2RSIA

Solution structures of the dna-binding domains of immune-related zinc-finger protein zfat
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
GSSGSSGKPYKCPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLIKHIRDAHDPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein ZFAT
publication title Solution structures of the DNA-binding domains of immune-related zinc-finger protein ZFAT
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13909 zf-H2C2_5 C2H2-type zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rsiA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rsiA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rsiA03
2EM9A 2EMGA 2EOQA 2YU8A 1ZR9A 2JP9A 2EMLA 1KJKA 2J7JA 3EPHA 2GHFA 2M9AA 2EL6A 3EPJA 1G2FC 1LLMC 2YSPA 2VRDA 2YTDA 4F6NA 2LVHA 2YTFA 2EM0A 5KL2A 1TF3A 1BB8A 3EPKA 1A1LA 4R2QA 1X6HA 1YUIA 1JK1A 2DGCA 2EM5A 2EL5A 2EMBA 2ELYA 2YTEA 3MHSC 2EOZA 1A1IA 2BB8A 2EPUA 2DLKA 1A1HA 4IS1C 4R2RA 1X6FA 2ENAA 1X3CA 2EN8A 1B69A 1A1KA 2EMFA 2EE8A 2YTGA 2YTJA 2MKDA 2WBUA 1X6EA 2EN4A 2CT1A 4IJDA 2EMWA 4WSGA 2EPAA 1A1FA 2YRKA 2EOOA 1Z1BA 2EMZA 5KL6A 2LV2A 2DRPA 2EQ0A 4R2AA 2ENHA 1A1GA 2EM2A 2EOEA 4F6MA 2EM6A 1BBOA 2YRHA 2EPRA 2DLQA 2EMAA 2EN3A 2EQ3A 2EN1A 1P47A 2EMHA 4GZNC 3UK3C 2EM7A 1RMDA 2WCC3 2EOSA 2EOJA 2EMXA 2YTQA 1WJPA 2ENCA 4R2CA 2MKNA 4R2PA 2EM8A 2EOFA 2NABA 1UN6B 1YUJA 1DGCA 2LO3A 3EPLA 2EL4A 2EOIA 4X9JA 2LT7A 4F2JC 1TF6A 2EMYA 5KL3A 2EPCA 1A1JA 2EOHA 3MHHC 2EOXA 1MEYC 2EP3A 2A25A 3M99B 5KL4A 2RPCA 3VHTB 1UBDC 4M9VC 1NCSA 2YTPA 2YTOA 2EQ1A 1AAYA 2R1FA 2D9HA 2HGHA 1X5WA 2DMIA 2WBTA 2EM3A 2EM4A 2EPXA 2EPZA 2CTDA 2RSIA 1TN9A 2GLIA 2I13A 4R2EA 2YRMA 1YSAC 5KL5A 1ZU1A 4FK5C 2WBSA 2CSHA 4R2SA 2EMCA 2YTIA 2EOYA 2EN7A 2E72A 2YSOA 1ZAAC 2EPPA 2LCEA 4R2DA 2EMIA 2EJ4A 1JK2A 2EMKA 2YU5A 2EN2A 2ELZA 2ADRA 1G2DC 2EORA 2JPAA 1F2IG 2EN6A 2EOMA 2MDGA 5KL7A 2YTNA 2PRTA
chains in the Genus database with same CATH superfamily
2EM9A 1N34E 1ZR9A 2JR1A 4DV5E 3F6HA 4DR7E 4WSPA 2J7JA 1N32E 1DQ3A 5TSEA 2MC5A 1O0WA 3H09A 2YTDA 4Q35B 2YPNA 3J81C 4L5NC 2N3GA 1EH6A 4WYQB 1XMOE 1BB8A 4F9AB 4TUGA 1WXRA 4L8NA 2YTEA 3MHSC 1A1HA 3THNA 1PDAA 2VQFE 4IS1C 3P1XA 4OOGC 2EN8A 1B69A 1XNQE 2YTJA 2EMWA 2EPAA 2YRKA 4X64E 1N3GA 2L2KB 4B3ME 1T38A 3HQ1A 2DRPA 2HC5A 4JI6E 4O43A 2LUPB 4F6MA 2EM6A 4BHCA 4TUIA 2EPKX 3J7Yp 1YFHA 2LUQA 2EQ3A 2EN1A 5IV8B 4O24A 4ZYDA 3VK6A 1GZ6A 2YTQA 3T1HE 1ZBTA 4R2CA 2MKNA 2LTRA 2NABA 1UN6B 1KYQA 2RQLA 1YUJA 2EPOA 3EPLA 3J80C 5LMUE 2L2MA 4LTYA 2EPMX 2LT7A 3QG5C 4F2JC 5KL3A 3MHHC 2EOXA 2EP3A 3ECRA 3M99B 3VHTB 2N3HA 4BMJA 1QNTA 2YTOA 4F54A 1AAYA 4BBYA 1X5WA 2DMIA 2EM4A 2BBGA 2ODRD 2CTDA 1EH7A 2F4VE 2GLIA 4GKKE 1YSAC 1YPNA 1ZU1A 2I9IA 2CSHA 2VE7C 2EMCA 2YTIA 4P78A 3LMLA 2EN7A 3HXLA 2LCEA 4ZYEA 2EMIA 1IBKE 1QU6A 2YWQA 5T6JA 3C4BA 5KL7A 1YYOA 2UUAE 2EOQA 2YU8A 4JI4E 4LFBE 3EPHA 4RH8A 4BHBA 3EPJA 1G2FC 2DIXA 4DR5E 3KZYA 3ADGA 2LVHA 2EM0A 3BGHA 2E5LE 2L2NA 2DSYA 1J5EE 5IT9C 2V85A 5AC4A 2F8BA 2RTXA 3EPKA 3BIDA 4R2QA 1YUIA 1JK1A 1EH8A 3ADIA 4LF5E 2ELYA 2V86A 1A1IA 4DV4E 2EE8A 4R03A 2CT1A 1IMUA 3T1YE 1A1FA 2EOOA 5BR8E 2LV2A 4DV1E 1MGTA 2EQ0A 2KOUA 1SR9A 4KZSA 2EOEA 4JI8E 5AC5A 1BBOA 4YHHE 2EPRA 5A6BD 3FIGA 5AE2A 2EN3A 2ODRC 4B3TE 1P47A 4LF9E 3UK3C 4DV7E 2EOSA 2EOJA 2E1MA 3JTZA 4X65E 1WHNA 2V87A 4GEQB 5DNYA 2NUGA 1HNZE 4JI2E 2L92A 4X9JA 4X8WA 3KWRA 4X66E 5IWAE 1TF6A 1FKAE 2EPCA 1A1JA 2RS7A 5FLXC 2B7VA 1X47A 2R76A 1MEYC 1N36E 1HNWE 1N33E 4WXCA 2KONA 2B9DA 2NUEA 3HPZA 1UBDC 3BF2A 4M9VC 1J26A 2YTPA 4O5GA 2JXPA 2D9HA 2EPZA 2EPLX 4R2EA 4WXDA 2CPNA 4HTGA 4DUZE 2N8XA 2EPPA 4R2DA 4F9BB 4X62E 1GQEA 2FGGA 3MSWA 3ZOQB 5A69A 2ELZA 1G2DC 3K6QA 2EORA 1F2IG 2MDGA 2V88A 2YTNA 4JI7E 1X49A 4MLQA 2EMLA 1KJKA 1ZBQA 4DR1E 1L4SA 4BCAA 2GHFA 3DJWA 3OMLA 2M9AA 2Q8UA 5A6JA 2LJUA 4DR6E 2MC6A 1LLMC 2YSPA 3IWCA 4AQYE 2YTFA 2JVAA 4DUYE 1TF3A 5A6KA 4KHPE 2JOBA 2EM5A 2EL5A 2EMBA 4JYAE 5AASA 2LTSA 1GTKA 2HJJA 2IHR1 2BB8A 2UU9E 2DLKA 4K0KE 2YZTA 4R2RA 1X6FA 1A1KA 2EMFA 3ADJA 2WBUA 5LL6R 2EN4A 3OTOE 2B7TA 3AUZA 2RS6A 5LLQA 1Z1BA 2L3CA 4N4RB 4R2AA 2ENHA 2V89A 2EM2A 1WRJA 4WPYA 1IQSA 3L00A 2LE2A 2YRHA 2DLQA 4B3RE 2JWOA 2G7HA 3LLHA 4GZNC 1EKZA 1YZ9A 1RMDA 4DR2E 2JYAA 2UXBE 4LF4E 2EMXA 5LMNE 2V8QB 1WJPA 3C6MA 3HPSA 2WZOA 4DV2E 2EM8A 2EOFA 5AE1A 1RC7A 4M2ZA 1X48A 3EQ1A 1DGCA 4BS9A 3DF6A 1T39A 4NXNE 4HEIA 2HHHE 4DV0E 2EOHA 1AH5A 2A25A 2VQEE 4DV3E 1NCSA 4WX9A 1STUA 4BC9A 5AE3A 2R1FA 1HNXE 2HGHA 1PJSA 2EPXA 2H36X 2K4VA 1PKPA 2RSIA 2RSMA 1T4OA 5CFFE 2I13A 5KL5A 4YY3E 3KZZA 1IBLE 3IWDA 4ZYGA 4DR4E 2JY9A 2UXCE 4O4KA 1PJQA 2UUBE 2LJHA 2M7QA 1PJTA 3THOB 2YU5A 2EN2A 4NHRA 2ADRA 2V83A 3JU0A 3ADLA 1XMQE 5A2QC 2EMGA 4I8OA 2NA2A 2VF1A 4DV6E 2JP9A 1T4LB 3F6GA 2K7IA 3C6KA 2FTXB 1I94E 2EL6A 1RQ0A 5F3WA 4DR3E 1T4NA 2VRDA 4F6NA 4DKKA 5KL2A 4LF8E 2EWLA 1A1LA 4R8OA 2L33A 1WHQA 4J8ZA 1X6HA 2MDRA 2DGCA 2DB2A 4RHBB 2EOZA 2EPUA 2ENAA 1X3CA 4JI5E 3VYXA 4M0VA 2YTGA 2MKDA 1X6EA 1IQOA 4IJDA 4WSGA 2LBSB 1DI2A 4F9CB 2UXDE 2EMZA 5IXMB 4DMIA 2EPNA 3JAMC 5KL6A 3VYYA 3HTXA 4JV5E 1UHZA 1A1GA 3TQMA 2JOXA 2UUCE 4JI0E 4KWYA 2YT4A 2GPIA 2EMAA 4NXME 1SFEA 2EMHA 3C4TA 4NZVA 4JI3E 2EM7A 2WCC3 2M1SA 4LFCE 1FJGE 3RMPA 2NUFA 2FV4B 2ENCA 4R2PA 1NEIA 1YYKA 2LO3A 4P7DA 2L6MA 2KHXA 2M4IA 4BC7A 2EL4A 2EOIA 3BBGA 1HR0E 4LF7E 2EMYA 4OX9E 1UILA 4JI1E 2B3TB 5KL4A 2RPCA 1BBGA 4WFTA 2DMYA 2EQ1A 5A6BA 2LMZA 3AV0A 2WBTA 2EM3A 2EZ6A 5ADZA 2ZM6E 1TN9A 1XNRE 3J7AG 2YRMA 4ZYHA 4FK5C 2WBSA 4GKJE 4R2SA 1IBME 4MLVA 4LF6E 2EOYA 2E72A 2YSOA 4B3SE 1ZAAC 4Q28A 2EJ4A 1JK2A 2EMKA 4LFAE 4LU9A 2L8TA 3IWBA 5A6AA 2JPAA 4M30A 2EN6A 2EOMA 2LRSA 1YYWA 2L3JA 2PRTA
chains in the Genus database with same CATH topology
2EM9A 2EMGA 2EOQA 2YU8A 1ZR9A 2JP9A 2EMLA 1KJKA 2J7JA 3EPHA 2GHFA 2M9AA 2EL6A 3EPJA 1G2FC 1LLMC 2YSPA 2VRDA 2YTDA 4F6NA 2LVHA 2YTFA 2EM0A 5KL2A 1TF3A 1BB8A 3EPKA 1A1LA 4R2QA 1X6HA 1YUIA 1JK1A 2DGCA 2EM5A 2EL5A 2EMBA 2ELYA 2YTEA 3MHSC 2EOZA 1A1IA 2BB8A 2EPUA 2DLKA 1A1HA 4IS1C 4R2RA 1X6FA 2ENAA 1X3CA 2EN8A 1B69A 1A1KA 2EMFA 2EE8A 2YTGA 2YTJA 2MKDA 2WBUA 1X6EA 2EN4A 2CT1A 4IJDA 2EMWA 4WSGA 2EPAA 1A1FA 2YRKA 2EOOA 1Z1BA 2EMZA 5KL6A 2LV2A 2DRPA 2EQ0A 4R2AA 2ENHA 1A1GA 2EM2A 2EOEA 4F6MA 2EM6A 1BBOA 2YRHA 2EPRA 2DLQA 2EMAA 2EN3A 2EQ3A 2EN1A 1P47A 2EMHA 4GZNC 3UK3C 2EM7A 1RMDA 2WCC3 2EOSA 2EOJA 2EMXA 2YTQA 1WJPA 2ENCA 4R2CA 2MKNA 4R2PA 2EM8A 2EOFA 2NABA 1UN6B 1YUJA 1DGCA 2LO3A 3EPLA 2EL4A 2EOIA 4X9JA 2LT7A 4F2JC 1TF6A 2EMYA 5KL3A 2EPCA 1A1JA 2EOHA 3MHHC 2EOXA 1MEYC 2EP3A 2A25A 3M99B 5KL4A 2RPCA 3VHTB 1UBDC 4M9VC 1NCSA 2YTPA 2YTOA 2EQ1A 1AAYA 2R1FA 2D9HA 2HGHA 1X5WA 2DMIA 2WBTA 2EM3A 2EM4A 2EPXA 2EPZA 2CTDA 2RSIA 1TN9A 2GLIA 2I13A 4R2EA 2YRMA 1YSAC 5KL5A 1ZU1A 4FK5C 2WBSA 2CSHA 4R2SA 2EMCA 2YTIA 2EOYA 2EN7A 2E72A 2YSOA 1ZAAC 2EPPA 2LCEA 4R2DA 2EMIA 2EJ4A 1JK2A 2EMKA 2YU5A 2EN2A 2ELZA 2ADRA 1G2DC 2EORA 2JPAA 1F2IG 2EN6A 2EOMA 2MDGA 5KL7A 2YTNA 2PRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM9 A;  2EMG A;  2EOQ A;  2YU8 A;  1ZR9 A;  2JP9 A;  2EML A;  1KJK A;  2J7J A;  3EPH A;  2GHF A;  2M9A A;  2EL6 A;  3EPJ A;  1G2F C;  1LLM C;  2YSP A;  2VRD A;  2YTD A;  4F6N A;  2LVH A;  2YTF A;  2EM0 A;  5KL2 A;  1TF3 A;  1BB8 A;  3EPK A;  1A1L A;  4R2Q A;  1X6H A;  1YUI A;  1JK1 A;  2DGC A;  2EM5 A;  2EL5 A;  2EMB A;  2ELY A;  2YTE A;  3MHS C;  2EOZ A;  1A1I A;  2BB8 A;  2EPU A;  2DLK A;  1A1H A;  4IS1 C;  4R2R A;  1X6F A;  2ENA A;  1X3C A;  2EN8 A;  1B69 A;  1A1K A;  2EMF A;  2EE8 A;  2YTG A;  2YTJ A;  2MKD A;  2WBU A;  1X6E A;  2EN4 A;  2CT1 A;  4IJD A;  2EMW A;  4WSG A;  2EPA A;  1A1F A;  2YRK A;  2EOO A;  1Z1B A;  2EMZ A;  5KL6 A;  2LV2 A;  2DRP A;  2EQ0 A;  4R2A A;  2ENH A;  1A1G A;  2EM2 A;  2EOE A;  4F6M A;  2EM6 A;  1BBO A;  2YRH A;  2EPR A;  2DLQ A;  2EMA A;  2EN3 A;  2EQ3 A;  2EN1 A;  1P47 A;  2EMH A;  4GZN C;  3UK3 C;  2EM7 A;  1RMD A;  2WCC 3;  2EOS A;  2EOJ A;  2EMX A;  2YTQ A;  1WJP A;  2ENC A;  4R2C A;  2MKN A;  4R2P A;  2EM8 A;  2EOF A;  2NAB A;  1UN6 B;  1YUJ A;  1DGC A;  2LO3 A;  3EPL A;  2EL4 A;  2EOI A;  4X9J A;  2LT7 A;  4F2J C;  1TF6 A;  2EMY A;  5KL3 A;  2EPC A;  1A1J A;  2EOH A;  3MHH C;  2EOX A;  1MEY C;  2EP3 A;  2A25 A;  3M99 B;  5KL4 A;  2RPC A;  3VHT B;  1UBD C;  4M9V C;  1NCS A;  2YTP A;  2YTO A;  2EQ1 A;  1AAY A;  2R1F A;  2D9H A;  2HGH A;  1X5W A;  2DMI A;  2WBT A;  2EM3 A;  2EM4 A;  2EPX A;  2EPZ A;  2CTD A;  2RSI A;  1TN9 A;  2GLI A;  2I13 A;  4R2E A;  2YRM A;  1YSA C;  5KL5 A;  1ZU1 A;  4FK5 C;  2WBS A;  2CSH A;  4R2S A;  2EMC A;  2YTI A;  2EOY A;  2EN7 A;  2E72 A;  2YSO A;  1ZAA C;  2EPP A;  2LCE A;  4R2D A;  2EMI A;  2EJ4 A;  1JK2 A;  2EMK A;  2YU5 A;  2EN2 A;  2ELZ A;  2ADR A;  1G2D C;  2EOR A;  2JPA A;  1F2I G;  2EN6 A;  2EOM A;  2MDG A;  5KL7 A;  2YTN A;  2PRT A; 
#chains in the Genus database with same CATH topology
 2EM9 A;  1N34 E;  1ZR9 A;  2JR1 A;  4DV5 E;  3F6H A;  4DR7 E;  4WSP A;  2J7J A;  1N32 E;  1DQ3 A;  5TSE A;  2MC5 A;  1O0W A;  3H09 A;  2YTD A;  4Q35 B;  2YPN A;  3J81 C;  4L5N C;  2N3G A;  1EH6 A;  4WYQ B;  1XMO E;  1BB8 A;  4F9A B;  4TUG A;  1WXR A;  4L8N A;  2YTE A;  3MHS C;  1A1H A;  3THN A;  1PDA A;  2VQF E;  4IS1 C;  3P1X A;  4OOG C;  2EN8 A;  1B69 A;  1XNQ E;  2YTJ A;  2EMW A;  2EPA A;  2YRK A;  4X64 E;  1N3G A;  2L2K B;  4B3M E;  1T38 A;  3HQ1 A;  2DRP A;  2HC5 A;  4JI6 E;  4O43 A;  2LUP B;  4F6M A;  2EM6 A;  4BHC A;  4TUI A;  2EPK X;  3J7Y p;  1YFH A;  2LUQ A;  2EQ3 A;  2EN1 A;  5IV8 B;  4O24 A;  4ZYD A;  3VK6 A;  1GZ6 A;  2YTQ A;  3T1H E;  1ZBT A;  4R2C A;  2MKN A;  2LTR A;  2NAB A;  1UN6 B;  1KYQ A;  2RQL A;  1YUJ A;  2EPO A;  3EPL A;  3J80 C;  5LMU E;  2L2M A;  4LTY A;  2EPM X;  2LT7 A;  3QG5 C;  4F2J C;  5KL3 A;  3MHH C;  2EOX A;  2EP3 A;  3ECR A;  3M99 B;  3VHT B;  2N3H A;  4BMJ A;  1QNT A;  2YTO A;  4F54 A;  1AAY A;  4BBY A;  1X5W A;  2DMI A;  2EM4 A;  2BBG A;  2ODR D;  2CTD A;  1EH7 A;  2F4V E;  2GLI A;  4GKK E;  1YSA C;  1YPN A;  1ZU1 A;  2I9I A;  2CSH A;  2VE7 C;  2EMC A;  2YTI A;  4P78 A;  3LML A;  2EN7 A;  3HXL A;  2LCE A;  4ZYE A;  2EMI A;  1IBK E;  1QU6 A;  2YWQ A;  5T6J A;  3C4B A;  5KL7 A;  1YYO A;  2UUA E;  2EOQ A;  2YU8 A;  4JI4 E;  4LFB E;  3EPH A;  4RH8 A;  4BHB A;  3EPJ A;  1G2F C;  2DIX A;  4DR5 E;  3KZY A;  3ADG A;  2LVH A;  2EM0 A;  3BGH A;  2E5L E;  2L2N A;  2DSY A;  1J5E E;  5IT9 C;  2V85 A;  5AC4 A;  2F8B A;  2RTX A;  3EPK A;  3BID A;  4R2Q A;  1YUI A;  1JK1 A;  1EH8 A;  3ADI A;  4LF5 E;  2ELY A;  2V86 A;  1A1I A;  4DV4 E;  2EE8 A;  4R03 A;  2CT1 A;  1IMU A;  3T1Y E;  1A1F A;  2EOO A;  5BR8 E;  2LV2 A;  4DV1 E;  1MGT A;  2EQ0 A;  2KOU A;  1SR9 A;  4KZS A;  2EOE A;  4JI8 E;  5AC5 A;  1BBO A;  4YHH E;  2EPR A;  5A6B D;  3FIG A;  5AE2 A;  2EN3 A;  2ODR C;  4B3T E;  1P47 A;  4LF9 E;  3UK3 C;  4DV7 E;  2EOS A;  2EOJ A;  2E1M A;  3JTZ A;  4X65 E;  1WHN A;  2V87 A;  4GEQ B;  5DNY A;  2NUG A;  1HNZ E;  4JI2 E;  2L92 A;  4X9J A;  4X8W A;  3KWR A;  4X66 E;  5IWA E;  1TF6 A;  1FKA E;  2EPC A;  1A1J A;  2RS7 A;  5FLX C;  2B7V A;  1X47 A;  2R76 A;  1MEY C;  1N36 E;  1HNW E;  1N33 E;  4WXC A;  2KON A;  2B9D A;  2NUE A;  3HPZ A;  1UBD C;  3BF2 A;  4M9V C;  1J26 A;  2YTP A;  4O5G A;  2JXP A;  2D9H A;  2EPZ A;  2EPL X;  4R2E A;  4WXD A;  2CPN A;  4HTG A;  4DUZ E;  2N8X A;  2EPP A;  4R2D A;  4F9B B;  4X62 E;  1GQE A;  2FGG A;  3MSW A;  3ZOQ B;  5A69 A;  2ELZ A;  1G2D C;  3K6Q A;  2EOR A;  1F2I G;  2MDG A;  2V88 A;  2YTN A;  4JI7 E;  1X49 A;  4MLQ A;  2EML A;  1KJK A;  1ZBQ A;  4DR1 E;  1L4S A;  4BCA A;  2GHF A;  3DJW A;  3OML A;  2M9A A;  2Q8U A;  5A6J A;  2LJU A;  4DR6 E;  2MC6 A;  1LLM C;  2YSP A;  3IWC A;  4AQY E;  2YTF A;  2JVA A;  4DUY E;  1TF3 A;  5A6K A;  4KHP E;  2JOB A;  2EM5 A;  2EL5 A;  2EMB A;  4JYA E;  5AAS A;  2LTS A;  1GTK A;  2HJJ A;  2IHR 1;  2BB8 A;  2UU9 E;  2DLK A;  4K0K E;  2YZT A;  4R2R A;  1X6F A;  1A1K A;  2EMF A;  3ADJ A;  2WBU A;  5LL6 R;  2EN4 A;  3OTO E;  2B7T A;  3AUZ A;  2RS6 A;  5LLQ A;  1Z1B A;  2L3C A;  4N4R B;  4R2A A;  2ENH A;  2V89 A;  2EM2 A;  1WRJ A;  4WPY A;  1IQS A;  3L00 A;  2LE2 A;  2YRH A;  2DLQ A;  4B3R E;  2JWO A;  2G7H A;  3LLH A;  4GZN C;  1EKZ A;  1YZ9 A;  1RMD A;  4DR2 E;  2JYA A;  2UXB E;  4LF4 E;  2EMX A;  5LMN E;  2V8Q B;  1WJP A;  3C6M A;  3HPS A;  2WZO A;  4DV2 E;  2EM8 A;  2EOF A;  5AE1 A;  1RC7 A;  4M2Z A;  1X48 A;  3EQ1 A;  1DGC A;  4BS9 A;  3DF6 A;  1T39 A;  4NXN E;  4HEI A;  2HHH E;  4DV0 E;  2EOH A;  1AH5 A;  2A25 A;  2VQE E;  4DV3 E;  1NCS A;  4WX9 A;  1STU A;  4BC9 A;  5AE3 A;  2R1F A;  1HNX E;  2HGH A;  1PJS A;  2EPX A;  2H36 X;  2K4V A;  1PKP A;  2RSI A;  2RSM A;  1T4O A;  5CFF E;  2I13 A;  5KL5 A;  4YY3 E;  3KZZ A;  1IBL E;  3IWD A;  4ZYG A;  4DR4 E;  2JY9 A;  2UXC E;  4O4K A;  1PJQ A;  2UUB E;  2LJH A;  2M7Q A;  1PJT A;  3THO B;  2YU5 A;  2EN2 A;  4NHR A;  2ADR A;  2V83 A;  3JU0 A;  3ADL A;  1XMQ E;  5A2Q C;  2EMG A;  4I8O A;  2NA2 A;  2VF1 A;  4DV6 E;  2JP9 A;  1T4L B;  3F6G A;  2K7I A;  3C6K A;  2FTX B;  1I94 E;  2EL6 A;  1RQ0 A;  5F3W A;  4DR3 E;  1T4N A;  2VRD A;  4F6N A;  4DKK A;  5KL2 A;  4LF8 E;  2EWL A;  1A1L A;  4R8O A;  2L33 A;  1WHQ A;  4J8Z A;  1X6H A;  2MDR A;  2DGC A;  2DB2 A;  4RHB B;  2EOZ A;  2EPU A;  2ENA A;  1X3C A;  4JI5 E;  3VYX A;  4M0V A;  2YTG A;  2MKD A;  1X6E A;  1IQO A;  4IJD A;  4WSG A;  2LBS B;  1DI2 A;  4F9C B;  2UXD E;  2EMZ A;  5IXM B;  4DMI A;  2EPN A;  3JAM C;  5KL6 A;  3VYY A;  3HTX A;  4JV5 E;  1UHZ A;  1A1G A;  3TQM A;  2JOX A;  2UUC E;  4JI0 E;  4KWY A;  2YT4 A;  2GPI A;  2EMA A;  4NXM E;  1SFE A;  2EMH A;  3C4T A;  4NZV A;  4JI3 E;  2EM7 A;  2WCC 3;  2M1S A;  4LFC E;  1FJG E;  3RMP A;  2NUF A;  2FV4 B;  2ENC A;  4R2P A;  1NEI A;  1YYK A;  2LO3 A;  4P7D A;  2L6M A;  2KHX A;  2M4I A;  4BC7 A;  2EL4 A;  2EOI A;  3BBG A;  1HR0 E;  4LF7 E;  2EMY A;  4OX9 E;  1UIL A;  4JI1 E;  2B3T B;  5KL4 A;  2RPC A;  1BBG A;  4WFT A;  2DMY A;  2EQ1 A;  5A6B A;  2LMZ A;  3AV0 A;  2WBT A;  2EM3 A;  2EZ6 A;  5ADZ A;  2ZM6 E;  1TN9 A;  1XNR E;  3J7A G;  2YRM A;  4ZYH A;  4FK5 C;  2WBS A;  4GKJ E;  4R2S A;  1IBM E;  4MLV A;  4LF6 E;  2EOY A;  2E72 A;  2YSO A;  4B3S E;  1ZAA C;  4Q28 A;  2EJ4 A;  1JK2 A;  2EMK A;  4LFA E;  4LU9 A;  2L8T A;  3IWB A;  5A6A A;  2JPA A;  4M30 A;  2EN6 A;  2EOM A;  2LRS A;  1YYW A;  2L3J A;  2PRT A; 
#chains in the Genus database with same CATH homology
 2EM9 A;  2EMG A;  2EOQ A;  2YU8 A;  1ZR9 A;  2JP9 A;  2EML A;  1KJK A;  2J7J A;  3EPH A;  2GHF A;  2M9A A;  2EL6 A;  3EPJ A;  1G2F C;  1LLM C;  2YSP A;  2VRD A;  2YTD A;  4F6N A;  2LVH A;  2YTF A;  2EM0 A;  5KL2 A;  1TF3 A;  1BB8 A;  3EPK A;  1A1L A;  4R2Q A;  1X6H A;  1YUI A;  1JK1 A;  2DGC A;  2EM5 A;  2EL5 A;  2EMB A;  2ELY A;  2YTE A;  3MHS C;  2EOZ A;  1A1I A;  2BB8 A;  2EPU A;  2DLK A;  1A1H A;  4IS1 C;  4R2R A;  1X6F A;  2ENA A;  1X3C A;  2EN8 A;  1B69 A;  1A1K A;  2EMF A;  2EE8 A;  2YTG A;  2YTJ A;  2MKD A;  2WBU A;  1X6E A;  2EN4 A;  2CT1 A;  4IJD A;  2EMW A;  4WSG A;  2EPA A;  1A1F A;  2YRK A;  2EOO A;  1Z1B A;  2EMZ A;  5KL6 A;  2LV2 A;  2DRP A;  2EQ0 A;  4R2A A;  2ENH A;  1A1G A;  2EM2 A;  2EOE A;  4F6M A;  2EM6 A;  1BBO A;  2YRH A;  2EPR A;  2DLQ A;  2EMA A;  2EN3 A;  2EQ3 A;  2EN1 A;  1P47 A;  2EMH A;  4GZN C;  3UK3 C;  2EM7 A;  1RMD A;  2WCC 3;  2EOS A;  2EOJ A;  2EMX A;  2YTQ A;  1WJP A;  2ENC A;  4R2C A;  2MKN A;  4R2P A;  2EM8 A;  2EOF A;  2NAB A;  1UN6 B;  1YUJ A;  1DGC A;  2LO3 A;  3EPL A;  2EL4 A;  2EOI A;  4X9J A;  2LT7 A;  4F2J C;  1TF6 A;  2EMY A;  5KL3 A;  2EPC A;  1A1J A;  2EOH A;  3MHH C;  2EOX A;  1MEY C;  2EP3 A;  2A25 A;  3M99 B;  5KL4 A;  2RPC A;  3VHT B;  1UBD C;  4M9V C;  1NCS A;  2YTP A;  2YTO A;  2EQ1 A;  1AAY A;  2R1F A;  2D9H A;  2HGH A;  1X5W A;  2DMI A;  2WBT A;  2EM3 A;  2EM4 A;  2EPX A;  2EPZ A;  2CTD A;  2RSI A;  1TN9 A;  2GLI A;  2I13 A;  4R2E A;  2YRM A;  1YSA C;  5KL5 A;  1ZU1 A;  4FK5 C;  2WBS A;  2CSH A;  4R2S A;  2EMC A;  2YTI A;  2EOY A;  2EN7 A;  2E72 A;  2YSO A;  1ZAA C;  2EPP A;  2LCE A;  4R2D A;  2EMI A;  2EJ4 A;  1JK2 A;  2EMK A;  2YU5 A;  2EN2 A;  2ELZ A;  2ADR A;  1G2D C;  2EOR A;  2JPA A;  1F2I G;  2EN6 A;  2EOM A;  2MDG A;  5KL7 A;  2YTN A;  2PRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...