1T39A

Human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
151
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3'
publication title DNA binding and nucleotide flipping by the human DNA repair protein AGT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 30
structure length 151
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t39A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1t39A01
1Q1HA 2W24A 2Z99A 4YFXF 3DP7A 1B6AA 3KZYA 2H94A 3HOSA 2K4JA 2HS5A 1B9NA 4ZH4F 1W7PB 4ESJA 3ECHA 4L0YB 3F6VA 2Z3YA 3T8RA 1G3SA 5FD5A 3RTRA 1MKMA 3C3WA 4Q48A 5FGMA 5ICGA 1S7OA 3E6CC 2IRFG 2QQBA 5E17F 2UXXA 3KFWX 1Z91A 1SMYF 2GWRA 3J81Z 1BBYA 2RGVA 2RVCA 2IJLA 2ZCWA 3JAMK 2JRTA 2KKOA 4B09A 4KDPA 1JHFA 2A6HF 3LSTA 5HLGA 4MEXF 2F5EA 2VT3A 2XUBA 1MDMB 2XIGA 2ZO4A 3M1EA 3P9KA 1GVJA 3VODA 5FO5A 4HF1A 2ACJA 1U3EM 3E5QA 3F22A 3CJNA 2UXNA 2BE5F 2LSOA 1XMAA 1KYZA 1WRJA 3WG9A 2ZXJA 4G94A 5D5UB 1YS7A 3D5LA 2F5FA 1FY7A 2CQKA 3HSRA 3WU0A 3LFKA 5ICFA 1PP7U 1QGPA 4EM0B 2RV8A 4MEYF 5JFRA 3RDIA 3SZPA 3W6JB 1R1TA 2O03A 1TNTA 4PCQA 1PDNC 2BBYA 3I4PA 3RYPA 1YLFA 2CFXA 4RGXA 3ZMZA 4YIFA 4UHTA 4LGWA 4ZZDA 4NHJA 2DTRA 3F8CA 2QBYA 2JTVA 3ULQB 5JI6A 3W6KB 4KN7X 4KNYA 3HRMA 1DPUA 4JK1X 4WXCA 5TJJA 4B8XA 2CO5A 2W57A 3QRFF 1ZRDA 2EA2A 1G3TA 1FYKA 4ZYDA 5IT9Z 5AIQA 3R0JA 5E20A 3CTAA 4L18B 2E7XA 5AONA 4KUMA 3LQRA 2FMLA 1OMIA 2L4MA 2OAZA 3EQLF 2ZMEA 3FF5A 2QYOA 2WWYA 4BHPA 5FLXZ 2MBFA 1REPC 4RAZA 1S8NA 2K86A 5L3CA 1T39A 1B4AA 3FZVA 3CLOA 2H09A 3M9AA 2JPBA 4I98B 2CG4A 5F1RA 2C6YA 2ESHA 2D1HA 1SFXA 5F64A 1XDSA 2XKOA 3E6BA 4JQFA 3E6DA 1FYMA 3NEUA 2AXLA 3J80Z 3I59A 4YFNF 1B1BA 3IKVA 1DUXC 4L5IA 1A04A 3PFIA 1BC8C 4LLNA 1ZGAA 2Y48A 2RDPA 5E8GA 2ESNA 4NQWA 5TRDA 3R0AA 2YU3A 2ZFWA 3ML6A 1F4KA 3LA7A 2OD5A 1J9IA 1H9GA 1RNLA 1J59A 3WTYC 2RQPA 3MZHA 1RZ4A 2DK8A 4M6YA 2NNNA 5H6RA 4A0YA 3WE2A 2PJPA 1QBJA 4ETSA 2E1NA 3QAHA 4YG2F 3M8FA 2HGCA 3HOTA 4EGZA 2QZ8A 3I54A 4RB3C 2PLYA 4G8XA 2E1CA 1QQIA 3WODF 4Q5SF 4IF4A 3ZPLA 2WV0A 5CVUA 2M45A 2BGCA 4A5NA 2HTJA 3KP3A 1LNWA 1H0MA 2V1DA 2DT5A 5BS6A 4ESFA 2X0LA 2OQRA 4UV8A 4LLGF 4KIBA 5K1YA 5DD4A 2K27A 2YX4A 4ZYGA 1RI7A 3M8EA 5DD8A 2HZTA 2IA0A 3TKYA 4BNCA 4HX8A 3LAPA 3WTXC 3R60A 2OA4A 1U78A 4MQ9F 3GF2A 3C7JA 1ZARA 4L0ZB 4CICA 2R7DA 4KIGA 5CVIA 1G3YA 1TLHB 2G7UA 1OYYA 2P5KA 1EV7A 2V79A 4OOIA 1RUNA 4O6JA 1UHWA 3ZMTA 2STWA 4IHSA 1ZYRF 3JTGA 4KIFA 1T38A 3L00A 3K1MA 3HUGA 4U0YA 3KP2A 1MD0A 3WTUC 1L0OC 3WE3A 1R7JA 1ZRCA 4HLXA 2Q2EA 3CUQB 4FX0A 4BAYA 1V4RA 5D6EA 4M71A 5D5XB 2UWMA 2XASA 3C18A 2IW5A 2PEXA 3MQ0A 4L9VA 4DNCA 4O3MA 3PQKA 2KRFA 1MGTA 3DPTA 4WX9A 2CW0F 4Y17A 5LLQA 3F6OA 5LBQA 5DUKA 1FP2A 5LGTA 1FWZA 5DDGA 3K2ZA 3QPTA 1T98A 3WGGA 2J5OA 1XSVA 5CVJA 1KU7A 4YFKF 3IKTA 3IWFA 1P4WA 3KZZA 5ILVA 1ON2A 1O57A 4HLYA 3KP6A 4KMUX 2NAZA 2FOKA 1LEAA 3E5UA 2VBWA 3Q9VA 3FX3A 2HTSA 2IA2A 4G7HF 2ISYA 2MC3A 5A2QZ 4KMFA 4ENMA 4IJAA 2XAQA 3ZMUA 1L3LA 4GYGA 2VN2A 4ON0A 1IF1A 2DLLA 4EJTA 3HRUA 4IVNA 4KN4X 2OU2A 1FPQA 2KJCA 3BOQA 4LG0A 4AVPA 2EFQA 4ENKA 2A61A 4LLLA 1HSJA 3QP6A 2HYFA 2XROA 3I53A 2FNAA 3O6BB 3I58A 4HX7A 2HQRA 4O5VA 1KU2A 2EFOA 5HVQC 2DPDA 1JHHA 3V8KA 1RUOA 4HDUA 1T2KA 1S29A 2CGPA 3GFMA 1U6GA 4I09A 5HLIA 2JT1A 4LB5A 4OIRF 3BJOA 3GEZA 4HYEA 5HOOA 3GFIA 4LMYA 1W7PD 4WXHA 1IXCA 4I0BA 2V6CA 3DFGA 2MLGA 4BXUA 2VC0A 3KP5A 4G6QA 4I01A 4IRHA 1WSUA 3BJ6A 2HKOA 3VB2A 4PDKA 2O6GE 1W4MA 3H3ZA 3U9GA 3C1DA 4LFUA 4PGHA 2PI0A 3EYYA 1FX7A 5FB2A 2NS0A 3FMRA 1R5GA 2ETHA 3K9TA 3N4MA 2K4BA 1HW1A 5E1ZB 1FSHA 5L3BA 3VFZA 4G9YA 3IC7A 3HHHA 3P7NA 3LWFA 4EJUA 2L01A 3ECOA 3GO5A 5KVRA 1HBXG 3ZQ7A 2V9VA 2M1BA 3FMSA 2W84A 4R1HA 4XSZF 1XCVA 1Z6RA 4L5JA 1R22A 2G9WA 2HQNA 3LA2A 2EV6A 1FC3A 2MA3A 2YX7A 3IWZA 4L9NA 1XMKA 5HS9A 4A0ZA 3F8FA 1GHCA 2H6CA 4FT8A 3TO7A 1MZBA 4MGRA 1ZHFA 3I5UA 1KQ9A 2PMUA 1E17A 1IW7F 2A68F 2HFHA 5D4RA 1W5SA 4M72A 5E18F 5D5WB 1B9MA 3KEQA 4XSXF 3I59B 2DW4A 5FFXA 4CXFA 2HR3A 2HWVA 1ZLKA 2YR2A 4M9ZA 5L3FA 4G6DA 3ZMVA 1U5TB 2VBXA 1XGSA 1MJ9A 2UZKA 5LEJA 2PBIA 5LEKA 3GFLA 2M8EA 3ABUA 2O8XA 1SD5A 2P6SA 1YW8A 4UV9A 2LDUA 2YSRA 4GCVA 1S3JA 4HW0A 1WQ2A 1WKMA 1R1UA 1GXQA 2KIMA 3S2WA 2X4HA 3HTUA 3RYRA 2VE8A 3K1NA 2L02A 1QNTA 2K7LA 3KP7A 5DV5A 5JHUA 2ZNYA 2VODA 4HQMA 3H92A 1ON1A 3QU6A 2HEOA 4IRIA 2PQ8A 2VBZA 3L9FA 2ELHA 3BWGA 1J7KA 3PQJA 3F21A 2Z9OA 4HF2A 5CVVA 4AIJA 3ROUA 3U2RA 4M74A 1D8KA 4EJOA 4BQAA 3JSPA 1BI1A 1J75A 3NRVA 4N0BA 1R1VA 4CO8A 4E70A 5BPIA 4F7ZA 1QZYA 1QZZA 2B0LA 3SQNA 3FM5A 1P4XA 3K0LA 1FBSA 3LQQA 4RB0A 3SHFA 2GA1A 3HTSB 3LAJA 1HXDA 1K78A 3FM3A 1PUEE 3OV8A 4HV5A 1STZA 2EK5A 3EUHA 5HDGA 4XLNF 5LHHA 1I27A 2EJRA 1U5TC 2IVMA 3E5XA 1LQ1A 1O7LA 2Y75A 4YIIA 1IUYA 1QPMA 1YTYA 5BMZA 4WWCA 1IN6A 3VOEA 1XSXA 2QLZA 2LF8A 1U2WA 1V3FA 1B59A 3WTSC 2A3SA 2F5CA 4D0PA 1BI3A 2EFWA 2O61A 2WTEA 1SMTA 1PP8F 1BM9A 1R36A 4S04A 3CO6C 3WTZA 3DQVC 1CF7B 1OYIA 2J5PA 3DPLC 1BIAA 2CSOA 4LB6B 1ZREA 4RGRA 1LDKB 5HDKA 3K1PA 4GYIA 4QLCU 1YO5C 1P4AA 3MEXA 1YFHA 2MD5A 3GLXA 4A12A 4OIQF 4U7BA 4UVAA 3WGIA 3KE2A 4U0VA 1X3UA 3QPHA 1ZGJA 4IHTA 4ESBA 2VONA 1YG2A 1W5TA 1ZN2A 3J81K 4JBAA 2XGXA 5J8FA 2STTA 1HSTA 1K79A 3DKWA 2FE3A 5L3EA 5JVTA 3KLNA 2GQQA 3L7WA 1XN7A 2P6TA 2NYXA 4BYYA 1ZAOA 3F8MA 1F9NA 4MTEA 3GZ6A 2BEOA 1HQCA 3KEOA 2V1XA 1EH8A 3LA3A 1OPCA 3JAMZ 4ZYHA 1TTYA 3WTVC 3R61A 5HS8A 4N9HA 1DPRA 3ZMSA 3T8TA 4R79A 2EV5A 4OMYA 2HKXA 2R7FA 3ELKA 3QP5A 1LDJA 2GIVA 3Q9SA 2HDCA 3V4GA 5LRRA 2DBBA 2OBPA 1BI2A 2DI3A 3Q5FA 4ZYEA 1LB2A 4HX4A 5LGNA 2FEZA 5F6FA 3RIRA 4HAMA 2XAHA 3DXJF 1Y0UA 5K5OA 1KYWA 3V8JA 1XGMA 4U88A 4A2UA 3P9IA 3B73A 4XRFA 4ZZLA 5JR3A 1UHMA 2F5DA 3ZN0A 2IA1A 1R5HA 3GW2A 4OIOF 2P5LC 1I6XA 2Q0OA 1TQPA 1ZG1A 3E97A 3GWZA 5K5QA 4U7DA 1T0FA 2A5YB 1P6RA 2QQ9A 4U0WA 2H6BA 2XAFA 1Z05A 6PAXA 5LHIA 2LF7A 1OYWA 3RKYA 4HOBA 2OQGA 2Z5UA 3G3ZA 4EM1A 2NNYA 3N97A 4RGSA 5H6QA 1USTA 4ENNA 4GO1A 5D5VB 4OU0A 2QM3A 5H20A 5LRSA 1FBUA 3NQOA 2RKHA 1IRGA 2FBHA 5IT9K 3RPUA 3IRQA 1IAWA 3V7RA 2Q8KA 3DF8A 2D1VA 4WK8F 3HSEA 2DQRA 1UCRA 4NB5A 5D8LB 5DCMA 4RS8A 1KQ8A 3E6MA 5E1WA 5CYVA 3AAFA 2EA4A 5FLXK 2CYYA 4HF0A 1IXSB 2ZKZA 5ILUA 2XAJA 4AIKA 4CYDA 1KQ0A 3CUQC 3O3KA 2XAGA 1LEBA 3OOPA 4HBLA 1TW3A 2M5WA 1F5TA 4S05A 3GZ5A 3R4KA 2XRNA 1BJAA 4KA4A 3V7CA 3F8NA 1OKRA 4XBFA 3J80K 4G7ZF 4RB1A 4M9XA 1YW9A 2VOOA 1HKTA 2EWNA 3KP4A 3GYHX 2ZBKA 4BHBA 1G3WA 5LGUA 3CO7C 1BI0A 1J0RA 2FNPA 2FRHA 4LJZF 4ASNA 4HA8A 3BJAA 2PG4A 4EJVA 2JSCA 2WC2A 4Y15A 4Y13A 2DK5A 2L3DA 2H27A 2FF4A 1TQMA 4MQVA 5DUIA 4RB2C 2ISZA 3KCCA 3CDHA 3L2CA 3BDDA 1OR7A 4L9JA 2CWEA 2XHKA 1FBQA 4UVBA 1FSEA 2RC4A 5HS7A 2QQAA 3V7SA 2ZNZA 4IPAA 3SFZA 2D45A 1ZH5A 2XKPA 2VBYA 1FNNA 4HV6A 3T1BA 3FMQA 2EB7A 3RI4A 2QBYB 4QWQA 4BHCA 1IXRC 5BOXA 2PN6A 1I5ZA 4A6DA 5K5RA 1FYLA 2FA5A 1IN5A 4LK0F 5D6FA 3I0TA 2V1UA 1BOAA 4LK1F 1MJBA 5E1XA 1TQIA 5ICEA 1O7FA 1KU9A 3SZTA 3FXRA 3FWEA 3RKWA 4KICA 2VXZA 5J8CA 1DP7P 1GXPA 3T0YA 2QVOA 2AS5F 2BYVE 2KIFA 1O3TA 2L4AA 2QENA 1YIOA 2DPUA 4GGGA 2ZMEB 1TBXA 1USSA 3COAC 1U8RA 4EQQA 1JXSA 4OMZA 3R6SA 3ZP5A 2JPCA 2DU9A 3O2PE 2M30A 1K78B 2G7HA 1HKSA 3BROA 4GXOA 2W25A 4FHTA 4Q4ZF 2M87A 2GA2A 1TW2A 2P5VA 4MTDA 2R3SA 3JTHA 1R00A 2XVCA 3FXQA 3TDZC 4XLPF 5BPDA 5CVRA 4IRGA 5J6XA 1YW7A 4ENJA 2IT0A 2MH9A 2YPRA 5EEGA 2PFBA 5E8IA 1JGSA 5IT3A 1E2XA 3FXUA 1D5VA 2A07F 4EM2A 1Z1DA 3TOAA 3G73A 3E3VA 4UVCA 3EETA 1C0WA 3IL2A 1W7PA 1XD7A 3EDPA 1SD4A 1IZ1A 2GZWA 3HRTA 1Z9CA 2P7CB 1CGPA 1IN8A 1KA8A 2IPQX 4EV0A 2VOPA 1XGNA 3GUDA 1ZG5A 3BPXA 3KETA 1YYVA 3QOPA 3WTTC 3RJPA 2FU4A 1UB9A 1ULYA 1IN7A 5A2QK 4CDGA 4Z2YA 1MDMA 1O3RA 4KYWA 4N9IA 1NHAA 5ERIA 1XSDA 4M6XA 2VE9A 2HYGD 2D2WA 3MWMA 1EH6A 4PZJA 5LHGA 1AWCA 1ZLJA 1Z6TA 3F3XA 4FX4A 3F8BA 2RN7A 2EV0A 3HSFA 4AWXB 3WGHA 1S6LA 3IRRA 4RGUA 4HZFA 4IXAA 1HKQA 1IN4A 3ABTA 2RNJA 4P9FA 2FBKA 2P4WA 2OZ6A 3HHGA 3TOBA 3RPQA 2L54A 2Z33A 1EH7A 1SFUA 3GFJA 2EFNA 3RKXA 1FP1D 5EEHA 2Y0MA 1G4DA 2FSWA 5DEQA 3P9CA 3REOA 4Q47A 4UUVA 3CUOA 1YS6A 1U5TA 1KGSA 3DV8A 2TDXA 2LKPA 2O0YA 1D3YA 1WI9A 2XV4S 3JSOA 1XCBA 3K69A 1JE8A 3H3UA 4A6EA 5ED4A 4P55A 4OIPF 4HQEA 1K7AA 1SD6A 2EFPA 1HW2A 2K02A 4P5OA 3T5XA 2LNBA 5DYMA 4A0XA 1ZRFA 4CHUA 1BIBA 3BY6A 1J5YA 3MFKA 2OZUA 1FT9A 3BZ6A 1FLIA 2VC1A 3TQNA 4AIHA 1WWXA 4MNUA 5CLSA 2GXGA 4P9UA 3F23A 1F1ZA 4R8HA 2JZYA 1R58A 3KLOA 1LVAA 5DCMB 5D4SA 4WCGA 1QO0D 1UFMA 4CGZA 4LD5A 2MLKA 1I1SA 4I7HA 2A69F 3BPVA 3M7GA 4UXNA 1RIOH 3HIFA 4WXDA 4K2EA 1ZG3A 3ZN1A 5ILSA 1DDNA 3TDUC 4LG0B 1IRFA 3ISPA 1ONVA 4HDVA 4EMSA 1T6SA 3D0SA 5CJ9A 2P8TA 3SXYA 3GX4X 4BH9A 2O3FA 3B02A 3BP8A 3GXOA 1SAXA 1CF7A 5FFZA 4TV7A 1LDDA 2FMYA 3MAJA 1AOYA 2QWWA 1R23A 1BN5A 2MH2A 1O3QA 2BV6A 2F2EA 4I02A 1SFEA 4I2OA 1G6NA 1BC7C 5AIPA 1YQAA 3L09A 2HOEA 3MCZA 4G7OF 3V8LA 4L9TA 1VTNC 3WU1B 2IP2A 4H0EA 1HW5A 3VEPA 2DQLA 1I1GA 1LJ9A 1XGOA 3JW4A 1H9TA 3FHZA 3ERED 1O3SA 2PMHA 4DQ2A 2E7WA 2KIUA 4WF2A 4MHGA 3IHUA 2W85A 3TGNA 2COMA 1FZPB 3HYIA 4EVIA 5L3GA 3EYIA 1J2XA 1S7AA 4KT5C 2DFIA 2P7VB 1XDUA 1D8JA 2GXBA 3GVAA 3DEUA 1Z7UA 4P96A 3U1DA 5L3DA 2VT2A 1TNSA 3ZMDA 3MZYA 2FQ3A 4EGYA 3HRSA 1KU3A 1ODDA 1P2FA 4M9SA 3I71A 4UNOA 1FOKA 3QU3A 5BQTA 4OINF 2NRAC 1SD7A 1MJAA 2ZJ2A 5HDNA 2GAUA 3F72A 2FXAA 5D8KB 2DAOA 5DCFA 4PGGA 3WTWC 4KFCA 4I0AA 4M73A 4CZZA 3CUQA 2FBIA 1P92A 3I64A 3TO6A 2QUFA 1K6OA 4A5MA 4RAYA 4EJWA 2ADUA 5FD6A 2A6EF 2DO7A 3TO9A 5ICCA 2KJBA 3J7AO 1XB4A 5KK1A 4AD9A 5HLHA
chains in the Genus database with same CATH superfamily
1Q1HA 2W24A 2X6OA 3EUKL 3HB9A 4BUPA 2X85A 2XAUA 2Z99A 1YJWI 4YFXF 2KL4A 3DP7A 1B6AA 3KZYA 2H94A 2KPMA 2JVAA 3HOSA 5M3FJ 2K4JA 4BKXA 2HS5A 3DTEA 1B9NA 4ZH4F 1W7PB 3LSGA 1FKAE 1LUJB 2ZSHB 4ESJA 3ECHA 1K4TA 4D7MA 4L0YB 3F6VA 1DQUA 2Z3YA 1X4OA 2L7ZA 3IAS2 1G3SA 5FD5A 3RTRA 3T8RA 1MKMA 3BR3A 3C3WA 2E72A 2B63J 5EGOA 1YITI 4M30A 1ETXA 1WPKA 2WA0A 1JKPC 3FKIJ 4NBQA 2CUZA 4Q48A 5FGMA 2KONA 5ICGA 2KRCA 1S7OA 5M5YJ 3E6CC 2LFBA 2IRFG 1R6RA 2QQBA 2WBMA 2K9QA 4I76A 3A2KA 2UXXA 3KFWX 5E17F 3NWSA 1Y8RB 5EEAA 1Z91A 1SMYF 2BB8A 2GWRA 3J81Z 1GDTA 2Q1ZB 4LITA 2DFHA 5IYDJ 3QYBA 1BBYA 2IS6A 1ETVA 2RGVA 2DT6A 2RVCA 3CQZJ 3S3OA 2IJLA 2J7JA 2ZCWA 3W2VA 3JAMK 2JRTA 3LSJA 4X1EA 1X19A 2UUBE 2KKOA 4B09A 2LCEA 4KDPA 1JHFA 3K4NA 2A6HF 3MVPA 1LFUP 3LSTA 1MDMB 4JI7E 4JI4E 3HTXA 4YRVA 4DR5E 5HLGA 4MEXF 2F5EA 4W97A 2XUBA 2FUG2 2VT3A 2NOGA 2JVHA 2XIGA 2ZO4A 3M1EA 3P9KA 3UR3C 1Y1VJ 3ZQHA 1K6YA 2JRMA 3EPJA 1GVJA 3FIWA 3VODA 4TUGA 5FO5A 4HF1A 4C3HJ 5F3WA 3K4KA 3VSLA 5GADJ 2EOEA 4YELA 2ACJA 4E7SA 3HOZJ 4KWYA 1U3EM 1BBGA 1VFCA 3E5QA 3F22A 3CJNA 4NC6A 2UXNA 3K4LA 2EMXA 3EQ1A 3AG1H 2BE5F 2LSOA 3GMEA 2DB2A 2WAFA 2VE7C 3OYGA 1T08B 1XMAA 1ORKA 4BDZA 1KYZA 3GTPJ 1WRJA 3WG9A 2R7ZJ 2ZXJA 3BR5A 2XGDA 4C2UA 4O5GA 4LF7E 4G94A 3HM5A 1NEIA 5D5UB 2OC6A 2F48A 1YS7A 3D5LA 4LF8E 3BG3A 3DEWA 2GHFA 1NG7A 2F5FA 2R7VA 1FY7A 3ZGKA 2CQKA 3HSRA 1T56A 1V5FA 3WU0A 3LFKA 5ICFA 1PP7U 1IRZA 4B3XA 1QGPA 3CJRB 4LFCE 2YT4A 5AC4A 5DTDA 2LJUA 4EM0B 2DMNA 2RV8A 2B9SA 3MN2A 3C2HA 4MEYF 1HR0E 2ZXWH 5JFRA 2E60A 1PJSA 4FQGA 1STUA 1JJ8C 3RDIA 1VQMI 2V87A 3SZPA 3W6JB 2ZFUA 1UBDC 1R1TA 5J1YA 3GTQJ 2MW8A 2G0EA 4JP0A 3UKGA 2CQ7A 2O03A 4GFBA 4AUXA 5A6KA 1TNTA 4R2QA 4GRIA 5E3NA 1YYKA 5IY5H 2UXCE 4PCQA 1PDNC 2H1LA 2BBYA 3I4PA 3RYPA 4XKWA 3JTZA 2NUGA 5LFAA 1YLFA 2CFXA 4RGXA 1MSEC 1V54H 2HXOA 5DS9A 3ZMZA 4CCOA 4YIFA 4RM3A 1VQ9I 1XMQE 2BHYA 4UHTA 4LGWA 4ZZDA 4BS9A 4NHJA 2JA7J 2DTRA 3F8CA 4JV5E 2H8RA 4XLHA 2QBYA 2YTJA 2JTVA 3QQAA 1H8AC 3A1YA 1TWCJ 1BR1A 3ULQB 1AA7A 2QKMB 1NK2P 2EPCA 5JI6A 3W6KB 4KN7X 1ETYA 2EIJH 2LKSA 1N32E 4KNYA 3BGHA 3IH2A 2EMFA 4GKJE 3HRMA 1DPUA 4R2AA 1WHNA 4E7HA 1A1IA 4JK1X 2DSYA 4WXCA 1IV8A 2OCEA 5JVGF 5TJJA 4B8XA 1TF6A 2HHHE 2CO5A 4A3EJ 1VQ5I 2W57A 3QRFF 2LBSB 3H5AA 4A3KJ 5KL6A 5GAGJ 4HNVA 3A02A 1ZRDA 2EA2A 3VYRB 1G3TA 2HI3A 4JX6A 1FYKA 4BY7J 3FXOA 4ZYDA 3BG6A 3HC7A 4EEFG 1JUMA 3JRDA 2XB5A 5IT9Z 4TUIA 5AIQA 2WADA 3R0JA 1AH5A 2QEXI 5E20A 2JJ7A 1AKHB 3PJRA 3CTAA 4X66E 1WJCA 4L18B 2E7XA 5AONA 1B8IA 2EMBA 4KUMA 2YU9J 4R03A 3LQRA 4DV6E 1Z21A 2FMLA 1MBHA 1OMIA 1V5EA 2L4MA 2OAZA 3ZRGA 3BT9A 4DBQA 2EOYA 3EQLF 1NCSA 2LRDA 2ZMEA 2A5WA 3FF5A 2QYOA 4QPOA 5TSEA 2BY1A 2WWYA 5C4XJ 3J7YJ 1YSAC 4BHPA 5FLXZ 3BZCA 4MO7A 3A4CA 2MBFA 1REPC 3BG7A 4RAZA 2LVHA 2EPRA 4DV3E 3TEDA 2MG4A 3OYFA 4AYBA 1RESA 1S8NA 4N4RB 1YYOA 2K86A 3VYTB 2VF1A 1X2NA 5EG0A 5L3CA 1T39A 1B4AA 2EBIA 3CLOA 3FZVA 2EM5A 2D9HA 2H09A 3M9AA 2JPBA 4I98B 5J47A 2HVRA 2JA6J 1Z1BA 5M3MJ 1MNMC 2CG4A 2UUZA 5F1RA 4KT6A 2C6YA 2ESHA 2R5YB 2NVUB 3VWBA 2D1HA 4B48A 1SFXA 5EZGA 3DCFA 3LL7A 3S14J 5A6BD 4X62E 5F64A 1XDSA 2XKOA 3OYCA 3E6BA 2EMKA 4JQFA 1PUFB 5J4VA 2K7IA 2JP9A 3E6DA 1FYMA 3NEUA 4AYBN 2AXLA 3J80Z 3I59A 4W1UA 1R4MB 4YFNF 2HJJA 1JK1A 1B1BA 4RBOA 2LYCA 4C3IJ 3IKVA 4CA0A 1DUXC 2HQ5A 2FX0A 3VK6A 5KNLA 4DW6A 2EN6A 1K4SA 2L8TA 4L5IA 3HOUJ 1X4PA 1A04A 4A3GJ 2WB1N 3PFIA 4C3JJ 1XPXA 2DDAA 1BC8C 4LLNA 1ZGAA 2Y48A 2DT7B 2AQFA 2RDPA 2WAQN 4XORA 2ESNA 5E8GA 1LE8A 3U21A 3P1XA 4F55A 4NQWA 4PJJA 2O5RA 3R0AA 5TRDA 2MDGA 2X6XA 5EDNA 1EJ9A 2L3JA 2NA2A 1I94E 3H0DA 2YU3A 2ZFWA 3HL2A 3ML6A 4CCKA 1O0WA 3HXLA 3CLQA 1F4KA 3LA7A 2OD5A 2DN0A 1MSFC 1J9IA 1H9GA 1RNLA 3F9KA 2YTDA 2MD0A 4JX4A 3QOEA 2A05A 3ZOBA 1J59A 3WTYC 1MMNA 3THOB 2RQPA 3S3NA 3OIOA 2MC5A 1RR7A 3MZHA 1RZ4A 2DK8A 4AC0A 1VQNI 4BC7A 2XPVA 2NNNA 4M6YA 4RLQA 5H6RA 3CMYA 4V19K 1EKEA 1ZKGA 3PNTA 3H0GJ 2JY9A 3Q0UA 3AV0A 2CFOA 4A0YA 3V42A 3VYUB 3WE2A 1YHQI 2PJPA 2EH3A 1QBJA 4ETSA 1VNDA 2BVLA 2MC6A 2E1NA 5TISC 2EPKX 4CCLA 3DTKA 3QAHA 3M8FA 4YG2F 5K7FA 2HGCA 3HOTA 4Q35B 4NDLA 1WHUA 3AG4H 4EGZA 2QZ8A 3I54A 4RB3C 2M8GX 2PLYA 4G8XA 2CS3A 2LK2A 3HPZA 4DUZE 1HNZE 2JR1A 2E1CA 2LTPA 3IV5A 1VZ0A 5E79C 1OCTC 2KDZA 1D0XA 1QQIA 1T95A 1ZR2A 3WODF 3HDDA 2DLKA 4Q5SF 4IF4A 3M3YJ 3ZPLA 2YTOA 2WV0A 5CVUA 2M45A 3FKJA 2BGCA 4JYAE 1WH5A 4A5NA 4BQOA 3BR0A 1SVOA 2RQLA 2HTJA 2LR8A 2Y0SA 3KP3A 1YYWA 1LNWA 4HTGA 1H0MA 4ZDOA 2GXAA 2CUFA 1E3HA 3S17J 2V1DA 1A6QA 2DT5A 5BS6A 2BY0A 2E2JJ 3VYYA 4DBRA 2VKEA 1T4NA 4ESFA 1A31A 2X0LA 2OQRA 1ZTRA 3D5SC 4UV8A 3S16J 2FOWA 4LLGF 2LMZA 1X1DA 3WG7H 1PKPA 4B43A 4KIBA 3D1NI 5K1YA 2R76A 5DD4A 2EM7A 2DA7A 1IRXA 2K27A 1U9NA 2XDVA 2YX4A 3F6GA 3CCQI 3S15J 3C2GA 4ZYGA 1RI7A 5IYCJ 3M8EA 4BC9A 5DD8A 2HVQA 4A3DJ 2HZTA 2IA0A 3TKYA 3W2AA 2DA6A 1N36E 3LSKA 4BNCA 3JRFA 4HX8A 3LAPA 2EIKH 2Y0SN 1ZBTA 3WTXC 4GZNC 1X58A 1WCMJ 2BW3B 3R60A 2EPZA 2LY9A 2OA4A 2WY7Q 5F27A 1U78A 2OTJI 2EM9A 4MLVA 4MQ9F 3GF2A 3C7JA 1I3AA 3QWLA 3J7AY 3S8PA 1N78A 2CMPA 1ZARA 2EMAA 3HPGA 4B3SE 4L0ZB 2MSYA 4E7KA 2PMZN 4CICA 2R7DA 4KIGA 5CVIA 2R7TA 1G3YA 1DU6A 3AFHA 1TLHB 3CCJI 1SC7A 2Z2SB 2COBA 3J7Yp 2G7UA 1OYYA 1FOYA 2P5KA 1EV7A 2V79A 4OOIA 2KZGA 3CCSI 1RKWA 5A6BA 1RUNA 5AE3A 4O6JA 2M7BA 4BJ5C 1UHWA 2CH0A 3ZMTA 2STWA 4XLEA 4FK5C 2DGCA 1BW5A 2W7NA 4DMIA 4FE7A 4IHSA 1ZYRF 2EMLA 2E1MB 2LY1A 5F0HA 3JTGA 3FISA 4KIFA 2R7XA 2R7QA 5M5XJ 4JI6E 4F93B 1VF9A 2LH9A 1T38A 4B44A 1NTCA 3L00A 2V89A 3K1MA 2RPCA 3ADLA 2L7FP 3HUGA 1IDZA 4U0YA 3KP2A 3DBRB 2L2MA 3VYSB 1MD0A 3WTUC 3H35A 1L0OC 3BTIA 3H3VK 3WE3A 2BOLA 1R7JA 1ZRCA 3FXLA 4LTYA 2ID6A 4HLXA 2Q2EA 3CUQB 3Q0VA 4WPYA 4FX0A 4BAYA 5IWAE 1GUUA 1V4RA 5D6EA 3I55I 4M71A 1X6FA 1A5JA 5D5XB 2UWMA 1JKOC 2XASA 3C18A 2IW5A 2PEXA 3MQ0A 4L9VA 1YOVB 4A93J 1IBME 5IOYA 4DNCA 4O3MA 3CP2A 1HA8A 3PQKA 3M8JA 2KRFA 2W48A 1MGTA 1D5YA 3LOCA 3DPTA 4WX9A 2CW0F 4Y17A 2K9SA 5LLQA 2DIXA 2DTZA 3F6OA 5LBQA 2L9NA 1E3OC 1X3CA 5DUKA 1FP2A 5LGTA 2LUPB 4DV0E 4HSRA 1FWZA 2DMIA 3S1QJ 3WHCA 2EP3A 5DDGA 2EL4A 3A0BC 1MMGA 3K2ZA 3QPTA 1T98A 2BY2A 2L2OA 3G1LA 3WGGA 1HNWE 4Y7NJ 4XOTA 5AE2A 2J5OA 3X2QH 2YTQA 4P7DA 2O7OA 2I9IA 1XSVA 2IGNA 2Y9YA 5CVJA 1KU7A 4PJMA 4YFKF 3IKTA 3IWFA 5C4JJ 1P4WA 3KZZA 5ILVA 1ON2A 2BHZA 1O57A 1RETA 3NAUA 4HLYA 4ZTJA 4M0VA 3KP6A 4DGWB 3KZIC 4JOMA 4KMUX 3ZQFA 5EGOB 2NAZA 5IOZA 2CT1A 2CU7A 2FOKA 1JK2A 2VJJA 1LEAA 3E5UA 3ADIA 3HPSA 2VBWA 3Q9VA 3FX3A 2HTSA 2IA2A 4G7HF 2ISYA 2MC3A 5A2QZ 2ECBA 2OF7A 3TQMA 4KMFA 4R2SA 3K4JA 4ENMA 4IJAA 2XAQA 2E1MC 3ZMUA 1L3LA 4GYGA 1EF4A 2VN2A 1GZ6A 4ON0A 1IF1A 2R7UA 2EM0A 2DLLA 4QIWN 2L9VA 4AVZA 2IXSA 3LLHA 4GKKE 4EJTA 3HRUA 4IVNA 4B3TE 4KN4X 2KT0A 2OU2A 2VL8A 1FIPA 1FPQA 4C9YA 2KJCA 4IL6C 4D7NA 2EOIA 4R2EA 3IWDA 3B6AA 3K70D 3BOQA 4LG0A 4AVPA 4RLFA 3M99B 2EFQA 4ENKA 2A61A 4LLLA 1HSJA 3QP6A 3HOXJ 3H9JA 2RS7A 2HYFA 3JAMC 3C2BA 1HCRA 2XROA 4P78A 1JTYA 1YUIA 4NUBA 4LOCA 2QSHX 2EN1A 2L33A 4IHWA 2HQAA 1QZEA 3DWLE 1JT6A 4DR4E 4BEHA 2XSJC 3S1NJ 4XLAA 3I53A 2FNAA 3O6BB 3I58A 4X9JA 4HX7A 2HQRA 4O5VA 4WSGA 4LF5E 3SFIA 4LF9E 1KU2A 4C30A 2EFOA 3PNYA 1WVRA 5HVQC 3CMEI 1JHHA 2DPDA 3V8KA 1IGNA 2NOJB 1RUOA 4S0HB 3IUOA 4HDUA 4FCYA 1T2KA 3W6VA 1ITYA 4PUSA 2R4GA 5F1JA 2DJNA 1S29A 1QRYA 3I4NJ 4L8NA 2HOAA 2CGPA 3GFMA 2H36X 2EOOA 1OCZH 1U6GA 5LMUE 4F9BB 4I09A 5HLIA 2JT1A 3CP8A 4LB5A 3L2RA 4HPQA 2EWLA 2V8QB 4B47A 4OIRF 3BJOA 3S93A 2HXIA 3DF6A 1VQPI 3GEZA 3H5RA 4HYEA 5HOOA 3GFIA 2EOMA 2EINH 4LMYA 1W7PD 4PFOA 2DXIA 2JSPA 5CKTA 3K6QA 4WXHA 1IXCA 4XM3A 3KIOA 4I0BA 1TN9A 2V6CA 3DFGA 4KJZA 2JA2A 2MLGA 4BXUA 3OYIA 2VC0A 3B6CA 3KP5A 4G6QA 4I01A 2YU8A 2YTNA 4IRHA 3JREA 4G12A 2XRLA 1WSUA 2QF7A 3BJ6A 2DOFA 2XPUA 2HKOA 2OTLI 1E0EA 3VB2A 2V86A 4PDKA 3HKZA 2RS6A 3KYLA 2O6GE 1N33E 3OYDA 1UHZA 1W4MA 3H3ZA 2MFZA 3U9GA 4HNTA 3C1DA 4II2A 4LFUA 5EF6A 4PGHA 2PI0A 3EYYA 2DA5A 1G8XA 4I99C 5A6JA 1FX7A 5GAEJ 5FB2A 2DMUA 2NS0A 3FMRA 2ZXIA 4X65E 2ODRC 1R5GA 1LLMC 2WZOA 2ETHA 2X51A 3K9TA 3K10A 3QYFA 3N4MA 2EPFA 3K70C 5GPCA 1OCCH 3H9GA 2K4BA 3G6EI 1HW1A 5E1ZB 1FSHA 2PJRA 1I39A 5L3BA 3VFZA 2O8KA 4G9YA 3DU5A 3IC7A 2GM4A 1X1AA 3HKZN 3MKZA 4B3RE 2EOHA 2HOSA 3CDLA 2EOXA 4AIDA 5J1UA 1IUFA 4IX7A 4NHRA 4K0KE 2JN6A 1GTKA 3HHHA 1IC8A 5T6JA 2ID3A 2H8WA 3P7NA 1F43A 2IGMA 3LWFA 3RZDJ 4EJUA 2L01A 3ECOA 3JRGA 3GO5A 1HNXE 2JK3A 5KVRA 1HBXG 1YUJA 3HPHA 2FJ1A 4LU9A 2YRKA 3ZQ7A 1QVTA 3HG9A 2V9VA 1SAUA 1JGGA 2GBYA 2M1BA 3FMSA 1T8IA 2EM4A 1MBJA 1B8IB 2W84A 1NH3A 2L3CA 3KX2A 4R1HA 4XSZF 1WJEA 2ZSIB 1XCVA 1Z6RA 2QSFX 1DGRM 4L5JA 3W2WA 2XGCA 1R22A 4PSWA 2ENAA 4BCAA 2G9WA 2EZKA 2HQNA 3LA2A 5HODA 1AU7A 1N34E 2V9KA 1JUPA 3CCRI 2EV6A 1FC3A 2MA3A 2YX7A 2VB6A 3IWZA 3FIGA 3BLYA 3CC2I 4L9NA 4DR1E 1XMKA 5HS9A 3GTGJ 2EN2A 2L0KA 3F8FA 4A0ZA 1GHCA 3CESA 2OCCH 2H6CA 2EPLX 3DBHB 4FT8A 3TO7A 4F6MA 4DUYE 2HYJA 2OUMA 1A1GA 4BXXJ 5EG0B 1WFXA 4JI3E 4HEA2 1MZBA 4MGRA 1ZHFA 2LG4A 4A3BJ 2WCC3 3I5UA 4E6KG 1KQ9A 2PMUA 1E17A 1VQ7I 2NS7A 1IW7F 2A68F 5KL7A 5AE1A 2HFHA 2EMCA 1X6EA 5D4RA 1W5SA 4M72A 2L7MP 5E18F 5D5WB 4PK4A 2F4VE 3JCUC 4LFAE 1B9MA 1RMDA 3DTIA 3LNQA 3KEQA 1OCOH 3PFYA 1YZ9A 4XSXF 1JKRC 3L2VA 2VRDA 2KDOA 2DW4A 3I59B 3HGGA 2NVYJ 3G1OA 4BQNA 4XRMA 2KQRA 5FFXA 4CXFA 2ELJA 1UG2A 3MZ8A 2GPIA 3J81C 2HR3A 2HWVA 3LSPA 1ZLKA 1YRNA 3GTJJ 4NZVA 1T4OA 4F2JC 1FMVA 2YR2A 4M9ZA 5LD2C 2JUCA 5L3FA 5F08A 4G6DA 5DM7F 3MSWA 3ZMVA 1U5TB 2VBXA 4RH8A 1XGSA 1MJ9A 3BC8A 5LEJA 2UZKA 2PBIA 3P5JA 3BR1A 3OSFA 4A3IJ 1HDPA 5LEKA 3GFLA 2EOZA 2M8EA 2MKNA 4XR6A 3S2HJ 3D5RC 3ABUA 2O8XA 4MFEA 4NQWB 2X48A 1SD5A 2P6SA 5IV8B 2XSDC 1YW8A 1DQ3A 4F3QA 4UV9A 2LDUA 2YSRA 4DV7E 4GCVA 5HNHA 1S3JA 4HW0A 1W1WE 1WQ2A 3CCVI 2Y69H 1RPWA 3BTCA 1WKMA 1R1UA 1GXQA 2E5NA 2KIMA 4RMNA 2Z1DA 2L6MA 2GIZA 3CCMI 3S2WA 2X4HA 4XIDA 2CSHA 2HNHA 1UELB 3HTUA 3RYRA 2VE8A 3K1NA 2L02A 1PVEA 3QYEA 3FXMA 1QNTA 2K7LA 3KP7A 5DV5A 1MNEA 5JHUA 2ZNYA 2VODA 3JRCA 3OMLA 1S9HA 4HQMA 3H92A 1ON1A 3QU6A 2FV4B 2ELKA 2HEOA 1FOXA 3HZJA 3ZCOA 4WYQB 3DKXA 4CYCA 4IRIA 3WHBA 4BMJA 2PQ8A 3DJWA 2VBZA 3L9FA 4IS1C 2X1DA 2E1OA 2HPIA 2HZDA 2KLOA 2ELHA 3A03A 1J7KA 3BWGA 4DV1E 3PQJA 3F21A 2Z9OA 4HF2A 5CVVA 4AIJA 3ROUA 1WJFA 3U2RA 2UXDE 1Y6IA 2LP0A 4M74A 1D8KA 4EJOA 2BY3A 3VYXA 4BQAA 2EMYA 2V7FA 3JSPA 1YIJI 1IV6A 3ASNH 1BI1A 1J75A 3NRVA 4Y4RA 4N0BA 1R1VA 4CO8A 4E70A 2EMWA 5BPIA 1I50J 3C6KA 4F7ZA 2LV2A 1QZYA 1QZZA 2B0LA 3SQNA 3S3MA 1A1JA 2WBSA 1ZK8A 1P4XA 3FM5A 2MYSA 3K0LA 3ABKH 1BB8A 1FBSA 1WJ5A 3PUBA 1A6IA 1MMDA 2XPWA 3LQQA 1A1FA 4RB0A 2N3GA 4LF4E 4B4CA 4DIQA 3GTOJ 3SHFA 5FRMA 1P47A 2GA1A 2HC5A 3HTSB 3W3CA 1MH3A 1G59A 3CCEI 3LAJA 1HXDA 1LFPA 4DOZA 1K78A 3FM3A 3RZOJ 1PUEE 3OV8A 4HV5A 1STZA 2EK5A 2LMDA 3EUHA 5HDGA 4XLNF 2DMPA 2WB1A 5LHHA 4A3FJ 1I27A 2EJRA 1S72I 1U5TC 4QSHA 2IVMA 3E5XA 1MEYC 1LQ1A 2WAQA 1O7LA 2Y75A 2QA4I 2CTDA 3L2UA 2P81A 1TWGJ 4YIIA 1IUYA 2I8DA 2WY8Q 1Z67A 1QPMA 1YTYA 3F6HA 1S5LC 5BMZA 4WWCA 1IN6A 4AM3A 3VOEA 4FTHA 3BG5A 1POGA 3FBNB 2EL6A 3J7AG 1XSXA 2QLZA 2LF8A 2E2HJ 4D1QA 3QPSA 1U2WA 1V3FA 1B59A 3WTSC 2KIQA 1VQ6I 2KISA 1JKQC 2A3SA 2F5CA 2O9LA 3RQ4A 4D0PA 1BI3A 2EFWA 1SFOJ 1TF3A 2FD5A 2RSMA 1J09A 3F0CA 1XTAA 4II3A 5FROA 2R93J 2WTEA 2O61A 1ZU1A 1SMTA 2AO9A 1BM9A 1PP8F 3OR1C 1R36A 1XX5A 3T1YE 5M5WJ 1Y56A 1G2HA 5F0FA 4J01A 1MBGA 2JA8J 3CCLI 4S04A 1Z7LA 3CO6C 4N4OB 3PO2J 3L1PA 2VKDA 1YJ9I 3WTZA 1ERDA 3DQVC 1CF7B 1OYIA 2NS8A 5A6AA 5IP9J 2J5PA 1KONA 3K2AA 1DGWY 4LFBE 2DRPA 2VQEE 2LT7A 3DPLC 1BIAA 2YSPA 2CSOA 3LSIA 4FETA 4LB6B 2A25A 2LJHA 1ZREA 2CV0A 2DA3A 1LDKB 4RGRA 2YUSA 5HDKA 2EOFA 3K1PA 3EPHA 4GYIA 2BBGA 4QLCU 1YO5C 4YEJA 5KHDA 1G2DC 3LMLA 2M9HA 1P4AA 3MEXA 3HJEA 3ZQIA 2FGGA 3FXKA 4CUGA 2V4JC 3DBLB 2Q2EB 1YFHA 2NABA 2MD5A 3GLXA 2HU9A 4A12A 4OIQF 4U7BA 4UVAA 1LKXA 3WGIA 3KE2A 1LFBA 4U0VA 2EM8A 1X3UA 3QPHA 1A1LA 4IZZA 2M1SA 1ZGJA 4IHTA 1PJQA 5DNYA 4ESBA 2VONA 1YG2A 4UUSA 1W5TA 1ZN2A 3J81K 3ESWB 4M3EA 4JBAA 4BJ6C 3RPUD 2XGXA 5J8FA 2STTA 1DP3A 1HSTA 1K79A 3BQZA 3ZOQB 5ADZA 3HGYA 2DFFA 3DKWA 1X1PA 2FE3A 5L3EA 5JVTA 3KLNA 2GQQA 5IYBJ 3L7WA 1PYVA 3OY9A 1XN7A 2P6TA 3HBLA 2M0MA 2NYXA 4BYYA 1ZAOA 3F8MA 2HOTA 3FK7A 1MBFA 4LG3A 4XL9A 1F9NA 4MTEA 2DDBA 2VJ5A 3GZ6A 2BEOA 1HQCA 4X0GA 1VQ8I 3A01A 3KEOA 2MDRA 3ADJA 5KL4A 2V1XA 1X49A 2ME0A 4PJLA 2RSIA 2R7OA 1EH8A 2KRHA 2EN8A 3ONQA 5FLMJ 3LA3A 1F36A 1OPCA 2PMZA 1XG1A 2IHR1 3NARA 4IKFA 2W4SA 2VUMJ 4OOGC 4BXFA 4KISA 3JAMZ 1TTYA 4ZYHA 4JI5E 2WAEA 2FQ4A 4NNJA 2EZIA 3WTVC 3TMOA 2EIMH 1LVKA 2RAEA 3R61A 4N9HA 5HS8A 1DPRA 3CD6I 2EMZA 4OWRB 3SYTA 2L9SA 3ZMSA 3T8TA 2DYSH 4V2FA 1A1KA 1DGCA 4HNUA 4R79A 1CQTA 2EV5A 4OMYA 2ENHA 2HKXA 2R7FA 5IT9C 3ELKA 3MKWB 3QP5A 2L92A 1LDJA 2GIVA 4B3ME 3Q9SA 3GZNB 2HDCA 3V4GA 2OV7A 5LRRA 4U87A 2DMYA 4L5EA 4UY8I 1YX5A 2VJ4A 3CJTB 3ZR8X 5JLWA 2DBBA 3CC7I 1GQEA 2OBPA 1BI2A 2DI3A 3DU6A 3THNA 5IXMB 2R5ZB 3Q5FA 2VKHA 3C4TA 1VQOI 4ZYEA 2CPNA 3H1CA 4RA2A 1LB2A 3OS1A 3U1KA 3OS2A 5CQEA 2KZVA 4HX4A 5LGNA 2FEZA 5F6FA 3RIRA 4BBRJ 4HAMA 2L7KA 2XAHA 2NXNB 3DXJF 2TCTA 1V55H 1Y0UA 1BA5A 5K5OA 2HVSA 1OCRH 1KYWA 3V8JA 1XGMA 1J26A 4U88A 3PIPF 4A2UA 3FBIB 3P9IA 3B73A 4XRFA 4ZZLA 5JR3A 2B7EA 2W1OA 1UHMA 2F5DA 3CDIA 3OMYA 3ZN0A 2GOMA 2D5VA 2IA1A 1R5HA 4BL0B 4F9CB 3GW2A 4BEHB 4OIOF 2P5LC 1OCPA 1I6XA 1RRJA 2Q0OA 1TQPA 5KL3A 2EMIA 2LC2A 4GDFA 2L2NA 1ZG1A 3SEZA 2DA4A 4LIVA 2NVQJ 1IQSA 4BACA 4IOAF 1PJRA 3E97A 4X8WA 3GWZA 2VQLA 5JLXA 4ZDPA 4MLOA 1R71A 4XN3A 3RSNA 3A0HC 3OL4A 1OQYA 4E4HA 5K5QA 4U7DA 1T0FA 1T4LB 2A5YB 1P6RA 2QQ9A 3JRHA 1AHDP 3MHSC 4O24A 4YY3E 1X1CA 4BQQA 4BE0A 1N3GA 2W82A 2YTIA 4U0WA 2H6BA 2VJIA 2XAFA 5BR8E 3J80C 1MH4A 2K40A 1Z05A 6PAXA 1HF0A 5LHIA 3H09A 1D1AA 2LF7A 2GLIA 4IHXA 2YSOA 1W0TA 1OYWA 3RKYA 4HOBA 2OQGA 1I6HJ 1SVLA 5FKKA 2Z5UA 3G3ZA 4EM1A 5IPAA 2NNYA 3N97A 3OSGA 4RGSA 2DMQA 5H6QA 1GLNA 1USTA 2DCEA 3MHHC 1WJPA 1AAYA 4ENNA 5IP6A 4GO1A 3JRBA 5D5VB 4OU0A 2QM3A 2K4VA 5H20A 5LRSA 2TRTA 1OLTA 3BCBA 4N4NB 2CW8A 3JR9A 1FBUA 3NQOA 2RKHA 1X6HA 4JYKA 1IRGA 2FBHA 5IT9K 1SANA 2R7RA 3OWTA 1QU6A 3BCAA 3RPUA 2DA2A 2LBFA 4XONA 3TW7A 5C44J 4X64E 3IRQA 1IAWA 3DEEA 3V7RA 3JU0A 1TT5B 1O4XA 2Q8KA 3DF8A 2D1VA 4WK8F 4F91B 2KHMA 3HSEA 2VQHA 3AL0B 3IWBA 2DQRA 1UCRA 1Z77A 2XGEA 4NB5A 2HDWA 5D8LB 5DCMA 1X2MA 2EN4A 4RS8A 2ICWG 1BBOA 3K7AJ 3TP3A 2ELYA 2V1NA 1B72A 1KQ8A 4V2GA 3ECRA 3E6MA 2JUGA 2L2KB 5E1WA 1D1CA 2PJRB 1GVDA 4XNFA 5CYVA 3AAFA 2EA4A 5FLXK 2LD5A 2CYYA 3OIQA 1GT0C 4KZSA 4OX9E 2LY2A 4HF0A 2YZTA 1IXSB 1RQ0A 3OTOE 2ZKZA 4E7JA 3ZQLA 1ZBQA 5ILUA 2XAJA 2ODRD 4AIKA 4CYDA 4ZTFA 1WJBA 1KQ0A 5E3LA 3CUQC 5B1BH 1APLC 3O3KA 2LLKA 2XAGA 1LEBA 3OOPA 4HBLA 1TW3A 1Y0NA 2M5WA 4B1RA 3VHTB 2E36A 5GTHC 2ZC2A 3FHNA 1F5TA 4S05A 3I9V2 1ETKA 3GZ5A 3S1MJ 1KZHA 3R4KA 2XRNA 4F92B 1BJAA 3L2WA 3EUAA 4KA4A 3V7CA 2BXYA 2DA1A 2K5CA 2Z16A 1D0ZA 3F8NA 1OKRA 4XBFA 1XMOE 2Y30A 5KAIC 2E34A 3J80K 4JI1E 2YS9A 3GLLA 4M9XA 4XMYA 4RB1A 4G7ZF 2M7QA 1FJGE 3SDGA 2LTSA 4M3DA 2K9LA 3BF2A 3BG9A 1YW9A 3BR6A 3BTLA 3BR2A 2VOOA 2EMHA 1HKTA 2EWNA 4M9VC 2E1MA 3KP4A 2ZBKA 4BHBA 5LGUA 1G3WA 3GYHX 5IP7J 4M3GA 3CO7C 4R2CA 2EQ0A 1BI0A 1IDYA 1J0RA 2EQ3A 2FNPA 2FRHA 3I3LA 2JMWA 4LJZF 4ASNA 1VQKI 4HA8A 2YRMA 3BJAA 2X1EA 3GBGA 2PG4A 4EJVA 2JSCA 2WC2A 2CUJA 2VIXA 5F04A 4Y15A 4Y13A 2DK5A 4IQ4A 2L3DA 2EPXA 2RTXA 2F5VA 3FXJA 2IGOA 4NC7A 1Y1WJ 2IGKA 3EPZA 2H27A 4C2TA 4IQJA 3KYDB 3CZ6A 2FF4A 4DYQA 1TQMA 4MQVA 5DUIA 1P7IA 2EM3A 4RB2C 2ISZA 3KCCA 4D5CA 3CDHA 3L2CA 2NVTJ 3BDDA 1OR7A 4L9JA 4ZYAA 4R2PA 4O4KA 1ZELA 2CWEA 1RKTA 2XHKA 1FBQA 4UVBA 1FSEA 2RC4A 3EPKA 5HS7A 4HEIA 2QQAA 3V7SA 1JUSA 1FMWA 2VQGA 2ZNZA 3AUZA 3QPLA 1XC5A 2YRHA 2I5UA 4IPAA 1YRNB 3SFZA 4X6AJ 2M2EA 1QU3A 2CRGA 2D45A 1W0UA 3SEQA 1DI2A 2DOAA 2CW7A 3AG3H 1ZH5A 2XKPA 1UZCA 2VBYA 3K4MA 3EPLA 3HOVJ 1FNNA 1WGXA 1BOBA 4HV6A 2LRSA 1IBKE 3T1BA 3OYAA 3I56I 3FMQA 3PNVA 2F6CA 2N8XA 2EB7A 3RI4A 4Y3OA 1HDDC 2QBYB 2EN7A 3K6GA 4QWQA 2M0CA 2M7AA 4BHCA 1TWHJ 1WH7A 1IXRC 5BOXA 2JYAA 2PN6A 1I5ZA 1X48A 3PIOF 4A6DA 5K5RA 1FYLA 2I10A 2KFDA 2IEKA 4PFPA 4CCMA 2FA5A 1IN5A 3HEFA 2YTPA 2LOOA 4LK0F 5D6FA 3I0TA 2OJED 2K9NA 2EL5A 2ZJRF 2V1UA 1BOAA 4LK1F 1T33A 2CJJA 2CQQA 2MABA 1MJBA 5E1XA 4F52A 4HG2A 1TQIA 4JI2E 4ZC3A 5ICEA 1O7FA 4NXNE 1KU9A 1UG0A 3SZTA 2H1KA 1HOMA 3GTLJ 4PJNA 2RQQA 5GPAA 1FOWA 3FWEA 3FXRA 1Z0XA 9ANTA 3RKWA 4CSWA 4BE2A 3OIPA 4KICA 2VXZA 4WFTA 3DKYA 3VPRA 5J8CA 4E7LA 4CYCB 1DP7P 1ETQA 1GXPA 3T0YA 4RHBB 2QVOA 2R7SA 2AS5F 2LO3A 4ZDLA 2BYVE 1WXRA 2KIFA 1O3TA 3CF5F 4ZJZA 4QPQA 5LMNE 4R2RA 2IAIA 2F4MB 3ZXSA 4A3CJ 2L4AA 2QENA 4M3BA 1ETOA 1YIOA 5K7HA 3FDYA 4Y33A 2EM2A 4Y52J 2DPUA 4GGGA 2ZMEB 1TBXA 1USSA 1D0YA 3COAC 1FTTA 4BU2A 1U8RA 2Y9ZA 1ENHA 3ERMA 4EQQA 1JXSA 4OMZA 1VI0A 2DODA 2QSGX 2P0WA 1UN6B 3R6SA 2K85A 3G4SI 1GV5A 3ZP5A 4IHVA 1WJAA 4LF6E 2JPCA 2WBUA 3RMPA 2DU9A 3E0JB 2LTRA 2EZLA 5A2QC 3O2PE 1U8BA 5FKNA 1JI8A 1U0JA 2M30A 3OR2C 5K7ZA 1K78B 2G7HA 1UMQA 2E5LE 1HKSA 3BROA 3OYBA 1A36A 5F0CA 5FRNA 4GXOA 1A1HA 2W25A 2LKXA 4FHTA 4Q4ZF 3LFUA 4DYRA 2M87A 2P5VA 2GA2A 1TW2A 3OOUA 2HDDA 4MTDA 2R3SA 3JTHA 3OYNA 1FJLA 2YU5A 1R00A 2B7VA 2XVCA 3FXQA 4R8OA 3TDZC 1KJKA 4XLPF 3PO3J 1ZQ3P 2OPTA 5BPDA 2NVXJ 5B5EC 5CVRA 4IRGA 5J6XA 1YW7A 4ENJA 2IT0A 5EZHA 4XKBA 2KP6A 4L5NC 4WSPA 3FK6A 1BR2A 2MH9A 3TL4X 1JT0A 2YPRA 5EEGA 2PFBA 5E8IA 3KWRA 1JGSA 2HPMA 1QA6A 5IT3A 1E2XA 3FXUA 1PJTA 1D5VA 2XC7A 2A07F 2EQRA 2X1CA 2F4OB 4EM2A 1Z1DA 3TOAA 4DJAA 4ITVA 3E3VA 4CH7A 3G73A 1P7JA 1H88C 2KMUA 3Q3SA 4UVCA 3EETA 1C0WA 3KEYA 4D9JA 2E35A 3ABLH 1W7PA 3IL2A 1PDAA 1MNDA 1N25A 1XD7A 1LE8B 4RDUA 3EDPA 4I8OA 1SD4A 1N75A 1JJ6C 1IZ1A 2JWOA 5LL6R 5FKLA 1WZ2A 2GZWA 3HRTA 4Z6YA 1Z9CA 2P7CB 2JOBA 4DZPA 3RCOA 1CGPA 3MKLA 3DLAA 1N77A 2DFEA 3LMMA 1IN8A 1KA8A 2YTGA 1I3QJ 1J5EE 2IPQX 4EV0A 1BL0A 2VOPA 2UXBE 2ZMEC 2LE2A 4JI0E 1XGNA 3ASOH 2ZJQF 4FE4A 1WHQA 2GLOA 3GUDA 5B3SH 1ZG5A 1ACIA 4A3MJ 2KHXA 4NXME 2YTFA 3BPXA 3KETA 4UB8C 2JWTA 3HQ1A 2LUQA 1M1EB 1YYVA 3IP4B 1TL8A 3QOPA 2EPNA 3OYHA 4XRSA 3WTTC 3RJPA 4Q28A 2FU4A 2UV1A 1UB9A 4IHYA 1RC9A 3CJQB 3LSMA 5HLTA 4UUSB 1OISA 1ULYA 1IN7A 5A2QK 4IO9F 1UAAA 4CDGA 2IS2A 4Z2YA 3EUHC 1MDMA 4DZJA 2BZTA 2XF7A 1O3RA 4KYWA 3IWCA 2EPPA 4N9IA 1NHAA 3GTKJ 3PSFA 4M2ZA 4J00A 1QVUA 5J3LA 2ME6A 4BY1J 2RNGA 4AQYE 5ERIA 1XSDA 3S2DJ 2V6EA 3BZKA 4IOCF 1W36D 4EATA 2DOEA 4M6XA 2VE9A 2HYGD 2D2WA 2CV1A 3MWMA 1R49A 1EH6A 4PZJA 5LHGA 1AWCA 1WJDA 3WU2C 1ZLJA 1Z6TA 2CUEA 2EILH 3F3XA 2VLAA 2EOJA 2BXZA 3A01B 3OYMA 4FX4A 3F8BA 2RN7A 2A6TA 2DJIA 2E19A 3E7LA 3UK3C 2EV0A 3HSFA 1MBEA 4OAZA 5GP9A 4AWXB 3WGHA 2VQFE 2WV1A 4H4KC 1FEXA 4D5FA 1IBLE 3CCUI 4UB6C 1S6LA 1OJLA 3IRRA 4RGUA 2QKLB 4MFDA 4B3AA 2MKDA 3BQYA 2X6YA 4HZFA 4IXAA 1TP4A 2VI6A 1Z3YA 3H9QA 1H89C 1IMUA 1HKQA 1UJ8A 3L2QA 2EE8A 2IS4A 1IN4A 2EPAA 3ABTA 3C6MA 3QG5C 2RNJA 4P9FA 5DM6F 2FBKA 2P4WA 2OZ6A 2R92J 3PUFA 3HHGA 3TOBA 3RPQA 2L54A 2VPRA 2Z33A 1EH7A 1U9OA 5KL5A 5KAFC 3ZQQA 1SFUA 2E5ZA 3GFJA 4J8ZA 4BBYA 2EFNA 3RKXA 3E1SA 1FIAA 3DPUA 3I4MJ 1X3WB 4DR2E 2K3PA 1FP1D 2HGHA 5EEHA 1NK3P 4C2MJ 2R1FA 2BVMA 2Y0MA 4XKCA 1G4DA 1TWFJ 2JQ7A 2EPOA 1KYQA 1BW6A 2F4IA 3O8HA 5FKOA 2FSWA 3BIDA 4A3LJ 1LPQA 3G1MA 5DEQA 3P9CA 3REOA 4Q47A 5A69A 1ZR4A 5CFFE 4RM2A 4XOPA 1YX3A 3KYCB 3MMYB 4UUVA 2EZHA 2JXPA 1F2IG 3CUOA 1YS6A 2Q8UA 4I6ZA 2V88A 1MW7A 3HUGB 2R7WA 1U5TA 1KGSA 3DV8A 2TDXA 2LKPA 2LVSA 4RAFA 3VSKA 1K61A 1IJWC 1E3PA 4OAYA 3C4BA 2O0YA 1D3YA 1WI9A 1MMSA 3KPHA 2XV4S 3O8GA 3JRAA 3JSOA 1XCBA 2VKVA 2RREA 3K69A 1IG7A 2VQCA 5EYRA 3HOYJ 3Q0WA 2ZB9A 1JE8A 3RKQA 4E7ZA 1W36C 3H3UA 4A6EA 1Y39A 5FKMA 5ED4A 4XICA 4P55A 4OIPF 1X5WA 2EORA 2NUFA 4HQEA 4XRSG 1K7AA 1SD6A 4DV5E 4XLFA 4XLCA 3HOWJ 2IBDA 2EFPA 4HSTA 3TW6A 1HW2A 2W00A 4A3JJ 4DKKA 2K02A 4P5OA 2MGQA 3T5XA 2LNBA 1XMXA 4DYCA 5DYMA 5BNGA 1R4NB 4A0XA 1AKHA 3GTMJ 2K3FA 4BJTA 1ZRFA 5KCMA 1TC3C 3G2BA 3N05A 4CHUA 5J1RA 3LSRA 1BIBA 2M4IA 2R0QC 5JHFA 2B9DA 3BY6A 4F6NA 1J5YA 5E3MA 3MFKA 2OZUA 1FT9A 3BZ6A 1FTZA 1FLIA 2VC1A 4G6TB 3H36A 1X3ZB 2DMTA 3OYEA 2JA5J 3H5NA 4MIMA 4FASD 2LBFB 3RQIA 4DV2E 3OYLA 2ZXHA 3TQNA 4AIHA 1WWXA 4MNUA 5CLSA 2GXGA 3BBGA 4P9UA 2IS1A 3F23A 1F1ZA 3CMMA 1BR4A 4R8HA 2JZYA 1R58A 3KLOA 1UILA 2I13A 1LVAA 5DCMB 3MKYB 4ABZA 2XF5A 4AU7A 5D4SA 4P1WA 4WCGA 1QO0D 1UFMA 1B72B 4CGZA 2PX9A 1SR9A 2EPUA 1V5GA 4CCNA 1ETWA 4LD5A 2N3HA 2MLKA 4XKVA 3AG2H 4HRIA 4I7HA 2A69F 3BPVA 1I1SA 5AASA 5TGTA 3M7GA 4UXNA 1R9TJ 3SDBA 3CMAI 2KOUA 1RIOH 1JTXA 3HIFA 3MD2A 3T1HE 4YIRX 4WXDA 3PL8A 2DYRH 4K2EA 2R5YA 2M34A 2M9AA 3QODA 4CCJA 1A35A 2L9RA 1ZG3A 2Y2ZA 4RAGA 3ZN1A 5ILSA 3OYJA 4M3FA 5GAHJ 1DDNA 3TDUC 2B7TA 2V85A 2N8GA 2ZJPF 1IRFA 1PUFA 4LG0B 3M4OJ 4F9AB 3ISPA 1ONVA 1L4SA 5FLXC 4HDVA 1T0FC 4EMSA 2PRTA 3ZQGA 4DR7E 2JVGA 1T6SA 3D0SA 5CJ9A 3K4CA 2P8TA 4O43A 1SVMA 1YPNA 2NUEA 5J4YA 3PSIA 5B1AH 3G71I 1QPIA 4F54A 1MIJA 1XNRE 3SXYA 1YJNI 3GX4X 2EOSA 4BH9A 3UNGC 1G2FC 2O3FA 3B02A 3BP8A 2B3TB 3GXOA 4XK4A 1SAXA 3K4BA 2GOXB 1CF7A 5FFZA 4TV7A 5CPRB 2M3AA 1LDDA 3S32A 4IJDA 2FMYA 3MAJA 1AOYA 2QWWA 1R23A 1BN5A 2MH2A 1O3QA 3LSHA 2YPNA 4DV4E 5CQGA 5EJCA 2ZM6E 1W5CC 2BV6A 2ADRA 3VDXA 1YE9A 4QTRA 1QHHD 4UUTA 2AHQA 2M4GA 2F2EA 5AC5A 3OYKA 4LIUA 1SFKA 4I02A 3CC4I 2AQEA 4R2DA 1SFEA 5KL2A 4I2OA 3TP0A 4CZCA 1G6NA 2V83A 1BC7C 1HC8A 5AIPA 1VQ4I 1YQAA 4PSXA 2EM6A 1MMAA 1MBKA 3L09A 1IQOA 2UUAE 1ZR9A 2HOEA 3MCZA 4G7OF 2WBTA 3V8LA 2K9MA 5FLVA 3ZQCA 3S1RJ 3TBIA 4L9TA 1DU0A 4KITB 3WU1B 1VTNC 2IP2A 2F8BA 4H0EA 1HW5A 3VEPA 4BBSJ 4JX5A 4BGDA 2DQLA 1I1GA 1IO2A 1LJ9A 1XGOA 3JW4A 2LREA 1H9TA 3OS0A 3FHZA 3ERED 3BTJA 1O3SA 2EOQA 1VQLI 2PMHA 1TT0A 4XN0A 4DQ2A 2FTXB 1OFCX 2E7WA 2M4KA 2UUCE 1Y8QB 2KIUA 4WF2A 4MHGA 3IHUA 2W85A 3TGNA 4GEQB 2COMA 1FZPB 3HYIA 2L5QA 5B66C 2Y31A 4DR6E 1R5ID 3M07A 4EVIA 4BE1A 5L3GA 2EJ4A 2UU9E 4J19A 3AKZA 1RC7A 1S7EA 2ENCA 3EYIA 1J2XA 1S7AA 1D1BA 4KT5C 2JOXA 5HNFA 2VXDA 2CQNA 2DFIA 2P7VB 1XDUA 2EN3A 4JI8E 1D8JA 2GXBA 3GVAA 3JRIA 2YTEA 3DEUA 5E3OA 1Z7UA 2MC4A 5J40A 4P96A 3U1DA 2X6WA 5L3DA 1UHSA 1TZLA 1Q1VA 5FJ8J 2VT2A 2BW3A 1Z3XA 1TNSA 2V26A 3ZMDA 3MZYA 4PJ0C 4YHHE 2JPAA 1XS9A 1HLVA 3ADGA 2VPLA 2V9PA 2EQ1A 2CV2A 4KHPE 1WI3A 1XNQE 2YWQA 2FQ3A 2R5ZA 3OL3A 4EGYA 3HRSA 1KU3A 1ODDA 1BJZA 1ZGWA 3M1CA 1P2FA 3ABMH 3PM1A 3I71A 1K83J 4M9SA 2XF6A 4UNOA 1FOKA 3QU3A 3SJMA 2QGUA 5BQTA 1NG6A 2E2IJ 3IAM2 4ANJA 4OINF 1P9QC 1RR8C 2NRAC 1SD7A 1OR7C 4IEJA 1MJAA 1GV2A 2ZJ2A 1X1BA 5HDNA 1QHGA 5H2FC 2GAUA 3CCYA 2FXAA 2X9DA 3F72A 4M6VA 2QQ8A 3NWTA 1X47A 5D8KB 4DR3E 2ELZA 1EA3A 2E71A 2DAOA 5DCFA 1YI2I 4PGGA 3WTWC 1ZAAC 4KFCA 4FISA 4I0AA 4XQFA 4BDYA 4NC8A 4M73A 4A69C 4CZZA 1SEUA 3CUQA 3GCMA 2FBIA 2AXTC 1P92A 3I64A 3TO6A 3J7ZI 3AL0C 2ECCA 2QUFA 1TWAJ 2VASA 4A5MA 1K6OA 4RAYA 2CQXA 3IH4A 2DLQA 4EJWA 1B69A 2EPMX 2ADUA 2EZ6A 3IH3A 2XB0X 3SZGA 1EKZA 5FD6A 4E7IA 2A6EF 5C3EJ 3DLLF 2DO7A 3TO9A 5GTIC 3CF2A 5ICCA 2KJBA 3J7AO 4MLQA 1XB4A 5KK1A 2EMGA 2QCOA 4AD9A 5HLHA
chains in the Genus database with same CATH topology
1Q1HA 2W24A 2Z99A 4YFXF 3DP7A 1B6AA 3KZYA 2H94A 3HOSA 2K4JA 2HS5A 1B9NA 4ZH4F 1W7PB 4ESJA 3ECHA 4L0YB 3F6VA 2Z3YA 3T8RA 1G3SA 5FD5A 3RTRA 1MKMA 3C3WA 4Q48A 5FGMA 5ICGA 1S7OA 3E6CC 2IRFG 2QQBA 5E17F 2UXXA 3KFWX 1Z91A 1SMYF 2GWRA 3J81Z 1BBYA 2RGVA 2RVCA 2IJLA 2ZCWA 3JAMK 2JRTA 2KKOA 4B09A 4KDPA 1JHFA 2A6HF 3LSTA 5HLGA 4MEXF 2F5EA 2VT3A 2XUBA 1MDMB 2XIGA 2ZO4A 3M1EA 3P9KA 1GVJA 3VODA 5FO5A 4HF1A 2ACJA 1U3EM 3E5QA 3F22A 3CJNA 2UXNA 2BE5F 2LSOA 1XMAA 1KYZA 1WRJA 3WG9A 2ZXJA 4G94A 5D5UB 1YS7A 3D5LA 2F5FA 1FY7A 2CQKA 3HSRA 3WU0A 3LFKA 5ICFA 1PP7U 1QGPA 4EM0B 2RV8A 4MEYF 5JFRA 3RDIA 3SZPA 3W6JB 1R1TA 2O03A 1TNTA 4PCQA 1PDNC 2BBYA 3I4PA 3RYPA 1YLFA 2CFXA 4RGXA 3ZMZA 4YIFA 4UHTA 4LGWA 4ZZDA 4NHJA 2DTRA 3F8CA 2QBYA 2JTVA 3ULQB 5JI6A 3W6KB 4KN7X 4KNYA 3HRMA 1DPUA 4JK1X 4WXCA 5TJJA 4B8XA 2CO5A 2W57A 3QRFF 1ZRDA 2EA2A 1G3TA 1FYKA 4ZYDA 5IT9Z 5AIQA 3R0JA 5E20A 3CTAA 4L18B 2E7XA 5AONA 4KUMA 3LQRA 2FMLA 1OMIA 2L4MA 2OAZA 3EQLF 2ZMEA 3FF5A 2QYOA 2WWYA 4BHPA 5FLXZ 2MBFA 1REPC 4RAZA 1S8NA 2K86A 5L3CA 1T39A 1B4AA 3FZVA 3CLOA 2H09A 3M9AA 2JPBA 4I98B 2CG4A 5F1RA 2C6YA 2ESHA 2D1HA 1SFXA 5F64A 1XDSA 2XKOA 3E6BA 4JQFA 3E6DA 1FYMA 3NEUA 2AXLA 3J80Z 3I59A 4YFNF 1B1BA 3IKVA 1DUXC 4L5IA 1A04A 3PFIA 1BC8C 4LLNA 1ZGAA 2Y48A 2RDPA 5E8GA 2ESNA 4NQWA 5TRDA 3R0AA 2YU3A 2ZFWA 3ML6A 1F4KA 3LA7A 2OD5A 1J9IA 1H9GA 1RNLA 1J59A 3WTYC 2RQPA 3MZHA 1RZ4A 2DK8A 4M6YA 2NNNA 5H6RA 4A0YA 3WE2A 2PJPA 1QBJA 4ETSA 2E1NA 3QAHA 4YG2F 3M8FA 2HGCA 3HOTA 4EGZA 2QZ8A 3I54A 4RB3C 2PLYA 4G8XA 2E1CA 1QQIA 3WODF 4Q5SF 4IF4A 3ZPLA 2WV0A 5CVUA 2M45A 2BGCA 4A5NA 2HTJA 3KP3A 1LNWA 1H0MA 2V1DA 2DT5A 5BS6A 4ESFA 2X0LA 2OQRA 4UV8A 4LLGF 4KIBA 5K1YA 5DD4A 2K27A 2YX4A 4ZYGA 1RI7A 3M8EA 5DD8A 2HZTA 2IA0A 3TKYA 4BNCA 4HX8A 3LAPA 3WTXC 3R60A 2OA4A 1U78A 4MQ9F 3GF2A 3C7JA 1ZARA 4L0ZB 4CICA 2R7DA 4KIGA 5CVIA 1G3YA 1TLHB 2G7UA 1OYYA 2P5KA 1EV7A 2V79A 4OOIA 1RUNA 4O6JA 1UHWA 3ZMTA 2STWA 4IHSA 1ZYRF 3JTGA 4KIFA 1T38A 3L00A 3K1MA 3HUGA 4U0YA 3KP2A 1MD0A 3WTUC 1L0OC 3WE3A 1R7JA 1ZRCA 4HLXA 2Q2EA 3CUQB 4FX0A 4BAYA 1V4RA 5D6EA 4M71A 5D5XB 2UWMA 2XASA 3C18A 2IW5A 2PEXA 3MQ0A 4L9VA 4DNCA 4O3MA 3PQKA 2KRFA 1MGTA 3DPTA 4WX9A 2CW0F 4Y17A 5LLQA 3F6OA 5LBQA 5DUKA 1FP2A 5LGTA 1FWZA 5DDGA 3K2ZA 3QPTA 1T98A 3WGGA 2J5OA 1XSVA 5CVJA 1KU7A 4YFKF 3IKTA 3IWFA 1P4WA 3KZZA 5ILVA 1ON2A 1O57A 4HLYA 3KP6A 4KMUX 2NAZA 2FOKA 1LEAA 3E5UA 2VBWA 3Q9VA 3FX3A 2HTSA 2IA2A 4G7HF 2ISYA 2MC3A 5A2QZ 4KMFA 4ENMA 4IJAA 2XAQA 3ZMUA 1L3LA 4GYGA 2VN2A 4ON0A 1IF1A 2DLLA 4EJTA 3HRUA 4IVNA 4KN4X 2OU2A 1FPQA 2KJCA 3BOQA 4LG0A 4AVPA 2EFQA 4ENKA 2A61A 4LLLA 1HSJA 3QP6A 2HYFA 2XROA 3I53A 2FNAA 3O6BB 3I58A 4HX7A 2HQRA 4O5VA 1KU2A 2EFOA 5HVQC 2DPDA 1JHHA 3V8KA 1RUOA 4HDUA 1T2KA 1S29A 2CGPA 3GFMA 1U6GA 4I09A 5HLIA 2JT1A 4LB5A 4OIRF 3BJOA 3GEZA 4HYEA 5HOOA 3GFIA 4LMYA 1W7PD 4WXHA 1IXCA 4I0BA 2V6CA 3DFGA 2MLGA 4BXUA 2VC0A 3KP5A 4G6QA 4I01A 4IRHA 1WSUA 3BJ6A 2HKOA 3VB2A 4PDKA 2O6GE 1W4MA 3H3ZA 3U9GA 3C1DA 4LFUA 4PGHA 2PI0A 3EYYA 1FX7A 5FB2A 2NS0A 3FMRA 1R5GA 2ETHA 3K9TA 3N4MA 2K4BA 1HW1A 5E1ZB 1FSHA 5L3BA 3VFZA 4G9YA 3IC7A 3HHHA 3P7NA 3LWFA 4EJUA 2L01A 3ECOA 3GO5A 5KVRA 1HBXG 3ZQ7A 2V9VA 2M1BA 3FMSA 2W84A 4R1HA 4XSZF 1XCVA 1Z6RA 4L5JA 1R22A 2G9WA 2HQNA 3LA2A 2EV6A 1FC3A 2MA3A 2YX7A 3IWZA 4L9NA 1XMKA 5HS9A 4A0ZA 3F8FA 1GHCA 2H6CA 4FT8A 3TO7A 1MZBA 4MGRA 1ZHFA 3I5UA 1KQ9A 2PMUA 1E17A 1IW7F 2A68F 2HFHA 5D4RA 1W5SA 4M72A 5E18F 5D5WB 1B9MA 3KEQA 4XSXF 3I59B 2DW4A 5FFXA 4CXFA 2HR3A 2HWVA 1ZLKA 2YR2A 4M9ZA 5L3FA 4G6DA 3ZMVA 1U5TB 2VBXA 1XGSA 1MJ9A 2UZKA 5LEJA 2PBIA 5LEKA 3GFLA 2M8EA 3ABUA 2O8XA 1SD5A 2P6SA 1YW8A 4UV9A 2LDUA 2YSRA 4GCVA 1S3JA 4HW0A 1WQ2A 1WKMA 1R1UA 1GXQA 2KIMA 3S2WA 2X4HA 3HTUA 3RYRA 2VE8A 3K1NA 2L02A 1QNTA 2K7LA 3KP7A 5DV5A 5JHUA 2ZNYA 2VODA 4HQMA 3H92A 1ON1A 3QU6A 2HEOA 4IRIA 2PQ8A 2VBZA 3L9FA 2ELHA 3BWGA 1J7KA 3PQJA 3F21A 2Z9OA 4HF2A 5CVVA 4AIJA 3ROUA 3U2RA 4M74A 1D8KA 4EJOA 4BQAA 3JSPA 1BI1A 1J75A 3NRVA 4N0BA 1R1VA 4CO8A 4E70A 5BPIA 4F7ZA 1QZYA 1QZZA 2B0LA 3SQNA 3FM5A 1P4XA 3K0LA 1FBSA 3LQQA 4RB0A 3SHFA 2GA1A 3HTSB 3LAJA 1HXDA 1K78A 3FM3A 1PUEE 3OV8A 4HV5A 1STZA 2EK5A 3EUHA 5HDGA 4XLNF 5LHHA 1I27A 2EJRA 1U5TC 2IVMA 3E5XA 1LQ1A 1O7LA 2Y75A 4YIIA 1IUYA 1QPMA 1YTYA 5BMZA 4WWCA 1IN6A 3VOEA 1XSXA 2QLZA 2LF8A 1U2WA 1V3FA 1B59A 3WTSC 2A3SA 2F5CA 4D0PA 1BI3A 2EFWA 2O61A 2WTEA 1SMTA 1PP8F 1BM9A 1R36A 4S04A 3CO6C 3WTZA 3DQVC 1CF7B 1OYIA 2J5PA 3DPLC 1BIAA 2CSOA 4LB6B 1ZREA 4RGRA 1LDKB 5HDKA 3K1PA 4GYIA 4QLCU 1YO5C 1P4AA 3MEXA 1YFHA 2MD5A 3GLXA 4A12A 4OIQF 4U7BA 4UVAA 3WGIA 3KE2A 4U0VA 1X3UA 3QPHA 1ZGJA 4IHTA 4ESBA 2VONA 1YG2A 1W5TA 1ZN2A 3J81K 4JBAA 2XGXA 5J8FA 2STTA 1HSTA 1K79A 3DKWA 2FE3A 5L3EA 5JVTA 3KLNA 2GQQA 3L7WA 1XN7A 2P6TA 2NYXA 4BYYA 1ZAOA 3F8MA 1F9NA 4MTEA 3GZ6A 2BEOA 1HQCA 3KEOA 2V1XA 1EH8A 3LA3A 1OPCA 3JAMZ 4ZYHA 1TTYA 3WTVC 3R61A 5HS8A 4N9HA 1DPRA 3ZMSA 3T8TA 4R79A 2EV5A 4OMYA 2HKXA 2R7FA 3ELKA 3QP5A 1LDJA 2GIVA 3Q9SA 2HDCA 3V4GA 5LRRA 2DBBA 2OBPA 1BI2A 2DI3A 3Q5FA 4ZYEA 1LB2A 4HX4A 5LGNA 2FEZA 5F6FA 3RIRA 4HAMA 2XAHA 3DXJF 1Y0UA 5K5OA 1KYWA 3V8JA 1XGMA 4U88A 4A2UA 3P9IA 3B73A 4XRFA 4ZZLA 5JR3A 1UHMA 2F5DA 3ZN0A 2IA1A 1R5HA 3GW2A 4OIOF 2P5LC 1I6XA 2Q0OA 1TQPA 1ZG1A 3E97A 3GWZA 5K5QA 4U7DA 1T0FA 2A5YB 1P6RA 2QQ9A 4U0WA 2H6BA 2XAFA 1Z05A 6PAXA 5LHIA 2LF7A 1OYWA 3RKYA 4HOBA 2OQGA 2Z5UA 3G3ZA 4EM1A 2NNYA 3N97A 4RGSA 5H6QA 1USTA 4ENNA 4GO1A 5D5VB 4OU0A 2QM3A 5H20A 5LRSA 1FBUA 3NQOA 2RKHA 1IRGA 2FBHA 5IT9K 3RPUA 3IRQA 1IAWA 3V7RA 2Q8KA 3DF8A 2D1VA 4WK8F 3HSEA 2DQRA 1UCRA 4NB5A 5D8LB 5DCMA 4RS8A 1KQ8A 3E6MA 5E1WA 5CYVA 3AAFA 2EA4A 5FLXK 2CYYA 4HF0A 1IXSB 2ZKZA 5ILUA 2XAJA 4AIKA 4CYDA 1KQ0A 3CUQC 3O3KA 2XAGA 1LEBA 3OOPA 4HBLA 1TW3A 2M5WA 1F5TA 4S05A 3GZ5A 3R4KA 2XRNA 1BJAA 4KA4A 3V7CA 3F8NA 1OKRA 4XBFA 3J80K 4G7ZF 4RB1A 4M9XA 1YW9A 2VOOA 1HKTA 2EWNA 3KP4A 3GYHX 2ZBKA 4BHBA 1G3WA 5LGUA 3CO7C 1BI0A 1J0RA 2FNPA 2FRHA 4LJZF 4ASNA 4HA8A 3BJAA 2PG4A 4EJVA 2JSCA 2WC2A 4Y15A 4Y13A 2DK5A 2L3DA 2H27A 2FF4A 1TQMA 4MQVA 5DUIA 4RB2C 2ISZA 3KCCA 3CDHA 3L2CA 3BDDA 1OR7A 4L9JA 2CWEA 2XHKA 1FBQA 4UVBA 1FSEA 2RC4A 5HS7A 2QQAA 3V7SA 2ZNZA 4IPAA 3SFZA 2D45A 1ZH5A 2XKPA 2VBYA 1FNNA 4HV6A 3T1BA 3FMQA 2EB7A 3RI4A 2QBYB 4QWQA 4BHCA 1IXRC 5BOXA 2PN6A 1I5ZA 4A6DA 5K5RA 1FYLA 2FA5A 1IN5A 4LK0F 5D6FA 3I0TA 2V1UA 1BOAA 4LK1F 1MJBA 5E1XA 1TQIA 5ICEA 1O7FA 1KU9A 3SZTA 3FXRA 3FWEA 3RKWA 4KICA 2VXZA 5J8CA 1DP7P 1GXPA 3T0YA 2QVOA 2AS5F 2BYVE 2KIFA 1O3TA 2L4AA 2QENA 1YIOA 2DPUA 4GGGA 2ZMEB 1TBXA 1USSA 3COAC 1U8RA 4EQQA 1JXSA 4OMZA 3R6SA 3ZP5A 2JPCA 2DU9A 3O2PE 2M30A 1K78B 2G7HA 1HKSA 3BROA 4GXOA 2W25A 4FHTA 4Q4ZF 2M87A 2GA2A 1TW2A 2P5VA 4MTDA 2R3SA 3JTHA 1R00A 2XVCA 3FXQA 3TDZC 4XLPF 5BPDA 5CVRA 4IRGA 5J6XA 1YW7A 4ENJA 2IT0A 2MH9A 2YPRA 5EEGA 2PFBA 5E8IA 1JGSA 5IT3A 1E2XA 3FXUA 1D5VA 2A07F 4EM2A 1Z1DA 3TOAA 3G73A 3E3VA 4UVCA 3EETA 1C0WA 3IL2A 1W7PA 1XD7A 3EDPA 1SD4A 1IZ1A 2GZWA 3HRTA 1Z9CA 2P7CB 1CGPA 1IN8A 1KA8A 2IPQX 4EV0A 2VOPA 1XGNA 3GUDA 1ZG5A 3BPXA 3KETA 1YYVA 3QOPA 3WTTC 3RJPA 2FU4A 1UB9A 1ULYA 1IN7A 5A2QK 4CDGA 4Z2YA 1MDMA 1O3RA 4KYWA 4N9IA 1NHAA 5ERIA 1XSDA 4M6XA 2VE9A 2HYGD 2D2WA 3MWMA 1EH6A 4PZJA 5LHGA 1AWCA 1ZLJA 1Z6TA 3F3XA 4FX4A 3F8BA 2RN7A 2EV0A 3HSFA 4AWXB 3WGHA 1S6LA 3IRRA 4RGUA 4HZFA 4IXAA 1HKQA 1IN4A 3ABTA 2RNJA 4P9FA 2FBKA 2P4WA 2OZ6A 3HHGA 3TOBA 3RPQA 2L54A 2Z33A 1EH7A 1SFUA 3GFJA 2EFNA 3RKXA 1FP1D 5EEHA 2Y0MA 1G4DA 2FSWA 5DEQA 3P9CA 3REOA 4Q47A 4UUVA 3CUOA 1YS6A 1U5TA 1KGSA 3DV8A 2TDXA 2LKPA 2O0YA 1D3YA 1WI9A 2XV4S 3JSOA 1XCBA 3K69A 1JE8A 3H3UA 4A6EA 5ED4A 4P55A 4OIPF 4HQEA 1K7AA 1SD6A 2EFPA 1HW2A 2K02A 4P5OA 3T5XA 2LNBA 5DYMA 4A0XA 1ZRFA 4CHUA 1BIBA 3BY6A 1J5YA 3MFKA 2OZUA 1FT9A 3BZ6A 1FLIA 2VC1A 3TQNA 4AIHA 1WWXA 4MNUA 5CLSA 2GXGA 4P9UA 3F23A 1F1ZA 4R8HA 2JZYA 1R58A 3KLOA 1LVAA 5DCMB 5D4SA 4WCGA 1QO0D 1UFMA 4CGZA 4LD5A 2MLKA 1I1SA 4I7HA 2A69F 3BPVA 3M7GA 4UXNA 1RIOH 3HIFA 4WXDA 4K2EA 1ZG3A 3ZN1A 5ILSA 1DDNA 3TDUC 4LG0B 1IRFA 3ISPA 1ONVA 4HDVA 4EMSA 1T6SA 3D0SA 5CJ9A 2P8TA 3SXYA 3GX4X 4BH9A 2O3FA 3B02A 3BP8A 3GXOA 1SAXA 1CF7A 5FFZA 4TV7A 1LDDA 2FMYA 3MAJA 1AOYA 2QWWA 1R23A 1BN5A 2MH2A 1O3QA 2BV6A 2F2EA 4I02A 1SFEA 4I2OA 1G6NA 1BC7C 5AIPA 1YQAA 3L09A 2HOEA 3MCZA 4G7OF 3V8LA 4L9TA 1VTNC 3WU1B 2IP2A 4H0EA 1HW5A 3VEPA 2DQLA 1I1GA 1LJ9A 1XGOA 3JW4A 1H9TA 3FHZA 3ERED 1O3SA 2PMHA 4DQ2A 2E7WA 2KIUA 4WF2A 4MHGA 3IHUA 2W85A 3TGNA 2COMA 1FZPB 3HYIA 4EVIA 5L3GA 3EYIA 1J2XA 1S7AA 4KT5C 2DFIA 2P7VB 1XDUA 1D8JA 2GXBA 3GVAA 3DEUA 1Z7UA 4P96A 3U1DA 5L3DA 2VT2A 1TNSA 3ZMDA 3MZYA 2FQ3A 4EGYA 3HRSA 1KU3A 1ODDA