1T39A

Human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
151
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3'
publication title DNA binding and nucleotide flipping by the human DNA repair protein AGT.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 151
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t39A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1t39A01
1WWXA 3KP6A 1O7LA 3RKWA 1GHCA 3W6KB 1XGOA 1Q1HA 2NNYA 2GXBA 1I27A 5CVRA 4I01A 2RGVA 2MH9A 2F2EA 2JPCA 4HLXA 4YFKF 2IRFG 5K5RA 2L3DA 2GAUA 2PI0A 2LF8A 3FZVA 5D4SA 3TO9A 2G7UA 2WWYA 3FF5A 4IXAA 4R79A 4EM2A 4FT8A 3E97A 5LLQA 1V4RA 1USSA 3SXYA 5E8IA 2F5CA 3WTZA 4L0YB 4Q4ZF 5L3CA 1T39A 4L18B 2KIUA 1B6AA 1TQIA 5H6RA 4P55A 1RUOA 2HQRA 1XD7A 3GZ6A 1G6NA 1Z6TA 2P5LC 3BPXA 2DO7A 3FXUA 3R61A 1HBXG 4EM0B 3VEPA 1HXDA 1U5TA 2E1NA 3I4PA 1LDDA 4XLNF 1U5TC 2JRTA 1R23A 2E1CA 3CJNA 3CO7C 4MTDA 4S04A 3C1DA 3HRTA 1OYWA 2H09A 5JVTA 3IWZA 2ETHA 1S6LA 1TQPA 2R7FA 2FBHA 3R4KA 3BDDA 5HDNA 4XSXF 4OIOF 4M72A 3KCCA 1HKSA 4KN4X 4NB5A 1EH6A 2P6TA 3ECOA 1KU2A 4ZYHA 1BIAA 3O6BB 2OZ6A 3GFIA 4R1HA 2ESNA 2BBYA 2Z33A 2QYOA 1ZLKA 2Z99A 1OYYA 5HLIA 3JTGA 5BOXA 3E5QA 3MZHA 4BHPA 4PDKA 4HA8A 1ON1A 1ZH5A 4EV0A 1ON2A 2DW4A 3Q5FA 4KICA 2KJBA 4BYYA 1C0WA 2VT3A 3K0LA 2ESHA 2IJLA 3V7RA 2DK5A 4OU0A 4HF0A 2HKOA 3NRVA 5E18F 1KA8A 1BM9A 4OINF 1E2XA 3V7SA 5HVQC 3IL2A 2O6GE 2STTA 4F7ZA 1IXRC 4O3MA 4LLNA 1XGMA 2PEXA 3P9CA 3KZYA 2MBFA 1IN4A 1R22A 3L9FA 3WGGA 3V4GA 2D2WA 2NYXA 3T8TA 2FNPA 1EV7A 3R60A 2C6YA 2ZMEA 1I6XA 1ZYRF 2OQRA 1YYVA 2HEOA 2HYGD 1T6SA 2RV8A 2VBWA 2D1VA 5HOOA 2FXAA 4AIHA 5ILVA 3IWFA 2A07F 1K78B 2HQNA 4L0ZB 1XSDA 3IRQA 1X3UA 2UXXA 3HHGA 5L3GA 2FF4A 5ERIA 1BN5A 3D0SA 4KUMA 5LHIA 2EA2A 4MQ9F 4ZH4F 5D5UB 2HFHA 1XMAA 1HKTA 1U5TB 1ZN2A 1CGPA 2X0LA 1V3FA 4ENJA 1ZG5A 3CUOA 3T1BA 2FMYA 1TW3A 3ZMTA 1W5TA 4HOBA 3TDZC 4M6XA 3EQLF 3FMSA 2LNBA 2CFXA 1YS6A 3WTXC 1O7FA 2GA2A 3ELKA 4EJOA 3QP6A 3LA7A 1U78A 2EFNA 3TDUC 2ZBKA 3GLXA 3GXOA 2QWWA 3M9AA 4DQ2A 2AS5F 1ZGAA 4KFCA 4IJAA 1FWZA 2K02A 5IT3A 4PZJA 2XAJA 4Y17A 4OIRF 4U0VA 3REOA 1Z6RA 3M8EA 1SD6A 3WE3A 4MEXF 3DKWA 4ENNA 2E7WA 2CWEA 4G7ZF 3COAC 1FLIA 1IN6A 5E8GA 2RN7A 3ZPLA 3LA3A 5LHGA 1IXSB 3WTYC 2ZFWA 2ZO4A 5L3DA 2Y0MA 4IRIA 2FMLA 3VB2A 1QNTA 2R7DA 2VE8A 4K2EA 5FGMA 2QENA 4EM1A 2IT0A 1FSEA 4ZYGA 3P9KA 3J80K 4AIJA 4PGHA 2D45A 4I7HA 2ZNZA 3ZN0A 2H94A 4E70A 3BJAA 4G7OF 4LK1F 4N0BA 1LDKB 4GYGA 3GW2A 5LEKA 4MEYF 1YW7A 4B09A 3W6JB 4I98B 3V8LA 4HLYA 2MC3A 4O5VA 5DEQA 1P2FA 3CLOA 1MDMA 3IKTA 1R5GA 3KLOA 3M1EA 4WX9A 3F3XA 3KP2A 1ZARA 1EH7A 1YQAA 3EYYA 3FM5A 2XKPA 4UVBA 2DK8A 3GEZA 4YIFA 4G6QA 3V8KA 4CO8A 3WU1B 2DFIA 1IRGA 2OZUA 2M1BA 1Y0UA 4Q48A 1K6OA 1T2KA 2XHKA 3LWFA 5KK1A 5DCMA 4EGZA 1MJ9A 3RJPA 1Z1DA 1PUEE 2YSRA 4JQFA 1RNLA 1BIBA 2GZWA 2PG4A 5ICEA 3DQVC 1JE8A 1JGSA 4CDGA 6PAXA 5F64A 2DI3A 4G6DA 4LLGF 5CVVA 4GGGA 2QVOA 5FFZA 4MTEA 1P6RA 2HKXA 2V9VA 4BNCA 3NEUA 5FD5A 2P6SA 1P4WA 3OV8A 2P4WA 2FEZA 5CVJA 5E1WA 1MJBA 1SFUA 1DPRA 2HZTA 4ZYEA 2V6CA 4Y15A 1XGNA 4ASNA 4OMYA 3CUQB 4A0ZA 1YO5C 5E1XA 2ZXJA 1XDSA 4M6YA 2OU2A 4MNUA 4O6JA 4YIIA 2IPQX 1IN7A 2VODA 5D6EA 4WXCA 4FX4A 1BI2A 3U1DA 4A12A 4A5NA 4RB1A 3VOEA 1WSUA 2QLZA 2DQRA 2O0YA 1IN8A 1FX7A 3PQKA 3T8RA 4DNCA 2EFWA 4UUVA 2HTSA 2PFBA 2QQ9A 1U8RA 3V8JA 3ZQ7A 3LQQA 3E6DA 4WWCA 3RPQA 4IRHA 2J5OA 2RC4A 1U2WA 4LD5A 5K5OA 1YW9A 3F8MA 4YG2F 2FRHA 1ZGJA 2R3SA 1F1ZA 4I0BA 1PP7U 3HRUA 4CGZA 2EFOA 4P9FA 5J8FA 1H9GA 1CF7A 1G3TA 5F6FA 2XIGA 5JHUA 4M73A 4I0AA 2W24A 3HOTA 4Q5SF 2J5PA 4IPAA 1S8NA 3I59B 4OOIA 1FYMA 2EWNA 3RDIA 2HR3A 2NAZA 2W85A 5CVUA 2HYFA 1W5SA 5FLXK 3F8BA 2K4JA 3FMQA 3ECHA 5DCMB 1A04A 1O3QA 3BY6A 1KU9A 3RKYA 2D1HA 1W7PB 3NQOA 5HS9A 1HSJA 2EB7A 2RNJA 3HTUA 4UV8A 2OBPA 2Z5UA 4A2UA 3D5LA 4A0YA 3HOSA 5BPDA 1YTYA 1TNSA 2L54A 3KETA 3TGNA 5IT9Z 4LFUA 2F5EA 2XVCA 1T0FA 5LBQA 1U6GA 5K1YA 2EV5A 1B9NA 4HF1A 4RS8A 3HHHA 3K9TA 1BC7C 4M9ZA 3CO6C 3IKVA 4QLCU 2VONA 1W4MA 4A6EA 2XRNA 2VN2A 1FBUA 3KZZA 3O2PE 3GYHX 1BBYA 3E3VA 2V1XA 5ICGA 2DLLA 1IUYA 2H6BA 4KIGA 4ESBA 2Q0OA 4ESJA 4P96A 4G94A 2EFPA 4N9IA 4LJZF 2G9WA 1SAXA 1MGTA 3L2CA 3S2WA 1SFXA 5H20A 3HTSB 5BPIA 4Y13A 4EVIA 2GIVA 3J81K 4HDVA 3RTRA 2KRFA 2GA1A 1BJAA 1L3LA 3I54A 2VT2A 4EMSA 1S7OA 5J6XA 2CGPA 2EA4A 3HRMA 1YIOA 2ZKZA 4I09A 3JW4A 3K69A 4U0WA 2O8XA 2LSOA 4A5MA 2Z3YA 2QQAA 4WXDA 3R6SA 5HLHA 3RI4A 3GWZA 3HRSA 2G7HA 4M71A 4XSZF 2ELHA 3EUHA 5HDKA 4RGXA 1J9IA 4CICA 2DBBA 1RUNA 2XAQA 2M8EA 4BHBA 1J0RA 2L01A 1ULYA 2VBZA 4ENKA 3Q9SA 3MEXA 2Q2EA 5FLXZ 4L5JA 3G73A 2STWA 4HQMA 2EV0A 2Y48A 1I1GA 1SMTA 1I1SA 3GO5A 4OIPF 3CTAA 4RB2C 1MZBA 3F6OA 2EJRA 2IVMA 2W25A 5E20A 5A2QK 2O03A 3ZMVA 4EQQA 3R0AA 2OD5A 1FPQA 1OMIA 3F23A 5D8LB 2KIMA 4HAMA 2KKOA 1YLFA 1O57A 3I5UA 1WI9A 4QWQA 5TJJA 5E17F 3F21A 2FQ3A 2V79A 3HIFA 4IHTA 3L09A 4MQVA 4HQEA 1PP8F 1J75A 4I2OA 4I02A 2ACJA 3I71A 3ZMSA 5ICCA 2QBYA 2FA5A 4TV7A 3E6BA 2LF7A 3L00A 2BEOA 1XSVA 1R58A 3GF2A 2Z9OA 3HSEA 2UXNA 3E6CC 2VE9A 2V1UA 4BXUA 3FXRA 3OOPA 2P5VA 2HDCA 1IRFA 3PQJA 5HS7A 1QPMA 5L3EA 4LB6B 3H92A 1FBSA 3KEQA 2A68F 3J7AO 2VBYA 4HX4A 3I64A 2CW0F 2W57A 3GFLA 1RI7A 3LAJA 5JR3A 4KDPA 2HTJA 3LFKA 1FP1D 3IHUA 3TOAA 4HW0A 4RGRA 3TOBA 3QAHA 3KP5A 1R1UA 1YS7A 4XBFA 3TKYA 2K86A 1FBQA 3T0YA 5ILUA 3SFZA 1DUXC 2ISZA 2DTRA 4CYDA 4RAZA 5DD4A 2ZMEB 2ADUA 5JFRA 1ONVA 2FE3A 2FBIA 3QP5A 5EEGA 3I0TA 1R1TA 5ILSA 2W84A 2H27A 1HW5A 1TW2A 5BMZA 5LHHA 1T98A 1KGSA 2BYVE 1QQIA 1FYKA 4RB3C 2VXZA 1OR7A 2BV6A 2MH2A 4L9JA 2EK5A 1ODDA 2RKHA 1FY7A 3GFMA 5LGTA 3QPTA 2KJCA 3F8CA 4ZYDA 1FC3A 5CVIA 1KYZA 3DV8A 4LLLA 5A2QZ 4HV6A 4XLPF 4HBLA 4OMZA 1FT9A 5D6FA 3SQNA 3BROA 2DU9A 2XAHA 2IP2A 4EJVA 2V1DA 4U7BA 4KN7X 1AOYA 4RGSA 1S7AA 1FP2A 5HLGA 3B73A 1S3JA 3B02A 3KLNA 5LRSA 3TO7A 1WRJA 2P7CB 2XUBA 5DYMA 3T5XA 2YPRA 3P9IA 5F1RA 1HSTA 5D5WB 5BQTA 2JT1A 1P92A 4HYEA 5D5VB 2FU4A 3FM3A 1XB4A 3K1MA 3IRRA 1P4AA 2VC0A 1MD0A 3DXJF 1H9TA 1RZ4A 2RVCA 3JAMK 1XMKA 5CJ9A 1J2XA 3C3WA 3ISPA 3WTWC 3WTSC 1IXCA 2YU3A 2WC2A 1ZLJA 3FWEA 1OYIA 2CYYA 3K1PA 5DUKA 3F22A 1RIOH 3Q9VA 3GVAA 5DV5A 1YG2A 4HX7A 4KMUX 2NS0A 4A6DA 4RAYA 2VOPA 1SD5A 3F6VA 4LGWA 1ZRFA 2VBXA 4UXNA 3MAJA 3BWGA 2P5KA 1REPC 3J80Z 2XAGA 1STZA 3RIRA 4HDUA 3GX4X 3RYRA 3QOPA 2CSOA 3RKXA 4P9UA 3ULQB 2FNAA 1VTNC 2PMHA 5EEHA 5AONA 1BI1A 2BE5F 4YFXF 1MDMB 1TLHB 4H0EA 2DQLA 5H6QA 1KQ0A 3KEOA 4LG0A 2ZNYA 1IF1A 3AAFA 4G7HF 1FSHA 3BOQA 1WKMA 1D8KA 1MJAA 4NQWA 3WTUC 4L9TA 4KT5C 2NRAC 1GXPA 1KU3A 4IRGA 1FZPB 1T38A 3DFGA 4RB0A 3FMRA 3R0JA 2IA0A 4YFNF 1QO0D 3K2ZA 5LGNA 1UCRA 5TRDA 4UHTA 1G3WA 2XGXA 2AXLA 3ABTA 1QZYA 1FNNA 2QUFA 1IN5A 4LB5A 4ZZDA 1LJ9A 3JSPA 1BOAA 1TQMA 2JSCA 3LQRA 4UVCA 3ZMZA 1R00A 2M87A 3K1NA 1FYLA 2XASA 4EJTA 1IZ1A 3BJ6A 2F5FA 4ENMA 3LA2A 4U7DA 1K78A 2JZYA 4XRFA 3ML6A 1S29A 3SZPA 4GXOA 1QGPA 3WTTC 3LAPA 2WTEA 4RGUA 2IA2A 5D5XB 3TO6A 2A69F 1F5TA 2CO5A 2OQGA 1XDUA 4EGYA 4M74A 4IHSA 3F8NA 3MFKA 1IAWA 5DUIA 4WCGA 5LGUA 4WK8F 2M5WA 1UFMA 2YX7A 4ZZLA 3ERED 3U2RA 3ZP5A 4CHUA 3JAMZ 2EV6A 1UHWA 4LK0F 2RQPA 3G3ZA 1Z05A 1LQ1A 3KP4A 2MD5A 3MWMA 2A6HF 4N9HA 4AVPA 1BC8C 1HW1A 3RYPA 1G3YA 1XN7A 1J5YA 4S05A 3E6MA 1QZZA 2OAZA 1ZRCA 1TTYA 1Z9CA 2JPBA 1XGSA 2K27A 4BHCA 1CF7B 4HF2A 3BZ6A 1K7AA 4ESFA 2VC1A 3KP3A 3WGIA 3V7CA 3FHZA 3BPVA 4GCVA 4HZFA 4LG0B 4EJUA 2PQ8A 3I53A 4R8HA 2K4BA 1ZHFA 5HDGA 2EFQA 2H6CA 1SD4A 2PMUA 2M30A 4U0YA 2IA1A 4FX0A 1R7JA 1UB9A 2COMA 3MQ0A 3U9GA 3QRFF 2Y75A 2QQBA 1XSXA 1GVJA 4Z2YA 3GFJA 5AIQA 2FSWA 5LEJA 3KP7A 2PBIA 4CZZA 2WV0A 3QPHA 1H0MA 4KYWA 4P5OA 5CLSA 1HW2A 3F8FA 2PN6A 2OA4A 3EDPA 3PFIA 3JSOA 5FO5A 4M9SA 3N97A 3ZMDA 4IVNA 2GQQA 3L7WA 2A5YB 1OPCA 2M45A 3IC7A 1W7PD 2UZKA 1DPUA 4LMYA 1UHMA 3WE2A 1G4DA 1ZREA 4GO1A 1E17A 2DAOA 3EYIA 3WGHA 3MCZA 4L9VA 4EJWA 1MKMA 4PGGA 1D3YA 5L3BA 2MLGA 1JXSA 3MZYA 2B0LA 2ISYA 2NNNA 1O3TA 2YX4A 3GZ5A 3HSFA 4IF4A 2QZ8A 2XKOA 3ZN1A 1HQCA 2DPUA 4NHJA 1BI0A 4UVAA 4KA4A 2HOEA 3WTVC 2FBKA 2ZJ2A 3C18A 3CDHA 2GWRA 2L02A 1KU7A 1B59A 1J7KA 1AWCA 3WG9A 5E1ZB 3TQNA 3JTHA 5DDGA 3ZMUA 5L3FA 2CQKA 5KVRA 3J81Z 3CUQA 4L5IA 4Q47A 2DPDA 1USTA 2F5DA 4FHTA 2YR2A 3SHFA 3CUQC 2LKPA 1NHAA 1I5ZA 1B4AA 1G3SA 5AIPA 4ETSA 3DF8A 1ZAOA 3BJOA 3VODA 2ZCWA 1F4KA 3KFWX 1O3SA 4JBAA 2TDXA 4U88A 2MLKA 4KMFA 1LNWA 3M7GA 2P7VB 1DDNA 2LDUA 1K79A 1PDNC 4OIQF 1XCVA 2HS5A 1R1VA 2HGCA 3H3ZA 3QU3A 1O3RA 4KNYA 1TBXA 2XAFA 3QU6A 1R36A 5ED4A 2A3SA 3VFZA 4MGRA 4D0PA 1TNTA 1R5HA 4KIFA 4B8XA 1L0OC 3WU0A 1DP7P 1ZG1A 3BP8A 3E5UA 2PLYA 2O3FA 3FXQA 1B1BA 2CG4A 3N4MA 4HX8A 3DEUA 3I59A 5DD8A 1LEBA 2KIFA 3O3KA 1KQ8A 1ZG3A 4BAYA 3WODF 2P8TA 1XCBA 1KQ9A 4G9YA 2L4AA 3RPUA 1YW8A 3P7NA 5J8CA 1SD7A 3KE2A 4M9XA 2QM3A 1OKRA 1BI3A 4BH9A 1B9MA 1SMYF 1FOKA 1D8JA 1W7PA 1ZRDA 2QBYB 3HUGA 4HV5A 5K5QA 5IT9K 2JTVA 4UNOA 1GXQA 3DP7A 5JI6A 4AIKA 5D4RA 3HSRA 2A61A 4CXFA 2E7XA 2FOKA 4JK1X 1WQ2A 2IW5A 5D8KB 2O61A 3LSTA 1Z91A 4AWXB 5DCFA 2BGCA 5BS6A 2UWMA 4GYIA 3DPLC 1HKQA 4PCQA 1LB2A 1U3EM 5FB2A 2VOOA 2MA3A 2DT5A 4A0XA 2K7LA 5FFXA 2Q8KA 1EH8A 3M8FA 3ROUA 2X4HA 3EETA 1LDJA 3DPTA 1QBJA 3SZTA 2XROA 2PJPA 3HYIA 3FX3A 2A6EF 1LVAA 1J59A 1D5VA 4WF2A 5HS8A 2GXGA 4L9NA 1LEAA 3I58A 4BQAA 1SFEA 5ICFA 3H3UA 3E5XA 3GUDA 5LRRA 1JHFA 4G8XA 1F9NA 1IW7F 1Z7UA 4KIBA 1YFHA 1P4XA 2HWVA 2XV4S 3F72A 4MHGA 2RDPA 1KYWA 2L4MA 5CYVA 4ON0A 5FD6A 1JHHA 4UV9A 4WXHA 3ABUA 4AD9A 3C7JA
chains in the Genus database with same CATH superfamily
1WWXA 3CQZJ 3KP6A 2CV1A 2WADA 3E0JB 1WPKA 2ZJQF 1O7LA 3HPSA 3RKWA 1UMQA 1D5YA 2CUEA 4JOMA 1GHCA 3W6KB 3CCRI 4N4NB 1XGOA 1Q1HA 2NNYA 1BA5A 3A02A 3HEFA 2GXBA 1ACIA 2FD5A 2LC2A 2EE8A 1I27A 5CVRA 1Z7LA 5F08A 4I01A 1EKEA 2RGVA 4F3QA 2MH9A 5GPCA 4HNVA 2F2EA 2JPCA 4HLXA 2EM0A 4YFKF 3G1LA 2IRFG 5K5RA 2L3DA 2GAUA 1DGRM 3G1MA 2PI0A 2BVMA 2JVGA 2CV2A 2LF8A 3FZVA 5D4SA 4LOCA 3TO9A 2G7UA 2WWYA 3FF5A 4IXAA 4R79A 2UUBE 1V55H 4EM2A 1FMWA 1HCRA 3Q3SA 4MIMA 1G2HA 4BACA 4E7KA 2EQ3A 1AKHB 3K4NA 4FT8A 1HA8A 3FK7A 1VQOI 3E97A 4X1EA 2V89A 5LLQA 1VQNI 1V4RA 2DA2A 1USSA 3SXYA 5E8IA 2YTNA 1VQKI 2F5CA 2DOEA 1KYQA 3WTZA 2GIZA 3K6GA 1V5FA 2XC7A 2VIXA 2KISA 4L0YB 2EBIA 2JP9A 4Q4ZF 5L3CA 1T39A 3OIPA 2KIUA 2MGQA 3W2AA 4L18B 2YU5A 3MHHC 1B6AA 1TQIA 4PFOA 4E4HA 5H6RA 2JN6A 4P55A 1RUOA 4HTGA 4A3DJ 4DBQA 2PMZA 1HDDC 4MO7A 2HQRA 1XD7A 3CMMA 2EPMX 4GEQB 3GZ6A 3CCSI 2HDDA 1UAAA 1A1IA 3BQZA 1G6NA 3D1NI 1Z6TA 2GBYA 2P5LC 3BPXA 4Q28A 3K4CA 2DO7A 3FXUA 2XPUA 3R61A 2CQ7A 2ZXIA 3PNVA 1HBXG 2VQFE 1B72A 4EM0B 3LMMA 2K9MA 3VEPA 1WJPA 5AC4A 2CTDA 1HXDA 1U5TA 2E1NA 3FK6A 3I4PA 3TL4X 1LDDA 2Y2ZA 3C2BA 1IGNA 1SVMA 1JI8A 2LR8A 4XLNF 1U5TC 3AG2H 2JRTA 2B7TA 2DLQA 1B69A 1R23A 2E1CA 2L9SA 5EG0A 2K4VA 2WV1A 2JA7J 2JUCA 2M1SA 3CJNA 3CO7C 4MTDA 3X2QH 5FLMJ 1MBHA 3A0BC 3C1DA 1ETXA 4S04A 3ZR8X 2RTXA 3HRTA 1MSEC 1XTAA 2KQRA 5KAFC 1OYWA 2H09A 3PUFA 5JVTA 2YPNA 4S0HB 3IWZA 2ETHA 2WZOA 1S6LA 1TQPA 4XLFA 2X6XA 2R7FA 2FBHA 4R2QA 3R4KA 1YRNA 3BDDA 5K7HA 5HDNA 3CLQA 4AU7A 4XSXF 4OIOF 2RQQA 3BLYA 3BZCA 4M72A 5C44J 3JRAA 3KCCA 4XM3A 1HKSA 2RSMA 3C4TA 4KN4X 4NB5A 2EQ0A 5J1UA 1EH6A 2AQFA 1WHNA 4B3RE 2HXOA 5IWAE 4DGWB 4PJLA 3U1KA 3TMOA 2P6TA 3ECOA 1LKXA 1KU2A 4ZYHA 2ZSHB 4I76A 1HOMA 1BIAA 3O6BB 2OZ6A 4QPQA 3GFIA 4R1HA 2ESNA 2BBYA 5E79C 3S15J 2Z33A 2QYOA 1ETYA 2WB1A 4Y7NJ 1ZLKA 1UZCA 2Z99A 1OYYA 4R2PA 3BC8A 5HLIA 3JTGA 5BOXA 3S1RJ 2BVLA 3E5QA 2UU9E 3MZHA 3W2WA 4BHPA 4PDKA 4QIWN 3HOUJ 4HA8A 1O4XA 1ON1A 3JR9A 5H2FC 4BS9A 1ZH5A 4XRSG 1R4MB 4EV0A 1ON2A 2DW4A 2XPWA 5LMUE 1YHQI 4O5GA 2LVSA 4M3FA 1KZHA 3K6QA 3Q5FA 4KICA 4XKVA 1YE9A 2KJBA 3G71I 3LSGA 3OIQA 1Q1VA 4BYYA 1X47A 1E3OC 3JRBA 1C0WA 4DYCA 2VT3A 2FOWA 3K0LA 1R6RA 2EM2A 1I94E 1GV5A 4OAZA 2R7TA 2ESHA 4BXXJ 2IJLA 1A6IA 3V7RA 2DK5A 2R7ZJ 1K83J 2HHHE 4OU0A 1TN9A 4MLOA 2LUPB 4HF0A 2HKOA 3NRVA 2CQNA 1LE8A 5E3MA 3GTMJ 4PFPA 2OF7A 4L8NA 5E18F 5KNLA 2MKNA 1KA8A 1BM9A 1V5GA 1E2XA 4OINF 3V7SA 2K5CA 3BR6A 5HVQC 3IL2A 2O6GE 2STTA 4F7ZA 2R7VA 2JQ7A 1IXRC 4O3MA 4LLNA 1XGMA 2PEXA 3P9CA 3KZYA 2MBFA 2EMLA 1RESA 2I10A 3OL3A 2VJ5A 2VKVA 2VKHA 3AKZA 1IN4A 1GV2A 1MIJA 2H8WA 1R22A 3L9FA 3D5RC 3WGGA 1EJ9A 2Y0SN 3V4GA 1ZQ3P 2D2WA 3A01B 1DQUA 3HKZN 1GTKA 2CU7A 3IAS2 3MD2A 2DGCA 2NYXA 3T8TA 2FNPA 4B3TE 2K9LA 1EV7A 3MKWB 3F9KA 3R60A 2C6YA 2ZMEA 4BBYA 3J80C 1I6XA 1TWFJ 3S3MA 5CQGA 1YJ9I 1ZYRF 4JYAE 2XSDC 2OQRA 1YYVA 1K4SA 1PJTA 2WAFA 4YELA 1LFBA 2HEOA 3LSHA 2GM4A 2HYGD 1T6SA 2RV8A 1WH7A 4C2MJ 2KMUA 3DU5A 4D7NA 5FKLA 3ZQQA 2DXIA 2R7SA 1BJZA 1X1DA 2IS4A 1NG7A 2VBWA 2D1VA 4U87A 2E2IJ 5HOOA 3LSRA 1G2DC 2FXAA 2BXZA 4AIHA 3PO2J 4B44A 2O9LA 2BY0A 5ILVA 3IWFA 2A07F 1K78B 2HQNA 4L0ZB 1XSDA 3IRQA 1X3UA 2UXXA 1ZKGA 3HHGA 3DTEA 5L3GA 3DJWA 2VQEE 4LF8E 3GTPJ 1G2FC 2VL8A 2FF4A 2M8GX 5ERIA 1BN5A 4FE4A 2Y69H 1IDZA 3D0SA 4KUMA 5LHIA 2EA2A 2JMWA 3PFYA 1VZ0A 2A05A 4MQ9F 4ZH4F 2HFHA 5D5UB 3ADLA 2F8BA 1D1BA 3W6VA 1XMAA 2KZVA 2YU9J 2EOHA 1HKTA 2O8KA 1FKAE 1U5TB 1ZN2A 1CGPA 2X0LA 1V3FA 1EF4A 3MMYB 4DV6E 2I9IA 4ENJA 1ZG5A 3CUOA 3P5JA 3T1BA 1QU6A 5LL6R 2FMYA 1TW3A 3ZMTA 3AG4H 1W5TA 1K4TA 2NOJB 4HOBA 3TDZC 3GBGA 1PJRA 4M6XA 4C9YA 3EQLF 3FMSA 2LNBA 2CFXA 2LRDA 3ZQFA 4BJ5C 1YS6A 2EMKA 4XRMA 1UN6B 3WTXC 1O7FA 2JR1A 2GA2A 3ELKA 4EJOA 3QP6A 2DMUA 3LA7A 1U78A 5KL2A 2EFNA 3TDUC 2ZBKA 3GLXA 3GXOA 2QWWA 3M9AA 4DQ2A 1YJNI 2AS5F 4X65E 4LF5E 3ERMA 3ASNH 2OC6A 1D0YA 1ZGAA 1GLNA 3H5NA 4KFCA 3M3YJ 5DTDA 3C2HA 4E7SA 4IJAA 2E2HJ 1FWZA 2K02A 4E7LA 2VPLA 5IT3A 4PZJA 3VPRA 2XAJA 1N34E 1JUPA 4Y17A 4OIRF 3ESWB 4U0VA 3SFIA 1SFKA 2BHYA 4M0VA 2UXCE 4FISA 3REOA 1IO2A 4IOCF 3KIOA 1Z6RA 3M8EA 1SD6A 3WE3A 3KZIC 3WG7H 4BL0B 2CSHA 4DV4E 2F4MB 4MEXF 2UUZA 3DKWA 1ZGWA 2ODRD 4ENNA 2K3PA 2E7WA 4ITVA 2EOOA 4R2AA 2CWEA 2EMZA 2HGHA 4G7ZF 2NVTJ 4DR5E 5J4YA 3COAC 1FLIA 2VI6A 1A35A 2QQ8A 1IN6A 1FOXA 4JYKA 4YY3E 1WH5A 5E8GA 1X6FA 3HZJA 2RN7A 3HOZJ 3ZPLA 3LA3A 4CH7A 5LHGA 1IXSB 1WZ2A 4MFEA 2GXAA 3WTYC 4B3ME 1ETWA 2Z1DA 3OYNA 2W7NA 1JK1A 2ZFWA 1U9NA 2ZO4A 5A6BD 2B7VA 3W3CA 5L3DA 2Y0MA 2MW8A 4IRIA 2FMLA 1NK3P 2VJ4A 2ELKA 1WJBA 3IWBA 3VB2A 2L5QA 5DS9A 1QNTA 2R7DA 2VE8A 3NARA 4K2EA 2QENA 1QHGA 5FGMA 4EM1A 4B47A 1FSEA 3CCUI 2IT0A 4ZYGA 4WYQB 1N75A 4UB6C 1X3WB 2BY2A 2DMTA 4JI7E 5TGTA 4D5FA 3HOWJ 5JLXA 3P9KA 3CP2A 3J80K 4AIJA 4PGHA 2D45A 2GLOA 4I7HA 2ZNZA 3ZN0A 2CH0A 5CQEA 2H94A 4E70A 1QPIA 3BJAA 4E6KG 4FTHA 3GTJJ 4G7OF 4R2CA 4YEJA 3BT9A 2UUCE 4O43A 1X3CA 4LK1F 4N0BA 1LDKB 1KONA 3GW2A 4GYGA 5LEKA 1J5EE 5HLTA 4MEYF 1OCTC 4BKXA 1X2NA 4B43A 1YW7A 4B09A 3W6JB 4J01A 4I98B 3V8LA 4HLYA 4Y33A 3CCYA 3KWRA 5CPRB 4IZZA 2MC3A 5KHDA 1ORKA 1HNZE 4NNJA 4A3GJ 1IDYA 2JSPA 4O5VA 4GDFA 5FRNA 5DEQA 3D5SC 1P2FA 1NEIA 3K4BA 1DGCA 3MZ8A 4QPOA 3J7Yp 3CLOA 1MDMA 3IKTA 1LLMC 1R5GA 3KLOA 3A1YA 3M1EA 4WX9A 3F3XA 4HG2A 3KP2A 2LMDA 4NBQA 3OMYA 1ZARA 3HOXJ 1EH7A 2MC5A 1YQAA 9ANTA 3TBIA 3EYYA 3M8JA 3DF6A 3FM5A 2R76A 2XKPA 4UVBA 1J26A 4FETA 3QOEA 1Y39A 2DK8A 3OYBA 2R7WA 3GEZA 4YIFA 4G6QA 1TF6A 3V8KA 1NTCA 4XR6A 1IQOA 3A2KA 4CO8A 4BBSJ 3WU1B 2YTEA 4ZJZA 1VQ5I 2DB2A 3GTOJ 2DFIA 4RAFA 3BBGA 4DR7E 2E1OA 1IRGA 2OZUA 2M1BA 1Y0UA 2H1LA 3BQYA 2V83A 3H1CA 4Q48A 4CCMA 2PRTA 1VF9A 1K6OA 2N3HA 4DIQA 1WCMJ 1EA3A 1TT0A 2YSPA 4JI6E 3BTLA 2VLAA 1T2KA 2XHKA 3LWFA 1E3HA 3QPLA 5KK1A 5DCMA 5FKMA 2KL4A 4XN3A 3OYAA 4EGZA 1D0XA 1MJ9A 4FK5C 3A0HC 1YJWI 3EPZA 3RJPA 1Z1DA 3OYLA 4M3GA 2IGMA 1PUEE 2YSRA 2VF1A 5EDNA 1VQ8I 4JQFA 1RNLA 1BIBA 2CW7A 2GZWA 2V26A 2PG4A 2EPXA 3OYFA 5ICEA 1MMAA 2LKSA 4MLVA 3DQVC 5F0FA 4PK4A 2LY1A 3AG1H 1JE8A 2JWOA 1JGSA 2ELJA 4CDGA 6PAXA 5F64A 3TP3A 2DI3A 4G6DA 4LLGF 3A03A 5CVVA 4GGGA 5FLXC 2QVOA 3O8HA 2RQLA 5FFZA 2EOMA 2VJIA 2VXDA 1YIJI 2EMYA 2EN4A 4MTEA 1P6RA 1WJDA 2HKXA 2V9VA 1JKQC 2EOFA 4BNCA 1XNQE 3L2VA 3VHTB 2LTSA 2YTQA 3NEUA 1AH5A 1SVOA 5FD5A 5A6KA 3JRIA 3CCJI 2P6SA 1P4WA 2YTPA 3OV8A 2P4WA 3RMPA 2FEZA 2DIXA 3OMLA 5CVJA 3K4JA 5E1WA 3OYCA 3K70C 1MJBA 1SFUA 1DPRA 1WHQA 4BCAA 2NOGA 3H0DA 2HZTA 4ZYEA 2V6CA 4Y15A 2EINH 1XGNA 4X66E 5J3LA 5JVGF 3OTOE 4ASNA 4OMYA 3OYHA 2EL6A 2IHR1 3CUQB 4OWRB 4A0ZA 2RSIA 1OCCH 3CDIA 3CC4I 1YO5C 3VYYA 5E1XA 3OL4A 4QSHA 4JI2E 2MDGA 4Y4RA 2ZXJA 2R5ZA 4LF6E 1XMOE 1XDSA 3GCMA 4M6YA 2LTPA 2OU2A 4MNUA 2GHFA 4O6JA 2MD0A 2IPQX 1IN7A 3DWLE 4YIIA 2VODA 5D6EA 2PMZN 4WXCA 4FX4A 5GTIC 1BI2A 1DP3A 1UHSA 2XB5A 3U1DA 4A12A 2V88A 3HPHA 2NABA 3S93A 4A5NA 4RB1A 1S72I 1YYKA 1X4OA 2YS9A 4UUTA 3VOEA 4BE0A 1WSUA 5J1RA 4R2SA 2RAEA 2L3JA 3H9JA 3RQIA 4CA0A 1RETA 1Y6IA 2CT1A 2QLZA 2DQRA 2O0YA 2IXSA 4NXME 3S1NJ 1M1EB 1IN8A 2DMQA 3S3OA 2JY9A 3Q0VA 1HNXE 2IGOA 4XRSA 1FX7A 4JX5A 4K0KE 3PQKA 3T8RA 4DNCA 2YTGA 2EFWA 1HLVA 3JRCA 1JJ8C 4A3FJ 4UUVA 3PO3J 2CUFA 2HTSA 2PFBA 2QQ9A 2YUSA 1U8RA 1U0JA 3V8JA 2JOBA 1G8XA 3ZQ7A 2KOUA 3LQQA 3E6DA 4WSGA 4WWCA 4DV1E 3RPQA 4IRHA 2J5OA 2L33A 1PDAA 4O24A 2ENAA 2RC4A 2K9NA 1BOBA 1U2WA 2YRKA 1RKTA 1VQMI 4LD5A 5K5OA 1YW9A 5A6BA 2BHZA 3F8MA 4WPYA 2DFFA 4BJ6C 4YG2F 5M5XJ 2FRHA 1ZGJA 1ZTRA 2R3SA 1BW6A 1F1ZA 4R8OA 4I0BA 2V85A 4BQNA 1PP7U 3HRUA 4CGZA 2ZFUA 4X6AJ 3TW7A 2F6CA 2EFOA 4P9FA 2EZKA 2XPVA 5J8FA 1HC8A 3BCBA 3JRDA 5IYBJ 1H9GA 3FHNA 1CF7A 5BR8E 1G3TA 5F6FA 2XIGA 4PJNA 1A1KA 3J81C 3ABMH 3U21A 5JHUA 5FKOA 4M73A 5J47A 4I0AA 2W24A 2EMFA 2EMIA 4F9CB 2BZTA 3HOTA 3LSIA 1OCPA 4Q5SF 1D0ZA 2E5ZA 2J5PA 2XSJC 4IPAA 1S8NA 2ZXHA 3I59B 2R7OA 4FQGA 4OOIA 1FYMA 2EWNA 3RDIA 3O8GA 4PUSA 1OJLA 4LTYA 2HR3A 4II3A 5FRMA 2NAZA 3NAUA 4A93J 2LCEA 2W85A 5CVUA 1W0TA 2LO3A 2X6WA 3UK3C 4IHXA 3DPUA 4BJTA 2HYFA 1W5SA 5FLXK 3F8BA 2K4JA 3FMQA 2IGKA 3ECHA 5DCMB 1A04A 1NG6A 1O3QA 1GT0C 3OYIA 4RLFA 3BY6A 1KU9A 2KLOA 3RKYA 4NZVA 1YX3A 2D1HA 4DR4E 3S32A 3GMEA 1P7IA 1W7PB 1P7JA 3PIPF 2EMWA 1F2IG 3NQOA 5HS9A 3HUGB 2HZDA 1HSJA 2EB7A 2RNJA 3HTUA 1QA6A 4UV8A 3SEQA 2X1EA 3L2RA 2X1CA 2VRDA 3FXMA 3OYDA 2DA6A 1ZAAC 2DMPA 4B48A 2CRGA 2OBPA 2IAIA 2Z5UA 4A2UA 1R5ID 2LY9A 1UHZA 2R5YA 3D5LA 4NC7A 3BIDA 4A0YA 3HOSA 3E1SA 5BPDA 1YTYA 1X1CA 1MBKA 2WY7Q 2OCEA 1TNSA 1JKPC 1FIAA 2L54A 3UR3C 3K7AJ 3DEEA 3DBLB 3KETA 2EQRA 2TCTA 3TGNA 5IT9Z 4LFUA 2B3TB 5BNGA 1T33A 2F5EA 4CYCB 2XVCA 2KPMA 1T0FA 2M2EA 4D5CA 5LBQA 1IQSA 3CJRB 2K85A 4BE2A 3RKQA 1X49A 2XGCA 2L9NA 1PYVA 1U6GA 4R2RA 5K1YA 3DTKA 2EV5A 1B9NA 3ADJA 2X9DA 3SDBA 4HF1A 3TQMA 2R7XA 2EOSA 4LF9E 4RS8A 3HHHA 2LOOA 4DZJA 3K9TA 1J09A 3IH4A 1BC7C 4M9ZA 4F54A 2WBSA 4IL6C 3CO6C 5DNYA 4CCKA 3IKVA 3WHBA 4QLCU 2VONA 1W4MA 2XRLA 4A6EA 1FTTA 4N4OB 4XNFA 5FKKA 3LMLA 4A3BJ 2XRNA 2IGNA 1FOWA 2LLKA 2VN2A 5A2QC 2WY8Q 4Y3OA 2DLKA 1FBUA 3EPHA 1WHUA 2LBFA 3KZZA 2NS7A 2KDOA 3O2PE 3GYHX 2HDWA 1BBYA 1MNMC 4DR3E 4C3HJ 3E3VA 4A3KJ 2V1XA 5ICGA 2JA5J 2DLLA 1IUYA 1YPNA 1B8IA 4R03A 1MBFA 1A6QA 2H6BA 2UV1A 2VQCA 4KIGA 4ESBA 2Q0OA 4AYBA 3OS0A 4P96A 4ESJA 4G94A 2CW8A 2NXNB 3LSJA 2EFPA 5B3SH 4N9IA 4LJZF 4HSTA 2M7QA 2HPIA 2G9WA 3EPKA 1SAXA 1MGTA 2KFDA 2W00A 3TEDA 2HOTA 1RR7A 1UG2A 3SYTA 3L2CA 3S2WA 3VWBA 4P7DA 4RBOA 1SFXA 5H20A 2HC5A 3HTSB 1SVLA 4X8WA 5BPIA 3CP8A 1X6EA 4Y13A 2LH9A 3KEYA 2LVHA 1YYOA 2GIVA 4EVIA 3LLHA 3J81K 4HDVA 3HTXA 5B1AH 4KZSA 1OISA 3RTRA 4RDUA 1TZLA 2G0EA 2KRFA 2EM6A 2GA1A 3VYTB 1BJAA 2MKDA 3S1QJ 1L3LA 1OCRH 2X1DA 3I54A 2VT2A 3QODA 2LT7A 4EMSA 1S7OA 5J6XA 2V87A 3Q0UA 2CGPA 2EA4A 3WHCA 2E5LE 3HRMA 3BG3A 1ZR2A 2RPCA 1YIOA 3H9QA 1D1CA 2YRMA 2ZKZA 3HXLA 2DMIA 1UELB 4I09A 4ABZA 3JW4A 3K69A 4U0WA 3I56I 2O8XA 2LSOA 4A5MA 5IPAA 2DMNA 3TW6A 4W1UA 3ZQLA 2D5VA 1T8IA 2Z3YA 1DI2A 1YOVB 4XMYA 4ANJA 1IV8A 2QQAA 4WXDA 2LYCA 3R6SA 5HLHA 4DV2E 3RI4A 3LL7A 2WAQN 3GWZA 2M0MA 2EH3A 3HRSA 4F93B 2G7HA 2H36X 4XOPA 4KITB 2EP3A 2LBSB 4M71A 4A3IJ 4XSZF 2ELHA 1N77A 1O0WA 4YHHE 3EUHA 2EPKX 5HDKA 4RGXA 1JT0A 1J9IA 3H09A 4CICA 2DBBA 3CC7I 1RUNA 2FJ1A 2EN7A 5AE1A 5B1BH 1Y0NA 2XAQA 4BEHA 2M8EA 4BHBA 1J0RA 2NVYJ 2A5WA 2L01A 2QCOA 4BUPA 1ULYA 3I9V2 2H8RA 2VBZA 2ZMEC 2OTLI 3BTCA 3SEZA 1I3QJ 2E2JJ 2K9QA 4A69C 2CJJA 4J00A 4ENKA 3Q9SA 1Y8RB 1WVRA 4BGDA 3MN2A 3OIOA 3MEXA 2K9SA 2Q2EA 2E35A 2LY2A 3OSGA 5FLXZ 4L5JA 2LFBA 3JRHA 2EMAA 4XKWA 3G73A 2STWA 2R5YB 4HQMA 2WCC3 4M3BA 1WJCA 1S9HA 2Y48A 2EV0A 2X85A 1I1GA 1LVKA 4I99C 1SMTA 3RCOA 2L0KA 3QYEA 4Y52J 3FIWA 1I1SA 1RQ0A 1T4LB 1DU0A 1F43A 3G1OA 3GO5A 4OIPF 3CTAA 4RB2C 2ICWG 2F48A 4PSWA 1MZBA 3F6OA 1IRXA 2EM5A 2EJRA 2IVMA 2JXPA 2W25A 1ITYA 4PJMA 1B72B 5F1JA 3W2VA 4KHPE 5E20A 5A2QK 1IJWC 2UUAE 4HNTA 2M9HA 2O03A 3CESA 3ZMVA 4HNUA 3GTGJ 1Z1BA 4EQQA 3R0AA 3LSKA 4C3IJ 2OD5A 4KISA 1FPQA 3LFUA 1OMIA 3F23A 4B4CA 5D8LB 2KIMA 2V4JC 1AHDP 1AA7A 2Y9YA 3WU2C 1HF0A 4HAMA 3QWLA 5EG0B 3CC2I 2BW3A 2KKOA 3ADIA 1YLFA 2XF5A 4DMIA 3PNTA 4E7JA 2ZSIB 4X9JA 2WBMA 1O57A 3I5UA 2LJHA 3J7YJ 1WI9A 2Z2SB 4QWQA 5TJJA 5E17F 4OOGC 3F21A 3OYMA 1W36D 2FQ3A 2V79A 4J19A 3HIFA 1I3AA 4IHTA 2EOJA 4DYQA 1VQLI 3LSMA 2FQ4A 3L09A 1YRNB 4MQVA 4HQEA 3OYEA 1PP8F 3K4MA 1J75A 4I2OA 2DMYA 4NHRA 2YWQA 4I02A 3VYXA 2ACJA 3I71A 4IQ4A 2HPMA 4LG3A 1AAYA 3ZMSA 5ICCA 2QBYA 2FA5A 4TV7A 4IHVA 2EPLX 1TC3C 2BOLA 3E6BA 2LF7A 3L00A 1UBDC 2BEOA 1XSVA 3K4LA 4DUYE 1R58A 2CQXA 3GF2A 3BTIA 3H5AA 4FE7A 3I3LA 2Z9OA 1PJSA 5A6JA 3HBLA 3HSEA 2UXNA 3E6CC 2VE9A 2V1UA 4BXUA 3FXRA 1N78A 3S2DJ 3OOPA 2L2OA 1JJ6C 2EOEA 2P5VA 5HNFA 2HDCA 4BDZA 4MLQA 2NVUB 3E7LA 1IRFA 4CCJA 3H35A 3PQJA 2VQHA 1YYWA 4JI4E 5HS7A 1ZBQA 4C3JJ 1QPMA 5L3EA 2DA7A 3GLLA 3FKIJ 4LB6B 3H92A 3BF2A 3ABLH 4EEFG 1IRZA 5GAGJ 1PKPA 1FBSA 2L3CA 3KEQA 1BBOA 4F9AB 1GZ6A 2LKXA 5CFFE 4GZNC 1DU6A 5GAEJ 2M0CA 5EZHA 3HGGA 4CSWA 5EYRA 2JVAA 2LD5A 2A68F 3J7AO 3IV5A 3BR0A 2VBYA 1FIPA 3CCLI 4E7IA 3GZNB 3HOYJ 1MH3A 3GTLJ 4HX4A 3I64A 2CW0F 1X5WA 2W57A 3GFLA 3S8PA 4UY8I 2EORA 1RI7A 2R92J 2O5RA 1UG0A 2Y0SA 3LAJA 5JR3A 3VYSB 3HKZA 4AVZA 4KDPA 3Q0WA 4II2A 2HTJA 3LFKA 1IG7A 4JV5E 1FP1D 4DOZA 4DR6E 1LE8B 3S1MJ 3IHUA 4LFAE 3K4KA 3TOAA 1BR1A 1A1JA 4HW0A 4RGRA 4AQYE 1QRYA 2QGUA 1JUMA 2YTDA 1X3ZB 3TOBA 3QAHA 4CCOA 3KP5A 1R1UA 1YS7A 2W48A 3HC7A 4XBFA 4ZDOA 3TKYA 4H4KC 2K86A 1FBQA 3T0YA 4F55A 3NWTA 4IHWA 3JAMC 4XLAA 5ILUA 3SFZA 2EOQA 3GTKJ 5DM7F 1DUXC 4LIUA 2ISZA 2F4IA 4M3DA 2VB6A 2DTRA 4CYDA 4RAZA 5EGOA 5DD4A 1APLC 2ZMEB 2ADUA 5EEAA 2IEKA 5JFRA 2L6MA 3C6MA 1ZK8A 2HQ5A 2ZXWH 2EZIA 1ONVA 2KHMA 2FE3A 5T6JA 2FBIA 3QP5A 5EEGA 3F0CA 3I0TA 4IX7A 1R1TA 3IH2A 5ILSA 1FTZA 1MBJA 2MG4A 2W84A 2BXYA 2EM9A 3FBIB 3OOUA 1HW5A 2H27A 1N33E 2VQLA 4ZDPA 1TW2A 5BMZA 2BBGA 5LHHA 1T98A 4M2ZA 1KGSA 5FLVA 2BYVE 4RA2A 3OS1A 1QQIA 1FYKA 1X1AA 4RB3C 3QG5C 3F6GA 2VXZA 2PJRA 1OR7A 5IOYA 4CZCA 3K10A 1BR2A 3KYCB 1Z21A 2BV6A 1OR7C 2RS6A 2LG4A 4XN0A 2MH2A 2M4GA 4L9JA 2EK5A 4B3SE 1ODDA 1OFCX 2RKHA 1FY7A 2DJNA 3GFMA 5LGTA 2YTFA 2M4IA 3QPTA 2L2MA 2KJCA 4LITA 3F8CA 1DQ3A 4ZYDA 4WSPA 5C4XJ 2E19A 2EIJH 2CV0A 3I4MJ 3PSIA 5IP7J 1FC3A 5CVIA 2JYAA 1KYZA 2HQAA 5LMNE 1F36A 1GVDA 3DV8A 4LLLA 2UXBE 4A3LJ 5A2QZ 2EN8A 4HV6A 3J7AY 4XLPF 4HBLA 3CF5F 3SJMA 3SDGA 4OMZA 1FT9A 5D6FA 1Y1VJ 4XKBA 3L2UA 3SQNA 3BROA 3EQ1A 2DU9A 2EPNA 4N4RB 1FMVA 2XAHA 2IP2A 4EJVA 2V1DA 4F52A 2COBA 4KN7X 4U7BA 4UUSA 1AOYA 1VQ6I 4RGSA 3DBHB 4I6ZA 3T1YE 1S7AA 4A3JJ 1FP2A 5GPAA 3B73A 5HLGA 2VUMJ 1X4PA 1S3JA 4DBRA 2JPAA 2FUG2 3B02A 3KLNA 1Y56A 2E1MA 4F6NA 3C2GA 2LP0A 2EPFA 3S17J 1IC8A 1MMGA 5LRSA 1RC9A 2E1MC 3TO7A 3CMEI 1WRJA 2P7CB 2HNHA 2XUBA 5DYMA 3T5XA 1IBKE 2YPRA 1JT6A 3P9IA 2QSGX 5F1RA 1HSTA 1AU7A 3AV0A 1ZBTA 3IWDA 2LK2A 4Z6YA 5D5WB 2OTJI 4DR2E 5BQTA 2JT1A 2HXIA 2QEXI 3S2HJ 1YUIA 1P92A 2DOFA 3JU0A 1IMUA 1PJQA 2CFOA 3RSNA 4HYEA 2O7OA 4V2FA 2L7ZA 5D5VB 5IP9J 5GAHJ 4DV5E 1TP4A 2FU4A 3FM3A 1XB4A 3HPGA 3K1MA 3BG7A 5HODA 2MC6A 3IRRA 3ZOQB 1P4AA 4D7MA 5KL4A 4X62E 2L92A 1MBGA 2VC0A 5FROA 3BG6A 1WGXA 4GKKE 1MD0A 5C4JJ 2EM4A 2VASA 5AASA 3DXJF 2JVHA 2KRHA 5KCMA 1H9TA 1RZ4A 2RVCA 3JAMK 1XMKA 5CJ9A 1J2XA 3C3WA 1YI2I 2L2NA 2M4KA 3FXOA 3ISPA 3WTWC 5EZGA 3WTSC 1IXCA 2YU3A 4CUGA 2WC2A 1ZLJA 3FWEA 1SANA 2YRHA 4RH8A 1OYIA 2CYYA 1I50J 1LPQA 2GOXB 3K1PA 2VJJA 5DUKA 3PIOF 3F22A 1RIOH 2F4OB 2DA5A 4R2EA 2ODRC 2AXTC 3Q9VA 3GVAA 5DV5A 1YG2A 4HX7A 1MMSA 4KMUX 2NS0A 4A6DA 2J7JA 4RAYA 2VOPA 2JWTA 1SD5A 4LF7E 3F6VA 2YTOA 2Z16A 3BTJA 4LGWA 1ZRFA 2QKMB 2K3FA 2VBXA 2IS1A 1HNWE 4UXNA 1Z77A 3MAJA 3T1HE 3BWGA 5HNHA 2P5KA 1SFOJ 5E3NA 4IS1C 1REPC 3OSFA 5A69A 2VKDA 1TWHJ 4ZC3A 2V9PA 2XAGA 3J80Z 2W1OA 1STZA 3FIGA 3RIRA 1SAUA 4HDUA 1RKWA 2KRCA 3BG9A 3GX4X 2E71A 4XK4A 4JI3E 3RYRA 3ZXSA 3QOPA 2CSOA 2MFZA 1MNDA 3RKXA 4P9UA 1Y8QB 2FNAA 3ULQB 5IYCJ 2PMHA 2QA4I 1VTNC 3PJRA 4C2TA 3ECRA 1JK2A 2XB0X 2ID6A 1Z3YA 1RRJA 3ZQGA 4JP0A 3S16J 5EEHA 5AONA 1BI1A 1WFXA 3BR5A 1PUFA 2DFEA 2EPOA 2BE5F 4YFXF 1MDMB 1TLHB 3BG5A 2ZJRF 4H0EA 1WJEA 1BBGA 3KYDB 2DQLA 5H6QA 4DJAA 3CMAI 3DLLF 1W1WE 2Y9ZA 2EOYA 2DRPA 4JI8E 1VQPI 2EN3A 2Y31A 1KQ0A 3KEOA 4LG0A 2ZNYA 4CCNA 3AAFA 1IF1A 1XMXA 4G7HF 2WB1N 2PJRB 1GUUA 2DCEA 2E34A 1FSHA 3BOQA 2EPZA 1WKMA 4RAGA 1D8KA 4BQQA 3OYKA 1XPXA 4M9VC 4CCLA 2EMHA 2JA6J 1MJAA 1OLTA 3BGHA 2DFHA 4NQWA 2B9SA 1X19A 4XONA 3WTUC 1RR8C 2OV7A 2EMBA 2EMCA 4L9TA 5IXMB 3TP0A 5B66C 5E3OA 5F27A 1XX5A 2E5NA 4KT5C 2NRAC 3H3VK 1GXPA 2L2KB 1MMDA 1KU3A 1GQEA 4IRGA 1FZPB 1T38A 1WJFA 2V9KA 3DFGA 4RB0A 3FMRA 2EPPA 1LFUP 3AL0C 3R0JA 2IA0A 4YFNF 1QO0D 3K2ZA 5LGNA 1UCRA 5FJ8J 4BE1A 3ZRGA 2N3GA 5TRDA 4UHTA 1G3WA 2OPTA 5A6AA 2XGXA 2F4VE 4L5EA 1R49A 2K7IA 5IY5H 1X58A 3AFHA 2AXLA 3QYBA 2OUMA 3ABTA 4W97A 3CCMI 5K7ZA 1QZYA 1FNNA 3J7ZI 3H36A 2QUFA 1IN5A 3A01A 4LB5A 3ZOBA 3CZ6A 4ZZDA 4BY1J 1LJ9A 1S5LC 1XG1A 4XKCA 1H88C 3JSPA 4BDYA 1BOAA 1TQMA 2JSCA 1X1BA 3LQRA 4UVCA 3ZMZA 4UUSB 1R00A 4BC7A 1EKZA 4F91B 2M87A 2LUQA 1IBLE 2B9DA 2DTZA 2CQQA 2E1MB 4E7ZA 3K1NA 1VQ7I 3JTZA 1FYLA 2XASA 2MDRA 1MBEA 3ABKH 4IHYA 2R93J 1Z0XA 4EJTA 2R7QA 1Z67A 2EQ1A 1IZ1A 3BJ6A 2F5FA 2DODA 2ID3A 4PSXA 1JGGA 1FOYA 3JCUC 3BCAA 4ENMA 3LA2A 3ZCOA 2DJIA 1T0FC 2R4GA 4U7DA 4X64E 1MH4A 1K78A 2JZYA 4XRFA 4PJ0C 3ML6A 4B1RA 3ZQHA 2QSFX 1S29A 1ZU1A 2NUGA 3SZPA 1JUSA 5KL7A 3EUKL 1QGPA 4GXOA 2R0QC 2EJ4A 2KZGA 3WTTC 3LAPA 1SC7A 2WTEA 3DBRB 3HDDA 4RGUA 1IV6A 2DA1A 2IA2A 4M30A 5D5XB 3TO6A 5F0HA 2A69F 2R5ZB 2JJ7A 3UNGC 2E36A 1F5TA 1BL0A 2CO5A 4NUBA 3FISA 2OQGA 1XDUA 4EGYA 4M74A 4IHSA 1T95A 1A1HA 3ONQA 3CCEI 3F8NA 1NK2P 1X2MA 4NXNE 3MFKA 4MFDA 2LREA 1IAWA 4PJJA 5DUIA 4WCGA 2ZM6E 3PNYA 3LOCA 2L7KA 1VQ4I 2GLIA 4HSRA 5LGUA 4NDLA 5J40A 1FJLA 4WK8F 3EPJA 1A1LA 2M5WA 1UFMA 1VI0A 2YX7A 1IBME 3MSWA 4ZZLA 3HPZA 2KP6A 4DV3E 1W0UA 2WBTA 1ETKA 3ERED 4DR1E 1K61A 2Q8UA 3U2RA 2HJJA 1X1PA 4J8ZA 3FDYA 3ZP5A 4CHUA 1V54H 4G12A 3JAMZ 2EV6A 3ZGKA 2NVXJ 1UHWA 4LK0F 2RQPA 3ZQIA 3DEWA 3I55I 5GTHC 3G3ZA 4DYRA 1Z05A 1LQ1A 3KP4A 4RHBB 2M34A 3DU6A 2MD5A 2DT6A 3MWMA 2OJED 3CCQI 1A36A 3ADGA 4L5NC 2HOSA 4O4KA 2A6HF 4N9HA 4AVPA 4C2UA 4HRIA 1BC8C 4XIDA 2EIMH 1HW1A 1X48A 3RYPA 3H0GJ 1G3YA 4RM2A 1XN7A 1J5YA 2M7AA 2NA2A 1K6YA 4S05A 4A3CJ 3E6MA 2BY1A 1QZZA 2OAZA 1UJ8A 3CJQB 5M5WJ 1ZRCA 1TTYA 1Z9CA 5DM6F 4D9JA 2JPBA 1XGSA 2RS7A 2K27A 4ZDLA 1PUFB 4RMNA 4BHCA 3OYJA 1CF7B 4HF2A 3BZ6A 1K7AA 4ESFA 4A3EJ 4WFTA 1YITI 1T08B 2MYSA 2VC1A 2CUZA 3KP3A 3HJEA 4IJDA 2EZLA 2V1NA 3WGIA 4YRVA 2NUEA 3V7CA 3FHZA 3BPVA 4GCVA 4HZFA 4LG0B 1ERDA 4EJUA 3F6HA 1N32E 3EPLA 5J1YA 1TL8A 4DUZE 2PQ8A 3I53A 1BR4A 2GPIA 4R2DA 3VYUB 4R8HA 1RMDA 2K4BA 1ZHFA 2V7FA 2YZTA 5HDGA 3HQ1A 3C6KA 2AO9A 2EFQA 2H6CA 2TRTA 1SD4A 4NQWB 4LF4E 1H89C 2M3AA 2PMUA 2M30A 2EMGA 2YTIA 5IV8B 3HM5A 4KJZA 3QQAA 5EJCA 4U0YA 2B7EA 2IA1A 4FX0A 3AL0B 3IWCA 4GRIA 4LFCE 4JI5E 1R7JA 3EUHC 1UB9A 2K40A 3SZGA 1FEXA 1V5EA 3G2BA 1XMQE 4FASD 2COMA 3MQ0A 3U9GA 2NS8A 5K7FA 4IO9F 2LMZA 4F6MA 4YIRX 3QRFF 2Y75A 1MNEA 2QQBA 4BMJA 1XSXA 3CDLA 3S3NA 1GVJA 1VFCA 2EN2A 4Z2YA 3GFJA 5AIQA 1Y1WJ 1MSFC 2FSWA 5KL6A 4F92B 5LEJA 4DKKA 5AC5A 2JK3A 2PBIA 3KP7A 2KDZA 3HB9A 4CZZA 1QVUA 2HVQA 3RZDJ 4NC6A 2WV0A 4IQJA 3QPHA 1H0MA 5EF6A 2I8DA 4KYWA 4P5OA 5CLSA 4XLEA 4XL9A 4B3XA 1HW2A 3F8FA 5IYDJ 2PN6A 3LNQA 2OA4A 2E60A 3EDPA 2L7FP 3BR2A 3PFIA 3RPUD 1E0EA 4LFBE 2EM7A 3JSOA 5FO5A 2ECCA 4M9SA 3IUOA 1LUJB 2DT7B 2EZHA 3N97A 1H8AC 5FKNA 3ZMDA 4IVNA 2GQQA 2MSYA 1ETQA 4BQOA 1E3PA 2FV4B 1GDTA 3NWSA 3L7WA 1OCOH 2A5YB 1OPCA 2M45A 1PVEA 2BY3A 1U9OA 4IOAF 3IC7A 1W7PD 2UZKA 4P78A 1YZ9A 1JKOC 2CUJA 1ZR9A 1DPUA 4ZTJA 4LMYA 1UHMA 3WE2A 3P1XA 2L9VA 3LSPA 1S7EA 1HDPA 1G4DA 1ZREA 2EZ6A 2GOMA 4GO1A 2QSHX 1I39A 4QTRA 1E17A 1OQYA 3CMYA 3PSFA 2DAOA 3EYIA 3WGHA 3L1PA 3M99B 5AE2A 3MCZA 1I6HJ 4L9VA 2OCCH 4D1QA 1QU3A 2X51A 4EJWA 2FGGA 1MKMA 4PGGA 1D3YA 1YUJA 5L3BA 1Z3XA 2HOAA 2QKLB 3JRFA 3DLAA 2IBDA 2ZJPF 2MLGA 1JXSA 3MZYA 1JTXA 2B0LA 2ISYA 2NNNA 1O3TA 2YX4A 2LBFB 3FXJA 3GZ5A 3HSFA 2DSYA 3K70D 3I4NJ 3FXLA 3BR1A 1IUFA 3ASOH 4IF4A 1B8IB 2QZ8A 2JOXA 2XKOA 3MKLA 3ZN1A 1HQCA 4DV0E 2HVRA 3OS2A 2M9AA 3HL2A 2DPUA 4NHJA 1BI0A 3KPHA 4UVAA 1RPWA 3RZOJ 2LE2A 4KA4A 2HOEA 3WTVC 3HGYA 4OX9E 2FBKA 2ZJ2A 3C18A 3CDHA 4B3AA 3V42A 1A5JA 4V2GA 2GWRA 2EL5A 1SR9A 4C30A 2L02A 5JLWA 5JHFA 5M3FJ 3OY9A 2CMPA 3DKYA 1KU7A 3BR3A 2V8QB 1VQ9I 2XF6A 2ELZA 1B59A 4AIDA 3THNA 1J7KA 2AQEA 1AWCA 3L2WA 3H5RA 4A3MJ 3FBNB 4XLCA 4AC0A 2EPAA 2EN1A 3CJTB 1R71A 5IT9C 3WG9A 5E1ZB 5E3LA 3TQNA 5IOZA 3H9GA 4KWYA 2MC4A 2WAQA 3JTHA 4F9BB 3M07A 2Q1ZB 5DDGA 2VQGA 5AE3A 5KL5A 3ZMUA 5L3FA 2CQKA 5KVRA 4ZTFA 3N05A 3CUQA 3J81Z 4L5IA 4Q47A 2DPDA 1USTA 2F5DA 2V6EA 2KT0A 4FHTA 3OYGA 2ZC2A 5F3WA 3C4BA 2YR2A 3A4CA 3CUQC 3SHFA 2LKPA 1NHAA 2DYRH 1I5ZA 2P0WA 1P9QC 2ME6A 1B4AA 1G3SA 5AIPA 5F0CA 4ETSA 5KAIC 3DF8A 3VSLA 4V19K 2EILH 5C3EJ 1ZAOA 2RNGA 3CD6I 2EWLA 1T4OA 1N3GA 3BJOA 2JA2A 4BC9A 3VODA 2ZCWA 1F4KA 3KFWX 2IS2A 5J4VA 2YTJA 1O3SA 2KIQA 4JBAA 2TDXA 2XGEA 3M1CA 4DZPA 4U88A 4FCYA 1TF3A 1U8BA 2R7RA 2MLKA 4KMFA 4X0GA 1WI3A 1LNWA 4GKJE 2ELYA 4KT6A 1UILA 2VKEA 4XORA 3M7GA 4Q35B 4TUGA 2P7VB 2F5VA 4BEHB 1DDNA 2LDUA 2W82A 1K79A 4EATA 3B6CA 1PDNC 2DOAA 2N8XA 2DDBA 4OIQF 1L4SA 1XCVA 2HS5A 4XLHA 1R1VA 2HGCA 3H3ZA 3QU3A 1O3RA 2X48A 4KNYA 1ETVA 1TBXA 2XAFA 3QU6A 4M6VA 2L9RA 2RREA 2EM3A 5KL3A 3KX2A 1SEUA 4JX6A 2Q2EB 1JTYA 2Y30A 1NH3A 2A25A 1ENHA 1JKRC 4AUXA 2YT4A 2XF7A 1R36A 5ED4A 2A3SA 2X6YA 3VFZA 4MGRA 4D0PA 4TUIA 2CPNA 5IP6A 2N8GA 4XOTA 3CCVI 1TNTA 3OWTA 1R5HA 2MABA 1VNDA 4KIFA 4B8XA 3PM1A 2CS3A 2HI3A 2AHQA 1L0OC 1A1FA 3WU0A 4XQFA 1DP7P 3QYFA 1ZG1A 2R7UA 1MMNA 3K2AA 1A1GA 3BP8A 3E5UA 2PLYA 3KYLA 2O3FA 3FXQA 1B1BA 1XS9A 2EIKH 2CG4A 3ZQCA 2HVSA 3N4MA 4HX8A 1WJ5A 3JREA 3DEUA 3I59A 4P1WA 1ZELA 5DD8A 1LEBA 2KIFA 3O3KA 1KQ8A 2BW3B 2KONA 1ZG3A 1LFPA 4BAYA 1TWAJ 3WODF 2A6TA 2P8TA 2YSOA 1XCBA 3VYRB 2R1FA 3S14J 1KQ9A 4G9YA 1BB8A 2L4AA 3RPUA 3MKYB 1MW7A 1YW8A 3OR2C 2JUGA 5CKTA 3P7NA 1AKHA 5J8CA 1SD7A 1D1AA 1QHHD 3KE2A 4M9XA 4ZYAA 2QM3A 1OKRA 5LFAA 2NVQJ 5ADZA 1BI3A 2UXDE 1DGWY 3FXKA 4BH9A 5F04A 1FJGE 1B9MA 1SMYF 2B63J 1FOKA 1D8JA 1W7PA 1ZRDA 2EM8A 2QBYB 4JI0E 2ECBA 3HUGA 2ADRA 2I13A 3BZKA 2PX9A 4HV5A 5K5QA 2EPCA 2XDVA 5IT9K 2JTVA 4UNOA 1GXQA 3DP7A 4HEA2 1T56A 5GP9A 5JI6A 1STUA 2YU8A 4JX4A 2EPRA 4LU9A 4AIKA 3CF2A 2LRSA 2IS6A 4BBRJ 5D4RA 3G6EI 3HSRA 2A61A 4IKFA 4CXFA 2WAEA 2E7XA 2FOKA 4HPQA 4LIVA 3QPSA 3HG9A 3HOVJ 1QVTA 4JK1X 1WQ2A 2IW5A 5D8KB 1MEYC 2ME0A 1A31A 2O61A 2FTXB 1W5CC 3EUAA 3LSTA 2XAUA 1Z91A 4OAYA 4AWXB 2LTRA 3DKXA 2BGCA 5DCFA 2WBUA 5BS6A 1W36C 2UWMA 4CYCA 1XNRE 4GYIA 2JA8J 3DPLC 1YSAC 1HKQA 4G6TB 4PCQA 1LB2A 1POGA 1U3EM 5FB2A 3PUBA 3JRGA 2LJUA 2VOOA 5B5EC 3PL8A 2L8TA 2MA3A 2L7MP 1TWGJ 1R4NB 3GTQJ 4RM3A 2DT5A 4A0XA 1ETOA 2XGDA 2DA4A 2W4SA 3IH3A 1G59A 4AM3A 1XC5A 3FKJA 2HYJA 3MHSC 2K7LA 2V86A 5TISC 4F2JC 2BB8A 3RQ4A 5FFXA 4I8OA 2ZB9A 2Q8KA 1EH8A 3M8FA 2D9HA 3ROUA 2VPRA 2X4HA 3EETA 4E7HA 4BXFA 1LDJA 4RLQA 3DPTA 2EMXA 4DW6A 2EOZA 1QBJA 3SZTA 4UB8C 2LV2A 3G4SI 1TT5B 2DDAA 2XROA 2PJPA 4NC8A 3VK6A 3HYIA 4IEJA 3FX3A 2A6EF 4BY7J 1BW5A 1LVAA 2HU9A 3UKGA 1OCZH 1N36E 1N25A 1J59A 1D5VA 1P47A 2M7BA 3B6AA 4WF2A 2ENCA 5HS8A 2GXGA 2QF7A 1WJAA 4L9NA 2VE7C 1LEAA 3MVPA 1CQTA 1HR0E 1X6HA 2NUFA 3I58A 4GFBA 4BQAA 1YX5A 4HEIA 1ZR4A 1SFEA 5EGOB 1QZEA 1NCSA 1TWCJ 2H1KA 5ICFA 3M4OJ 3H3UA 3IP4B 2EPUA 5TSEA 3VDXA 3DTIA 3E5XA 2I5UA 3GUDA 5LRRA 4DV7E 1JHFA 4G8XA 1IW7F 1F9NA 4JI1E 1Z7UA 4KIBA 2DA3A 1YFHA 3THOB 1RC7A 5LD2C 1WXRA 5GADJ 2ENHA 1P4XA 2FX0A 2HWVA 2XV4S 2EOIA 5M5YJ 2EN6A 2DYSH 1KJKA 3VSKA 2KHXA 4XICA 3F72A 4MHGA 2RDPA 2EL4A 2E72A 1KYWA 2WA0A 4AYBN 4BU2A 2L4MA 4M3EA 5CYVA 2X6OA 4ON0A 3IAM2 3AUZA 5FD6A 3AG3H 3L2QA 1JHHA 2P81A 1R9TJ 4UV9A 3OR1C 4WXHA 3J7AG 2JRMA 2EOXA 3MKZA 5M3MJ 3ABUA 3DCFA 2DN0A 4AD9A 3C7JA 1T4NA
chains in the Genus database with same CATH topology
1WWXA 3KP6A 1O7LA 3RKWA 1GHCA 3W6KB 1XGOA 1Q1HA 2NNYA 2GXBA 1I27A 5CVRA 4I01A 2RGVA 2MH9A 2F2EA 2JPCA 4HLXA 4YFKF 2IRFG 5K5RA 2L3DA 2GAUA 2PI0A 2LF8A 3FZVA 5D4SA 3TO9A 2G7UA 2WWYA 3FF5A 4IXAA 4R79A 4EM2A 4FT8A 3E97A 5LLQA 1V4RA 1USSA 3SXYA 5E8IA 2F5CA 3WTZA 4L0YB 4Q4ZF 5L3CA 1T39A 4L18B 2KIUA 1B6AA 1TQIA 5H6RA 4P55A 1RUOA 2HQRA 1XD7A 3GZ6A 1G6NA 1Z6TA 2P5LC 3BPXA 2DO7A 3FXUA 3R61A 1HBXG 4EM0B 3VEPA 1HXDA 1U5TA 2E1NA 3I4PA 1LDDA 4XLNF 1U5TC 2JRTA 1R23A 2E1CA 3CJNA 3CO7C 4MTDA 4S04A 3C1DA 3HRTA 1OYWA 2H09A 5JVTA 3IWZA 2ETHA 1S6LA 1TQPA 2R7FA 2FBHA 3R4KA 3BDDA 5HDNA 4XSXF 4OIOF 4M72A 3KCCA 1HKSA 4KN4X 4NB5A 1EH6A 2P6TA 3ECOA 1KU2A 4ZYHA 1BIAA 3O6BB 2OZ6A 3GFIA 4R1HA 2ESNA 2BBYA 2Z33A 2QYOA 1ZLKA 2Z99A 1OYYA 5HLIA 3JTGA 5BOXA 3E5QA 3MZHA 4BHPA 4PDKA 4HA8A 1ON1A 1ZH5A 4EV0A 1ON2A 2DW4A 3Q5FA 4KICA 2KJBA 4BYYA 1C0WA 2VT3A 3K0LA 2ESHA 2IJLA 3V7RA 2DK5A 4OU0A 4HF0A 2HKOA 3NRVA 5E18F 1KA8A 1BM9A 4OINF 1E2XA 3V7SA 5HVQC 3IL2A 2O6GE 2STTA 4F7ZA 1IXRC 4O3MA 4LLNA 1XGMA 2PEXA 3P9CA 3KZYA 2MBFA 1IN4A 1R22A 3L9FA 3WGGA 3V4GA 2D2WA 2NYXA 3T8TA 2FNPA 1EV7A 3R60A 2C6YA 2ZMEA 1I6XA 1ZYRF 2OQRA 1YYVA 2HEOA 2HYGD 1T6SA 2RV8A 2VBWA 2D1VA 5HOOA 2FXAA 4AIHA 5ILVA 3IWFA 2A07F 1K78B 2HQNA 4L0ZB 1XSDA 3IRQA 1X3UA 2UXXA 3HHGA 5L3GA 2FF4A 5ERIA 1BN5A 3D0SA 4KUMA 5LHIA 2EA2A 4MQ9F 4ZH4F 5D5UB 2HFHA 1XMAA 1HKTA 1U5TB 1ZN2A 1CGPA 2X0LA 1V3FA 4ENJA 1ZG5A 3CUOA 3T1BA 2FMYA 1TW3A 3ZMTA 1W5TA 4HOBA 3TDZC 4M6XA 3EQLF 3FMSA 2LNBA 2CFXA 1YS6A 3WTXC 1O7FA 2GA2A 3ELKA 4EJOA 3QP6A 3LA7A 1U78A 2EFNA 3TDUC 2ZBKA 3GLXA 3GXOA 2QWWA 3M9AA 4DQ2A 2AS5F 1ZGAA 4KFCA 4IJAA 1FWZA 2K02A 5IT3A 4PZJA 2XAJA 4Y17A 4OIRF 4U0VA 3REOA 1Z6RA 3M8EA 1SD6A 3WE3A 4MEXF 3DKWA 4ENNA 2E7WA 2CWEA 4G7ZF 3COAC 1FLIA 1IN6A 5E8GA 2RN7A 3ZPLA 3LA3A 5LHGA 1IXSB 3WTYC 2ZFWA 2ZO4A 5L3DA 2Y0MA 4IRIA 2FMLA 3VB2A 1QNTA 2R7DA 2VE8A 4K2EA 5FGMA 2QENA 4EM1A 2IT0A 1FSEA 4ZYGA 3P9KA 3J80K 4AIJA 4PGHA 2D45A 4I7HA 2ZNZA 3ZN0A 2H94A 4E70A 3BJAA 4G7OF 4LK1F 4N0BA 1LDKB 4GYGA 3GW2A 5LEKA 4MEYF 1YW7A 4B09A 3W6JB 4I98B 3V8LA 4HLYA 2MC3A 4O5VA 5DEQA 1P2FA 3CLOA 1MDMA 3IKTA 1R5GA 3KLOA 3M1EA 4WX9A 3F3XA 3KP2A 1ZARA 1EH7A 1YQAA 3EYYA 3FM5A 2XKPA 4UVBA 2DK8A 3GEZA 4YIFA 4G6QA 3V8KA 4CO8A 3WU1B 2DFIA 1IRGA 2OZUA 2M1BA 1Y0UA 4Q48A 1K6OA 1T2KA 2XHKA 3LWFA 5KK1A 5DCMA 4EGZA 1MJ9A 3RJPA 1Z1DA 1PUEE 2YSRA 4JQFA 1RNLA 1BIBA 2GZWA 2PG4A 5ICEA 3DQVC 1JE8A 1JGSA 4CDGA 6PAXA 5F64A 2DI3A 4G6DA 4LLGF 5CVVA 4GGGA 2QVOA 5FFZA 4MTEA 1P6RA 2HKXA 2V9VA 4BNCA 3NEUA 5FD5A 2P6SA 1P4WA 3OV8A 2P4WA 2FEZA 5CVJA 5E1WA 1MJBA 1SFUA 1DPRA 2HZTA 4ZYEA 2V6CA 4Y15A 1XGNA 4ASNA 4OMYA 3CUQB 4A0ZA 1YO5C 5E1XA 2ZXJA 1XDSA 4M6YA 2OU2A 4MNUA 4O6JA 4YIIA 2IPQX 1IN7A 2VODA 5D6EA 4WXCA 4FX4A 1BI2A 3U1DA 4A12A 4A5NA 4RB1A 3VOEA 1WSUA 2QLZA 2DQRA 2O0YA 1IN8A 1FX7A 3PQKA 3T8RA 4DNCA 2EFWA 4UUVA 2HTSA 2PFBA 2QQ9A 1U8RA 3V8JA 3ZQ7A 3LQQA 3E6DA 4WWCA 3RPQA 4IRHA 2J5OA 2RC4A 1U2WA 4LD5A 5K5OA 1YW9A 3F8MA 4YG2F 2FRHA 1ZGJA 2R3SA 1F1ZA 4I0BA 1PP7U 3HRUA 4CGZA 2EFOA 4P9FA 5J8FA 1H9GA 1CF7A 1G3TA 5F6FA 2XIGA 5JHUA 4M73A 4I0AA 2W24A 3HOTA 4Q5SF 2J5PA 4IPAA 1S8NA 3I59B 4OOIA 1FYMA 2EWNA 3RDIA 2HR3A 2NAZA 2W85A 5CVUA 2HYFA 1W5SA 5FLXK 3F8BA 2K4JA 3FMQA 3ECHA 5DCMB 1A04A 1O3QA 3BY6A 1KU9A 3RKYA 2D1HA 1W7PB 3NQOA 5HS9A 1HSJA 2EB7A 2RNJA 3HTUA 4UV8A 2OBPA 2Z5UA 4A2UA 3D5LA 4A0YA 3HOSA 5BPDA 1YTYA 1TNSA 2L54A 3KETA 3TGNA 5IT9Z 4LFUA 2F5EA 2XVCA 1T0FA 5LBQA 1U6GA 5K1YA 2EV5A 1B9NA 4HF1A 4RS8A 3HHHA 3K9TA 1BC7C 4M9ZA 3CO6C 3IKVA 4QLCU 2VONA 1W4MA 4A6EA 2XRNA 2VN2A 1FBUA 3KZZA 3O2PE 3GYHX 1BBYA 3E3VA 2V1XA 5ICGA 2DLLA 1IUYA 2H6BA 4KIGA 4ESBA 2Q0OA 4ESJA 4P96A 4G94A 2EFPA 4N9IA 4LJZF 2G9WA 1SAXA 1MGTA 3L2CA 3S2WA 1SFXA 5H20A 3HTSB 5BPIA 4Y13A 4EVIA 2GIVA 3J81K 4HDVA 3RTRA 2KRFA 2GA1A 1BJAA 1L3LA 3I54A 2VT2A 4EMSA 1S7OA 5J6XA 2CGPA 2EA4A 3HRMA 1YIOA 2ZKZA 4I09A 3JW4A 3K69A 4U0WA 2O8XA 2LSOA 4A5MA 2Z3YA 2QQAA 4WXDA 3R6SA 5HLHA 3RI4A 3GWZA 3HRSA 2G7HA 4M71A 4XSZF 2ELHA 3EUHA 5HDKA 4RGXA 1J9IA 4CICA 2DBBA 1RUNA 2XAQA 2M8EA 4BHBA 1J0RA 2L01A 1ULYA 2VBZA 4ENKA 3Q9SA 3MEXA 2Q2EA 5FLXZ 4L5JA 3G73A 2STWA 4HQMA 2EV0A 2Y48A 1I1GA 1SMTA 1I1SA 3GO5A 4OIPF 3CTAA 4RB2C 1MZBA 3F6OA 2EJRA 2IVMA 2W25A 5E20A 5A2QK 2O03A 3ZMVA 4EQQA 3R0AA 2OD5A 1FPQA 1OMIA 3F23A 5D8LB 2KIMA 4HAMA 2KKOA 1YLFA 1O57A 3I5UA 1WI9A 4QWQA 5TJJA 5E17F 3F21A 2FQ3A 2V79A 3HIFA 4IHTA 3L09A 4MQVA 4HQEA 1PP8F 1J75A 4I2OA 4I02A 2ACJA 3I71A 3ZMSA 5ICCA 2QBYA 2FA5A 4TV7A 3E6BA 2LF7A 3L00A 2BEOA 1XSVA 1R58A 3GF2A 2Z9OA 3HSEA 2UXNA 3E6CC 2VE9A 2V1UA 4BXUA 3FXRA 3OOPA 2P5VA 2HDCA 1IRFA 3PQJA 5HS7A 1QPMA 5L3EA 4LB6B 3H92A 1FBSA 3KEQA 2A68F 3J7AO 2VBYA 4HX4A 3I64A 2CW0F 2W57A 3GFLA 1RI7A 3LAJA 5JR3A 4KDPA 2HTJA 3LFKA 1FP1D 3IHUA 3TOAA 4HW0A 4RGRA 3TOBA 3QAHA 3KP5A 1R1UA 1YS7A 4XBFA 3TKYA 2K86A 1FBQA 3T0YA 5ILUA 3SFZA 1DUXC 2ISZA 2DTRA 4CYDA 4RAZA 5DD4A 2ZMEB 2ADUA 5JFRA 1ONVA 2FE3A 2FBIA 3QP5A 5EEGA 3I0TA 1R1TA 5ILSA 2W84A 2H27A 1HW5A 1TW2A 5BMZA 5LHHA 1T98A 1KGSA 2BYVE 1QQIA 1FYKA 4RB3C 2VXZA 1OR7A 2BV6A 2MH2A 4L9JA 2EK5A 1ODDA 2RKHA 1FY7A 3GFMA 5LGTA 3QPTA 2KJCA 3F8CA 4ZYDA 1FC3A 5CVIA 1KYZA 3DV8A 4LLLA 5A2QZ 4HV6A 4XLPF 4HBLA 4OMZA 1FT9A 5D6FA 3SQNA 3BROA 2DU9A 2XAHA 2IP2A 4EJVA 2V1DA 4U7BA 4KN7X 1AOYA 4RGSA 1S7AA 1FP2A 5HLGA 3B73A 1S3JA 3B02A 3KLNA 5LRSA 3TO7A 1WRJA 2P7CB 2XUBA 5DYMA 3T5XA 2YPRA 3P9IA 5F1RA 1HSTA 5D5WB 5BQTA 2JT1A 1P92A 4HYEA 5D5VB 2FU4A 3FM3A 1XB4A 3K1MA 3IRRA 1P4AA 2VC0A 1MD0A 3DXJF 1H9TA 1RZ4A 2RVCA 3JAMK 1XMKA 5CJ9A 1J2XA 3C3WA 3ISPA 3WTWC 3WTSC 1IXCA 2YU3A 2WC2A 1ZLJA 3FWEA 1OYIA 2CYYA 3K1PA 5DUKA 3F22A 1RIOH 3Q9VA 3GVAA 5DV5A 1YG2A 4HX7A 4KMUX 2NS0A 4A6DA 4RAYA 2VOPA 1SD5A 3F6VA 4LGWA 1ZRFA 2VBXA 4UXNA 3MAJA 3BWGA 2P5KA 1REPC 3J80Z 2XAGA 1STZA 3RIRA 4HDUA 3GX4X 3RYRA 3QOPA 2CSOA 3RKXA 4P9UA 3ULQB 2FNAA 1VTNC 2PMHA 5EEHA 5AONA 1BI1A 2BE5F 4YFXF 1MDMB 1TLHB 4H0EA 2DQLA 5H6QA 1KQ0A 3KEOA 4LG0A 2ZNYA 1IF1A 3AAFA 4G7HF 1FSHA 3BOQA 1WKMA 1D8KA 1MJAA 4NQWA 3WTUC 4L9TA 4KT5C 2NRAC 1GXPA 1KU3A 4IRGA 1FZPB 1T38A 3DFGA 4RB0A 3FMRA 3R0JA 2IA0A 4YFNF 1QO0D 3K2ZA 5LGNA 1UCRA 5TRDA 4UHTA 1G3WA 2XGXA 2AXLA 3ABTA 1QZYA 1FNNA 2QUFA 1IN5A 4LB5A 4ZZDA 1LJ9A 3JSPA 1BOAA 1TQMA 2JSCA 3LQRA 4UVCA 3ZMZA 1R00A 2M87A 3K1NA 1FYLA 2XASA 4EJTA 1IZ1A 3BJ6A 2F5FA 4ENMA 3LA2A 4U7DA 1K78A 2JZYA 4XRFA 3ML6A 1S29A 3SZPA 4GXOA 1QGPA 3WTTC 3LAPA 2WTEA 4RGUA 2IA2A 5D5XB 3TO6A 2A69F 1F5TA 2CO5A 2OQGA 1XDUA 4EGYA 4M74A 4IHSA 3F8NA 3MFKA 1IAWA 5DUIA 4WCGA 5LGUA 4WK8F 2M5WA 1UFMA 2YX7A 4ZZLA 3ERED 3U2RA 3ZP5A 4CHUA 3JAMZ 2EV6A 1UHWA 4LK0F 2RQPA 3G3ZA 1Z05A 1LQ1A 3KP4A 2MD5A 3MWMA 2A6HF 4N9HA 4AVPA 1BC8C 1HW1A 3RYPA 1G3YA 1XN7A 1J5YA 4S05A 3E6MA 1QZZA 2OAZA 1ZRCA 1TTYA 1Z9CA 2JPBA 1XGSA 2K27A 4BHCA 1CF7B 4HF2A 3BZ6A 1K7AA 4ESFA 2VC1A 3KP3A 3WGIA 3V7CA 3FHZA 3BPVA 4GCVA 4HZFA 4LG0B 4EJUA 2PQ8A 3I53A 4R8HA 2K4BA 1ZHFA 5HDGA 2EFQA 2H6CA 1SD4A 2PMUA 2M30A 4U0YA 2IA1A 4FX0A 1R7JA 1UB9A 2COMA 3MQ0A 3U9GA 3QRFF 2Y75A 2QQBA 1XSXA 1GVJA 4Z2YA 3GFJA 5AIQA 2FSWA 5LEJA 3KP7A 2PBIA 4CZZA 2WV0A 3QPHA 1H0MA 4KYWA 4P5OA 5CLSA 1HW2A 3F8FA 2PN6A 2OA4A 3EDPA 3PFIA 3JSOA 5FO5A 4M9SA 3N97A 3ZMDA 4IVNA 2GQQA 3L7WA 2A5YB 1OPCA 2M45A 3IC7A 1W7PD 2UZKA 1DPUA 4LMYA 1UHMA 3WE2A 1G4DA 1ZREA 4GO1A 1E17A 2DAOA 3EYIA 3WGHA 3MCZA 4L9VA 4EJWA 1MKMA 4PGGA 1D3YA 5L3BA 2MLGA 1JXSA 3MZYA 2B0LA 2ISYA 2NNNA 1O3TA 2YX4A 3GZ5A 3HSFA 4IF4A 2QZ8A 2XKOA 3ZN1A 1HQCA 2DPUA 4NHJA 1BI0A 4UVAA 4KA4A 2HOEA 3WTVC 2FBKA 2ZJ2A 3C18A 3CDHA 2GWRA 2L02A 1KU7A 1B59A 1J7KA 1AWCA 3WG9A 5E1ZB 3TQNA 3JTHA 5DDGA 3ZMUA 5L3FA 2CQKA 5KVRA 3J81Z 3CUQA 4L5IA 4Q47A 2DPDA 1USTA 2F5DA 4FHTA 2YR2A 3SHFA 3CUQC 2LKPA 1NHAA 1I5ZA 1B4AA 1G3SA 5AIPA 4ETSA 3DF8A 1ZAOA 3BJOA 3VODA 2ZCWA 1F4KA 3KFWX 1O3SA 4JBAA 2TDXA 4U88A 2MLKA 4KMFA 1LNWA 3M7GA 2P7VB 1DDNA 2LDUA 1K79A 1PDNC 4OIQF 1XCVA 2HS5A 1R1VA 2HGCA 3H3ZA 3QU3A 1O3RA 4KNYA 1TBXA 2XAFA 3QU6A 1R36A 5ED4A 2A3SA 3VFZA 4MGRA 4D0PA 1TNTA 1R5HA 4KIFA 4B8XA 1L0OC 3WU0A 1DP7P 1ZG1A 3BP8A 3E5UA 2PLYA 2O3FA 3FXQA 1B1BA 2CG4A 3N4MA 4HX8A 3DEUA 3I59A 5DD8A 1LEBA 2KIFA 3O3KA 1KQ8A 1ZG3A 4BAYA 3WODF 2P8TA 1XCBA 1KQ9A 4G9YA 2L4AA 3RPUA 1YW8A 3P7NA 5J8CA 1SD7A 3KE2A 4M9XA 2QM3A 1OKRA 1BI3A 4BH9A 1B9MA 1SMYF 1FOKA 1D8JA 1W7PA 1ZRDA 2QBYB 3HUGA 4HV5A 5K5QA 5IT9K 2JTVA 4UNOA 1GXQA 3DP7A 5JI6A 4AIKA 5D4RA 3HSRA 2A61A 4CXFA 2E7XA 2FOKA 4JK1X 1WQ2A 2IW5A 5D8KB 2O61A 3LSTA 1Z91A 4AWXB 5DCFA 2BGCA 5BS6A 2UWMA 4GYIA 3DPLC 1HKQA 4PCQA 1LB2A 1U3EM 5FB2A 2VOOA 2MA3A 2DT5A 4A0XA 2K7LA 5FFXA 2Q8KA 1EH8A 3M8FA 3ROUA 2X4HA 3EETA 1LDJA 3DPTA