA 1AAYA 2DLQA 2EM7A 3MHHC 2EPAA 2EMZA 2YRMA 2YSPA 1A1GA 1JK2A 1G2DC 1X6HA 2RPCA 1A1IA 2EMWA 1A1LA 2GHFA 1YUIA 2EN2A 2YTOA 2EPZA 2EMYA 2CT1A 2EMBA 4F6NA 2EJ4A 5KL7A 1X5WA 2EPUA 2VRDA 1ZAAC 2A25A 4IJDA 2J7JA 2YTJA 2EQ3A 2EOEA 5KL2A 4R2AA 2EOXA 4R2PA 2E72A 1YUJA 2LVHA 5KL3A 2EM5A 3EPJA 2EN8A 1UBDC 2GLIA 2LV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPX A;  2EN7 A;  4R2R A;  1RMD A;  1P47 A;  1DGC A;  1F2I G;  2YSO A;  2EM4 A;  2EN6 A;  2YTE A;  2ELY A;  2YU8 A;  2EE8 A;  1A1J A;  1B69 A;  2CSH A;  2EPP A;  2LO3 A;  2EP3 A;  2LCE A;  2EML A;  2EOF A;  3M99 B;  1G2F C;  2NAB A;  1NCS A;  2WBU A;  2WBS A;  2WBT A;  3EPL A;  2EM2 A;  2ENC A;  1TF3 A;  2ADR A;  2EMG A;  2EPC A;  2EQ1 A;  2M9A A;  4R2S A;  2EOI A;  1KJK A;  1YSA C;  2EM0 A;  1A1F A;  2EOZ A;  2EOR A;  2YTD A;  1A1H A;  2EN3 A;  2YTF A;  2ENA A;  2MKN A;  2EOY A;  2YTP A;  2WCC 3;  3UK3 C;  4GZN C;  2EMF A;  2EOJ A;  2EN1 A;  2EMC A;  1TF6 A;  5KL4 A;  2CTD A;  2JPA A;  2EMK A;  3MHS C;  5KL5 A;  2EMH A;  4R2C A;  4R2Q A;  2EMI A;  2R1F A;  2RSI A;  5KL6 A;  2ELZ A;  1WJP A;  4R2E A;  2JP9 A;  2PRT A;  1TN9 A;  2DGC A;  4FK5 C;  2YTQ A;  2YU5 A;  2LT7 A;  2EPR A;  4WSG A;  1LLM C;  2YTG A;  2EM8 A;  2EL6 A;  1A1K A;  1BB8 A;  2YRK A;  2YTN A;  3VHT B;  4IS1 C;  2MDG A;  2YRH A;  2I13 A;  1ZR9 A;  2EMA A;  2DRP A;  1UN6 B;  3EPK A;  1BBO A;  2D9H A;  2EOM A;  4F2J C;  1ZU1 A;  2MKD A;  2BB8 A;  2EL4 A;  2ENH A;  2EOS A;  1JK1 A;  1X3C A;  2EM9 A;  4X9J A;  4F6M A;  2EM3 A;  2EMX A;  4R2D A;  2DLK A;  2EL5 A;  2HGH A;  2EOH A;  2EOO A;  4M9V C;  2EQ0 A;  1X6E A;  3EPH A;  2DMI A;  1MEY C;  2EN4 A;  2EOQ A;  1X6F A;  2EM6 A;  2YTI A;  1Z1B A;  1AAY A;  2DLQ A;  2EM7 A;  3MHH C;  2EPA A;  2EMZ A;  2YRM A;  2YSP A;  1A1G A;  1JK2 A;  1G2D C;  1X6H A;  2RPC A;  1A1I A;  2EMW A;  1A1L A;  2GHF A;  1YUI A;  2EN2 A;  2YTO A;  2EPZ A;  2EMY A;  2CT1 A;  2EMB A;  4F6N A;  2EJ4 A;  5KL7 A;  1X5W A;  2EPU A;  2VRD A;  1ZAA C;  2A25 A;  4IJD A;  2J7J A;  2YTJ A;  2EQ3 A;  2EOE A;  5KL2 A;  4R2A A;  2EOX A;  4R2P A;  2E72 A;  1YUJ A;  2LVH A;  5KL3 A;  2EM5 A;  3EPJ A;  2EN8 A;  1UBD C;  2GLI A;  2LV2 A; 
#chains in the Genus database with same CATH topology
 2LRS A;  1RMD A;  5CFF E;  5T6J A;  1DGC A;  2DMY A;  2DIX A;  2EM4 A;  1YYW A;  3J7A G;  4GKK E;  4X62 E;  2EPN A;  2RS7 A;  4JI1 E;  3VK6 A;  4NHR A;  2LO3 A;  2EPK X;  5A6B D;  3ZOQ B;  5F3W A;  4BS9 A;  2UUC E;  1DQ3 A;  2LJH A;  2LTS A;  3C6M A;  4RH8 A;  2WBS A;  2JVA A;  2ENC A;  1N34 E;  2EPC A;  1HNZ E;  2RQL A;  1PJT A;  5A2Q C;  1HNW E;  2EOI A;  1KJK A;  2EM0 A;  4LF7 E;  2EOZ A;  3F6H A;  4NXN E;  2YTF A;  1SR9 A;  3AV0 A;  5DNY A;  4WYQ B;  1YZ9 A;  2KOU A;  2EMF A;  1TF6 A;  2JPA A;  2CTD A;  3HQ1 A;  4LFB E;  2YZT A;  4R2Q A;  5IV8 B;  3C4T A;  4R2E A;  4FK5 C;  4X65 E;  5LMU E;  4LFA E;  4JYA E;  2YRK A;  1X49 A;  1X48 A;  2YWQ A;  2E1M A;  1I94 E;  4AQY E;  1UN6 B;  1ZR9 A;  2EMA A;  2DRP A;  3EPK A;  2DB2 A;  5FLX C;  4BMJ A;  3LML A;  2G7H A;  4BBY A;  4ZYG A;  1IQO A;  4M0V A;  4OX9 E;  2EL4 A;  2ENH A;  2EOS A;  3BID A;  1JK1 A;  2V88 A;  2EMX A;  1ZBQ A;  2R76 A;  4JV5 E;  1EH7 A;  2EOH A;  2EOO A;  4BC9 A;  1IBK E;  1EH8 A;  1MEY C;  1RQ0 A;  2GPI A;  1X6F A;  2L8T A;  4LF5 E;  2YTI A;  3KWR A;  5AE2 A;  1AAY A;  2EM7 A;  4J8Z A;  2EMZ A;  4MLQ A;  5A6K A;  2FV4 B;  5IXM B;  2B7T A;  1YYO A;  4LF4 E;  2RPC A;  1A1I A;  2N3G A;  1YUI A;  4L8N A;  2FGG A;  2CT1 A;  2EMB A;  3TQM A;  3ADL A;  2UXB E;  1X5W A;  2JXP A;  2EPL X;  1XNQ E;  4IJD A;  4WPY A;  3JAM C;  2EOE A;  4R2A A;  4B3S E;  1N33 E;  2K7I A;  3P1X A;  5AE3 A;  1EKZ A;  1WRJ A;  5KL3 A;  1XMQ E;  1XMO E;  2EN8 A;  4R2R A;  2EN7 A;  4M2Z A;  3J7Y p;  1WXR A;  5A69 A;  2EN6 A;  4K0K E;  2ELY A;  3OTO E;  2YU8 A;  2LUQ A;  3BGH A;  2EE8 A;  4TUI A;  4F9A B;  4WXC A;  1PJQ A;  3HXL A;  4DV2 E;  1G2F C;  2NAB A;  4KWY A;  1NCS A;  2WBU A;  1FKA E;  2EPM X;  1O0W A;  2VQE E;  3IWB A;  2EZ6 A;  4DKK A;  1XNR E;  2I9I A;  2ADR A;  1YYK A;  4R2S A;  2K4V A;  1YSA C;  4MLV A;  1RC7 A;  4P78 A;  2YTD A;  3H09 A;  2L2N A;  2LMZ A;  2YTP A;  4DV4 E;  2WCC 3;  2M1S A;  3ECR A;  1HNX E;  4LF6 E;  5KL4 A;  3MHS C;  5KL5 A;  2EMH A;  2RSI A;  1QNT A;  1WJP A;  2PRT A;  1PJS A;  4DR3 E;  2YTQ A;  5LMN E;  1IBL E;  1WHN A;  1T4O A;  2EPR A;  1LLM C;  4DMI A;  3BF2 A;  4KHP E;  2V87 A;  1AH5 A;  1BB8 A;  3ADJ A;  1BBG A;  1WHQ A;  4DUZ E;  3VHT B;  2I13 A;  4I8O A;  1N36 E;  2EOM A;  4F2J C;  4JI7 E;  2M4I A;  2LBS B;  1DI2 A;  1GQE A;  2KHX A;  2ZM6 E;  2UUA E;  1X3C A;  2EM9 A;  4X9J A;  1YFH A;  4F6M A;  4B3T E;  4BCA A;  2DLK A;  4LF9 E;  2EL5 A;  4ZYE A;  2HGH A;  4M9V C;  4M30 A;  3IWC A;  1X6E A;  2DMI A;  2EM6 A;  4YHH E;  3T1H E;  2Q8U A;  4N4R B;  2MDR A;  1Z1B A;  4NZV A;  2EPA A;  2L2M A;  2YRM A;  1A1G A;  1JK2 A;  1G2D C;  1X6H A;  4DV0 E;  2EN2 A;  1UIL A;  2B9D A;  4DV5 E;  3T1Y E;  2EPZ A;  5TSE A;  1MGT A;  5KL7 A;  1PDA A;  2VRD A;  2J7J A;  2YTJ A;  3DJW A;  5KL2 A;  4R2P A;  2YPN A;  2E72 A;  1KYQ A;  2LVH A;  5A6J A;  1FJG E;  1STU A;  3EPJ A;  2GLI A;  2LV2 A;  1P47 A;  4LU9 A;  4JI5 E;  2ODR C;  1ZBT A;  2JR1 A;  4O4K A;  1PKP A;  4DR6 E;  1GZ6 A;  2RSM A;  2E5L E;  2F8B A;  2V89 A;  1A1J A;  2NUE A;  2CSH A;  2EPP A;  1T4N A;  2JOB A;  4DR4 E;  5AC4 A;  2EOF A;  3M99 B;  1T4L B;  2UUB E;  3J80 C;  1TF3 A;  2EMG A;  1IBM E;  1QU6 A;  2M9A A;  2RTX A;  3IWD A;  2L33 A;  2IHR 1;  4L5N C;  1A1F A;  3C6K A;  4B3M E;  2EN3 A;  2UXD E;  2EOY A;  5A6A A;  3UK3 C;  2KON A;  4DR7 E;  3BBG A;  2EOJ A;  2EN1 A;  2EMK A;  2M7Q A;  3JTZ A;  2EMI A;  2R1F A;  3JU0 A;  3MSW A;  1X47 A;  2BBG A;  2YU5 A;  1YPN A;  4F54 A;  4JI8 E;  2LT7 A;  4WSG A;  2YTG A;  1A1K A;  2L3J A;  4O24 A;  1HR0 E;  4O43 A;  4IS1 C;  2MDG A;  1BBO A;  3J81 C;  3AUZ A;  4B3R E;  1ZU1 A;  2RS6 A;  2JOX A;  2L92 A;  2BB8 A;  2EPO A;  2V83 A;  2V8Q B;  2CPN A;  1J26 A;  4WX9 A;  4WSP A;  2V85 A;  4DR5 E;  3EPH A;  1IMU A;  2EN4 A;  2EOQ A;  4DV7 E;  2HJJ A;  2B3T B;  2DLQ A;  3MHH C;  4DR1 E;  3THN A;  2N8X A;  2YSP A;  5A6B A;  1L4S A;  1GTK A;  3LLH A;  2B7V A;  4HTG A;  4X66 E;  2LE2 A;  2GHF A;  2L2K B;  2YTO A;  4X8W A;  2EMY A;  5AE1 A;  1ZAA C;  4GKJ E;  2LJU A;  3K6Q A;  2N3H A;  2EQ3 A;  4F9C B;  1YUJ A;  2YT4 A;  2EM5 A;  3FIG A;  3C4B A;  1UBD C;  5AC5 A;  2EPX A;  4JI4 E;  2WZO A;  2HHH E;  1EH6 A;  1F2I G;  2YSO A;  2YTE A;  4HEI A;  5AAS A;  4NXM E;  5BR8 E;  5IWA E;  4Q28 A;  4F9B B;  2VE7 C;  1B69 A;  2EP3 A;  2HC5 A;  2JYA A;  2LCE A;  2EML A;  2UXC E;  4JI0 E;  4OOG C;  4YY3 E;  4GEQ B;  4LFC E;  4R03 A;  1N3G A;  2WBT A;  3EPL A;  2EM2 A;  2VF1 A;  4BHB A;  2EQ1 A;  4R8O A;  5LLQ A;  1IQS A;  2F4V E;  2EOR A;  1A1H A;  1NEI A;  3HPZ A;  2ENA A;  4KZS A;  3OML A;  2MKN A;  3EQ1 A;  1N32 E;  4GZN C;  4DV6 E;  2EMC A;  2NUF A;  2MC5 A;  3RMP A;  4R2C A;  2L6M A;  5KL6 A;  2ELZ A;  4BHC A;  4LF8 E;  2JP9 A;  3VYX A;  1TN9 A;  2DGC A;  2UU9 E;  3HTX A;  2V86 A;  4JI3 E;  4P7D A;  2LUP B;  2EM8 A;  2EL6 A;  3L00 A;  2YTN A;  4BC7 A;  4TUG A;  1T39 A;  2YRH A;  4O5G A;  2D9H A;  4Q35 B;  3ADG A;  3KZZ A;  3F6G A;  3DF6 A;  2MKD A;  4ZYH A;  3ADI A;  4WFT A;  2L3C A;  2EM3 A;  4R2D A;  1SFE A;  2EWL A;  2EQ0 A;  2LTR A;  3KZY A;  4JI6 E;  4LTY A;  2FTX B;  3QG5 C;  3VYY A;  4DUY E;  4ZYD A;  2NUG A;  2VQF E;  2ODR D;  2JWO A;  3HPS A;  2EMW A;  5IT9 C;  3THO B;  1A1L A;  1J5E E;  2H36 X;  2NA2 A;  1T38 A;  4F6N A;  2EJ4 A;  2JY9 A;  5LL6 R;  2EPU A;  1UHZ A;  2A25 A;  4RHB B;  2MC6 A;  4WXD A;  4DV1 E;  4DV3 E;  2EOX A;  4X64 E;  4JI2 E;  5ADZ A;  4DR2 E;  2DSY A; 
#chains in the Genus database with same CATH homology
 2EPX A;  2EN7 A;  4R2R A;  1RMD A;  1P47 A;  1DGC A;  1F2I G;  2YSO A;  2EM4 A;  2EN6 A;  2YTE A;  2ELY A;  2YU8 A;  2EE8 A;  1A1J A;  1B69 A;  2CSH A;  2EPP A;  2LO3 A;  2EP3 A;  2LCE A;  2EML A;  2EOF A;  3M99 B;  1G2F C;  2NAB A;  1NCS A;  2WBU A;  2WBS A;  2WBT A;  3EPL A;  2EM2 A;  2ENC A;  1TF3 A;  2ADR A;  2EMG A;  2EPC A;  2EQ1 A;  2M9A A;  4R2S A;  2EOI A;  1KJK A;  1YSA C;  2EM0 A;  1A1F A;  2EOZ A;  2EOR A;  2YTD A;  1A1H A;  2EN3 A;  2YTF A;  2ENA A;  2MKN A;  2EOY A;  2YTP A;  2WCC 3;  3UK3 C;  4GZN C;  2EMF A;  2EOJ A;  2EN1 A;  2EMC A;  1TF6 A;  5KL4 A;  2CTD A;  2JPA A;  2EMK A;  3MHS C;  5KL5 A;  2EMH A;  4R2C A;  4R2Q A;  2EMI A;  2R1F A;  2RSI A;  5KL6 A;  2ELZ A;  1WJP A;  4R2E A;  2JP9 A;  2PRT A;  1TN9 A;  2DGC A;  4FK5 C;  2YTQ A;  2YU5 A;  2LT7 A;  2EPR A;  4WSG A;  1LLM C;  2YTG A;  2EM8 A;  2EL6 A;  1A1K A;  1BB8 A;  2YRK A;  2YTN A;  3VHT B;  4IS1 C;  2MDG A;  2YRH A;  2I13 A;  1ZR9 A;  2EMA A;  2DRP A;  1UN6 B;  3EPK A;  1BBO A;  2D9H A;  2EOM A;  4F2J C;  1ZU1 A;  2MKD A;  2BB8 A;  2EL4 A;  2ENH A;  2EOS A;  1JK1 A;  1X3C A;  2EM9 A;  4X9J A;  4F6M A;  2EM3 A;  2EMX A;  4R2D A;  2DLK A;  2EL5 A;  2HGH A;  2EOH A;  2EOO A;  4M9V C;  2EQ0 A;  1X6E A;  3EPH A;  2DMI A;  1MEY C;  2EN4 A;  2EOQ A;  1X6F A;  2EM6 A;  2YTI A;  1Z1B A;  1AAY A;  2DLQ A;  2EM7 A;  3MHH C;  2EPA A;  2EMZ A;  2YRM A;  2YSP A;  1A1G A;  1JK2 A;  1G2D C;  1X6H A;  2RPC A;  1A1I A;  2EMW A;  1A1L A;  2GHF A;  1YUI A;  2EN2 A;  2YTO A;  2EPZ A;  2EMY A;  2CT1 A;  2EMB A;  4F6N A;  2EJ4 A;  5KL7 A;  1X5W A;  2EPU A;  2VRD A;  1ZAA C;  2A25 A;  4IJD A;  2J7J A;  2YTJ A;  2EQ3 A;  2EOE A;  5KL2 A;  4R2A A;  2EOX A;  4R2P A;  2E72 A;  1YUJ A;  2LVH A;  5KL3 A;  2EM5 A;  3EPJ A;  2EN8 A;  1UBD C;  2GLI A;  2LV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...