1T39A

Human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
151
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3'
publication title DNA binding and nucleotide flipping by the human DNA repair protein AGT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 30
structure length 151
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t39A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1t39A01
4BYYA 1O7LA 4HYEA 3KZYA 4G7OF 4HV5A 2DI3A 2FEZA 3J7AO 5IT3A 3R4KA 4KMFA 2M45A 2DBBA 3VEPA 4N9IA 3LA7A 4GGGA 1FYKA 1ZG5A 4UHTA 1QZZA 5J8CA 3CDHA 1X3UA 1D8KA 4EM1A 2HQNA 2EFNA 3RKYA 4DQ2A 1LQ1A 2F5CA 1QBJA 1IN4A 1DPUA 2EJRA 4PCQA 1S8NA 1WWXA 1OYIA 3E5XA 3RDIA 1E2XA 1JXSA 5DD8A 4EV0A 3IC7A 2A5YB 4ESBA 4AD9A 3ZMDA 5AIPA 1OYYA 2XIGA 4M9SA 3CTAA 2O8XA 1R1TA 1UCRA 3HHHA 4G8XA 4L0ZB 2PMHA 1R5GA 2MH2A 2VOPA 3F8BA 4L5IA 4CHUA 2K4JA 1YLFA 1TLHB 1ZLJA 1G4DA 3I64A 4HW0A 2EA4A 3JSOA 3TDZC 2DK5A 3ZN0A 5E1ZB 2IVMA 4IHTA 1KU7A 2RQPA 4I0AA 5KVRA 3LSTA 2HKXA 4CYDA 2QENA 3FZVA 3JTGA 1MDMB 1STZA 1Z6TA 2CG4A 4O3MA 2L3DA 2D1VA 3VODA 2DW4A 3J81Z 2QM3A 1UHWA 3J80K 2QQ9A 4UV8A 3ROUA 4EVIA 2ZNZA 4HBLA 4LG0B 4KIFA 1USTA 2PJPA 4E70A 1T98A 1QQIA 2CYYA 3HOSA 4HDVA 4YFKF 1FP2A 3KP2A 5L3GA 1IZ1A 2Q2EA 3DXJF 3BOQA 3F6VA 3M8FA 2PQ8A 4OIPF 2YR2A 2NRAC 3IRQA 1Z1DA 1EH8A 3CUQA 1YW7A 1YFHA 3H3UA 3FXRA 1FY7A 3F8NA 1HW5A 1T0FA 3MZHA 2VE9A 3V7CA 1BJAA 5A2QZ 4I09A 3F23A 5HVQC 5LGUA 4M6YA 2XVCA 4YG2F 1G3WA 1G6NA 3TGNA 3ECHA 1P4WA 2ISYA 1LDKB 2BYVE 2OZUA 4EMSA 2GAUA 4HQEA 1TQMA 2MLGA 3ZMSA 5K5QA 4S04A 5BOXA 5FD6A 1TTYA 3O2PE 2CQKA 5CJ9A 4I98B 2XKPA 3RPUA 2Q8KA 5LRRA 4M72A 3CUQB 4GO1A 1ON1A 3I58A 1DUXC 4P9FA 3DPTA 1Z6RA 3F6OA 3MAJA 3EDPA 4M74A 1ZAOA 3ERED 2NAZA 3C18A 2GIVA 1IRFA 3F8FA 3V7RA 2GZWA 2P7CB 2VT3A 5DCMB 1I1GA 3WTSC 3W6JB 1T38A 5K1YA 3DFGA 2Y0MA 3JTHA 2F5FA 4DNCA 1S7OA 3GWZA 5JHUA 2IP2A 5FB2A 1WRJA 3HRUA 3JAMZ 5BS6A 1O3SA 4YIFA 1V4RA 3QAHA 4GYIA 3QPTA 4M71A 1IN8A 3HTSB 1D3YA 4K2EA 2E7XA 3WU1B 3CO6C 4WCGA 3MZYA 1ON2A 3T0YA 3EUHA 4O5VA 2UZKA 4S05A 4OIQF 2IT0A 5J8FA 4MHGA 1P4AA 3V4GA 2FNPA 3KE2A 5E1WA 1B9NA 2ISZA 1BI0A 1R36A 1KYZA 2VT2A 2FOKA 5DUKA 1R1UA 3HOTA 2V9VA 3ZMUA 4ZZDA 2LNBA 2OAZA 3I59A 1BC7C 1GHCA 3QP6A 1KU2A 5DV5A 4ZYHA 1KU3A 1W5TA 4M6XA 2LF8A 1T39A 2VBZA 3BZ6A 4KFCA 2ZNYA 3WGHA 1ZN2A 2EFWA 3R61A 2EFOA 2P4WA 2IA1A 1K7AA 3HUGA 5ICEA 1FT9A 2G7UA 5CVJA 5E8GA 2FBIA 4LLNA 2FNAA 2DK8A 2QQAA 1I1SA 3SZPA 4PZJA 1FSEA 2JRTA 3I71A 2GQQA 4RB3C 4ENJA 4HA8A 4M9ZA 4M9XA 2O03A 1YTYA 2R7FA 2M5WA 3ABTA 1ZYRF 2EB7A 1CGPA 4FX0A 2L4AA 2FRHA 2DPUA 4FX4A 1MJBA 2A07F 1RIOH 3WTTC 3KFWX 4HX4A 3WTWC 2JPBA 2P5KA 4L0YB 5LGTA 1ZH5A 5LBQA 5IT9K 3CLOA 2H6CA 1SFXA 2ADUA 3P7NA 4LFUA 4BHPA 2J5OA 3LQQA 4WF2A 4AIKA 3P9IA 2DFIA 4PGHA 2HR3A 2FXAA 2M1BA 2MBFA 3GO5A 1RUNA 3KP5A 2DT5A 3TO7A 5DD4A 2DU9A 2KIFA 5ERIA 1H9GA 2FE3A 4IXAA 1YS6A 4G7ZF 3M9AA 1GXPA 1V3FA 2H6BA 5F1RA 3DPLC 4RGUA 4XBFA 3TKYA 3QU6A 2F5DA 2IW5A 4N9HA 4ZZLA 1Z91A 4P96A 4Q47A 4UVAA 5L3BA 1ODDA 1IXCA 1TBXA 2R7DA 2CGPA 1J9IA 4WK8F 2YX7A 1FBUA 2OA4A 2FBHA 2Y75A 1FBQA 2V1DA 1LVAA 3MWMA 3WTUC 2IPQX 3GXOA 1BIBA 3GF2A 2LSOA 2XAGA 3FMRA 3WTZA 1T2KA 3E3VA 4EGZA 3GEZA 2M87A 2Z3YA 1XGNA 3FM5A 4HDUA 2R3SA 3WTVC 2Z9OA 3JAMK 3TOAA 3MFKA 4CDGA 1BOAA 2XROA 2MH9A 5FGMA 4R8HA 1F9NA 5D8KB 1QGPA 1IN5A 4EGYA 4UUVA 3I54A 1LNWA 5L3EA 4WX9A 3K2ZA 1KQ8A 2QZ8A 4A0XA 3K9TA 4I01A 1ULYA 3HSFA 1KQ0A 2ZMEB 1IW7F 4CGZA 5JFRA 5JI6A 3DEUA 2WV0A 4MEYF 3OOPA 3F3XA 4MTDA 1LDDA 5FFZA 2EFPA 3ECOA 3F21A 2VBXA 3BJAA 1MDMA 1FX7A 4MEXF 3TOBA 1U5TB 1B9MA 3BY6A 1YW9A 1WSUA 4XSZF 1R00A 4A12A 4Y15A 2OZ6A 5E1XA 2PI0A 1SD5A 4KN4X 3BPVA 1HW1A 4H0EA 1O7FA 2P5LC 4RB2C 2XAQA 4LG0A 2EK5A 3KCCA 1XMKA 1LJ9A 1YW8A 1RZ4A 2L01A 2P6TA 1U78A 2K02A 4WXCA 4KICA 2ZJ2A 5BPDA 1CF7B 5CLSA 1I27A 3HYIA 1ZHFA 2ZCWA 2HWVA 5ED4A 1JGSA 5FLXK 4YFXF 3K1PA 1AWCA 2AS5F 3W6KB 1YIOA 1PP8F 1WKMA 3CUOA 1UFMA 4A0ZA 2GA2A 3JW4A 4FT8A 3RIRA 4A5MA 3DKWA 2GWRA 3VB2A 3LWFA 1IUYA 2TDXA 3RYRA 2EV5A 3KLNA 4CZZA 3QRFF 1BN5A 5DYMA 2JT1A 3RJPA 3BJ6A 4I2OA 3GVAA 4BHCA 5CYVA 4A6DA 4WXDA 4Z2YA 1L0OC 1MJ9A 3ZP5A 3HHGA 2Z99A 3HSEA 1HKQA 3HRMA 2H94A 1W7PB 1L3LA 3Q5FA 4UNOA 3GYHX 1R7JA 1J7KA 1GVJA 4MNUA 3CJNA 2VBYA 3K1NA 2FF4A 2Q0OA 1W5SA 1F5TA 4RGSA 5EEHA 4U7DA 1LDJA 4GCVA 1SMYF 4MTEA 1FWZA 1QZYA 2DPDA 1SFEA 1VTNC 5CVRA 3D0SA 2H09A 4BHBA 1FC3A 4HOBA 4I7HA 5DCMA 2L54A 5CVIA 3BDDA 2D45A 2KJCA 5HLGA 4B8XA 1QNTA 1PP7U 1JHHA 3T8TA 3V8KA 1Z7UA 2A3SA 4ZYGA 4KA4A 1BBYA 3M7GA 5HDKA 2HZTA 1USSA 3TO9A 1BM9A 5D5VB 3GFLA 4LLLA 3E5UA 4HLXA 5LHHA 3KEQA 3VOEA 1A04A 2F2EA 2V1UA 2DAOA 1MGTA 1ZGAA 3IRRA 3RYPA 4EJWA 4U88A 2Z33A 4KUMA 4JQFA 1RI7A 3HRTA 1ZRFA 1IF1A 2EV6A 3CUQC 1K78B 1C0WA 3ZMTA 2MA3A 3Q9VA 3GZ6A 1YQAA 1TQIA 4XLPF 1JE8A 2JZYA 1IXRC 1J5YA 2XAFA 5D5WB 3MEXA 5TJJA 2DLLA 3BP8A 3ZPLA 2FBKA 3LAJA 3HSRA 2DQRA 4B09A 4RAZA 1DP7P 4KNYA 3GUDA 2J5PA 1R5HA 5F64A 1J2XA 4HQMA 3ZQ7A 3FXUA 3RKWA 1XGMA 3ZMVA 3FX3A 1XD7A 4IJAA 2BBYA 2FMYA 1XN7A 2ELHA 4EM0B 5HLIA 1REPC 3V8JA 2W57A 4WXHA 2ZO4A 2L02A 2DTRA 4AIHA 4LK1F 4IF4A 3WTYC 3C1DA 4HX8A 3D5LA 4RB0A 2RV8A 4Q4ZF 2K4BA 2LDUA 1HKTA 4OIOF 2FA5A 3VFZA 1OPCA 1G3SA 2E1CA 2KIMA 3KP3A 5DEQA 1G3TA 5L3DA 1OR7A 2CSOA 3TQNA 2A6HF 1LEBA 3KP4A 2XAJA 1H0MA 3EQLF 4HF2A 3HRSA 4ZYDA 4LLGF 1IAWA 1SFUA 2Y48A 3Q9SA 5ICGA 3L09A 3N4MA 4LD5A 5E8IA 4OINF 3F22A 2HTJA 3L9FA 1R1VA 4IRHA 2NS0A 3GX4X 1EV7A 5DUIA 3T8RA 4XLNF 1BIAA 1B1BA 1RNLA 3T5XA 2WC2A 2NNNA 5HDNA 2K27A 3J81K 4G94A 1ZREA 4OIRF 2XHKA 1DDNA 3JSPA 2EV0A 4XSXF 3GLXA 2HDCA 3IWFA 2XAHA 4OMYA 1FBSA 2VONA 2X4HA 4CO8A 2RGVA 3NEUA 2YSRA 4L9TA 1BI2A 2W25A 2VXZA 2PFBA 5CVUA 1YG2A 3M8EA 3ZN1A 5JR3A 4BNCA 4P5OA 2CO5A 1DPRA 2ESNA 4HLYA 3WE2A 4KYWA 3FXQA 1SAXA 4LGWA 1HKSA 2ETHA 5A2QK 1E17A 2LF7A 3K69A 3WTXC 5F6FA 1NHAA 1F1ZA 4HAMA 3S2WA 5HDGA 5LRSA 4GYGA 4UXNA 3GFIA 1EH6A 4KIBA 2HTSA 5LEJA 2HYGD 2V79A 3GFMA 3SQNA 1RUOA 4LB6B 2QUFA 3J80Z 3RTRA 5LEKA 3DF8A 2Z5UA 3E6CC 3KEOA 4G6DA 1Y0UA 3WE3A 4XRFA 2EWNA 4IVNA 3KP6A 4IRGA 4EJUA 2JPCA 1MZBA 2PBIA 4ESJA 5TRDA 3KP7A 2STTA 1S29A 2UWMA 2QBYB 4RB1A 2G7HA 5H6QA 4AWXB 4Q5SF 2OU2A 4ESFA 1B6AA 3K0LA 2UXXA 4HV6A 3L2CA 2GXGA 3EETA 2JTVA 1U8RA 1FYLA 2VBWA 4UVCA 3SHFA 3F8CA 1SD7A 5BMZA 2VC1A 2V1XA 2L4MA 4P9UA 2ZMEA 4IRIA 1P2FA 4MGRA 3U1DA 4MQVA 3BJOA 4HX7A 3E5QA 3LAPA 4U0YA 3REOA 5J6XA 1FLIA 4BH9A 1HSJA 1U5TA 2D1HA 2PN6A 3IHUA 2RDPA 2LKPA 5HS8A 2ACJA 3HIFA 5D8LB 4NQWA 2B0LA 2FQ3A 6PAXA 4G6QA 4CICA 2ESHA 2MC3A 3IWZA 3PQJA 5D5UB 4EJTA 4I02A 4LMYA 2M30A 1KQ9A 1R58A 3BROA 4A5NA 3IKTA 1BI3A 3L00A 5ICFA 1T6SA 4A0YA 1CF7A 2BEOA 5LHGA 5D5XB 2NNYA 1YO5C 2PLYA 1Z05A 1I5ZA 2ZXJA 5L3CA 4G9YA 1W7PD 4LJZF 5LGNA 2C6YA 2O6GE 2BV6A 4HF0A 4KN7X 1XDSA 2FMLA 1XDUA 1KYWA 3PQKA 2P6SA 4YFNF 4HF1A 2EFQA 3B73A 1LB2A 3FMSA 2XKOA 4D0PA 3H92A 4N0BA 4M73A 1KGSA 3M1EA 1J75A 1LEAA 2QLZA 5K5RA 3C7JA 4EM2A 1WI9A 2CW0F 4MQ9F 4OOIA 1U5TC 3E97A 3WG9A 3FWEA 3WODF 3HTUA 1TQPA 4GXOA 2IJLA 3F72A 1B59A 1W7PA 2G9WA 2XUBA 1UB9A 3V8LA 4ENNA 4FHTA 2X0LA 2HFHA 3COAC 3IKVA 1W4MA 2QVOA 1KA8A 1EH7A 3R0AA 4AIJA 1HBXG 2VC0A 2KJBA 3MCZA 1XGOA 3DQVC 3LQRA 2IA0A 3N97A 3I5UA 1QPMA 2VOOA 3QPHA 5D4SA 4ZYEA 2RKHA 3ML6A 1XSXA 3QOPA 4OMZA 2OQGA 1MKMA 2RC4A 5K5OA 1XSDA 2STWA 3MQ0A 4R1HA 2QWWA 3H3ZA 5HLHA 2HQRA 3E6MA 4U0WA 2P7VB 4JBAA 5H6RA 4ASNA 5D4RA 2HGCA 3SZTA 2IA2A 4BAYA 1FYMA 1U6GA 1FNNA 3I0TA 3NQOA 3R6SA 4Y13A 4G7HF 1S7AA 2RNJA 2A6EF 2EA2A 4A6EA 3P9CA 1IN6A 3KLOA 3FHZA 1K6OA 5ICCA 1Z9CA 1ZARA 2YU3A 4U0VA 2K7LA 4RGRA 4A2UA 1K78A 5ILSA 2HKOA 1G3YA 1UHMA 5H20A 4UV9A 1P6RA 5IT9Z 5AONA 4EJOA 2A68F 4L9VA 1FOKA 3WGGA 2A69F 5D6FA 1S3JA 3F8MA 4EQQA 3E6BA 5DDGA 2KKOA 3DV8A 2CFXA 3GZ5A 5LLQA 3ELKA 1O3RA 4WWCA 3I53A 3R60A 4ETSA 2OQRA 1HW2A 5ILUA 2H27A 2WWYA 2BGCA 2V6CA 1OYWA 2FSWA 4NB5A 5EEGA 1HXDA 2MD5A 1YS7A 3R0JA 2NYXA 1R22A 2RN7A 3SXYA 1XGSA 2HEOA 1AOYA 2F5EA 1B4AA 1FSHA 3L7WA 3LA3A 2BE5F 2COMA 1O57A 1IN7A 5FD5A 4TV7A 3BPXA 1JHFA 3RKXA 1J59A 3IL2A 1D5VA 1WQ2A 1TW3A 1SD4A 1F4KA 1K79A 2JSCA 1BC8C 1OKRA 2GXBA 2P8TA 1H9TA 1TNSA 3U2RA 3ZMZA 4Q48A 3RPQA 4KT5C 4L5JA 5HOOA 2IRFG 1XCVA 2FU4A 3GFJA 2XGXA 1R23A 4OU0A 1ZLKA 1SMTA 4O6JA 4RAYA 1TNTA 3OV8A 3I4PA 1OMIA 1PUEE 4AVPA 1BI1A 3WU0A 1HQCA 5BPIA 3NRVA 2YPRA 2P5VA 2K86A 1KU9A 3EYYA 4RGXA 1XB4A 4QLCU 3QU3A 5ILVA 1ZRCA 3O6BB 3T1BA 2MLKA 2ZKZA 5LHIA 2UXNA 1MD0A 3U9GA 4ZH4F 2O61A 2VN2A 2D2WA 1ZGJA 4KMUX 5L3FA 1TW2A 3O3KA 3AAFA 2W24A 1I6XA 2ZFWA 3SFZA 5AIQA 1XMAA 2XASA 5E20A 4F7ZA 3E6DA 2OD5A 3G73A 3ISPA 3TO6A 3ULQB 4LK0F 4L9JA 4QWQA 2GA1A 4ENMA 2PEXA 5FFXA 1GXQA 3EYIA 2E1NA 1U3EM 5HS9A 3FF5A 4Y17A 4BQAA 3FMQA 2W85A 2WTEA 3KETA 4R79A 3DP7A 1ZG3A 4PGGA 5CVVA 1D8JA 2QBYA 3CO7C 2YX4A 5FLXZ 1QO0D 3I59B 4JK1X 2DQLA 1MJAA 4ENKA 1XSVA 5E18F 4UVBA 2M8EA 2XRNA 4KDPA 3QP5A 4L9NA 4L18B 2HS5A 3C3WA 1O3QA 5HS7A 1ZRDA 2KIUA 2O0YA 2E7WA 5E17F 1P92A 1S6LA 4LB5A 2HOEA 4YIIA 2VE8A 2AXLA 3BWGA 5FO5A 1HSTA 1FP1D 2CWEA 2O3FA 4PDKA 2XV4S 3WGIA 2HYFA 3G3ZA 1FZPB 2PG4A 1IRGA 2VODA 1ZG1A 4ON0A 4I0BA 2OBPA 1ONVA 3LFKA 1YYVA 1Q1HA 1IXSB 4RS8A 4P55A 2ZBKA 3LA2A 2DO7A 4EJVA 4CXFA 4BXUA 2RVCA 4HZFA 5DCFA 1P4XA 1J0RA 3V7SA 2KRFA 3TDUC 1U2WA 2A61A 1SD6A 3K1MA 4NHJA 2QQBA 3P9KA 3ABUA 3FM3A 3RI4A 2QYOA 2W84A 2PMUA 1FPQA 1XCBA 3GW2A 3PFIA 5BQTA 1PDNC 1O3TA 3B02A 5JVTA 4IHSA 5D6EA 4KIGA 3KZZA 4U7BA 4IPAA 5KK1A
chains in the Genus database with same CATH superfamily
2LH9A 4BYYA 3BIDA 4XKWA 5TSEA 1O7LA 2YU5A 4HYEA 2VE7C 1PVEA 3KZYA 3S15J 3DTIA 4G7OF 4HV5A 2DI3A 3G1LA 1IBME 2XF7A 2YRHA 1PJSA 3H09A 3CDIA 2FEZA 5DTDA 3J7AO 4M0VA 4ITVA 4CH7A 5IT3A 4KITB 3HOVJ 3R4KA 4KMFA 2M45A 2DBBA 3VEPA 2PJRB 4R2CA 4DV4E 1A31A 1UZCA 3LA7A 4GGGA 4N9IA 2JXPA 2O8KA 1UHZA 2CSHA 1FYKA 4RH8A 1ZG5A 3W6VA 4UHTA 1PJQA 4FASD 1EA3A 1SAUA 2K9MA 4MLQA 1QZZA 3AFHA 5J8CA 3BR2A 3OWTA 3CDHA 1X3UA 3SEQA 2R92J 5T6JA 1D8KA 2F4IA 2ME0A 2W4SA 2R7OA 4EM1A 2HQNA 2EFNA 3RKYA 4DQ2A 3OMLA 4DV1E 4WFTA 5F0HA 5KL6A 1GUUA 1LQ1A 2F5CA 4ZC3A 1QBJA 5LFAA 1IN4A 3OYLA 4II2A 1DPUA 2EJRA 4PCQA 4P78A 5IT9C 3OSGA 1S8NA 2LP0A 2NVTJ 1WWXA 1OYIA 2MW8A 3E5XA 3ECRA 3O8GA 2L7FP 3PO3J 3RDIA 2EIMH 3QYBA 1ZR4A 2JSPA 4K0KE 1E2XA 1X4PA 1GT0C 1TF6A 1JXSA 5DD8A 2GOMA 3CMAI 2UUZA 2UUAE 4EV0A 3CJQB 3IC7A 2BXZA 2ZC2A 4UUSB 4L5EA 3HQ1A 2A5YB 3L2VA 1NCSA 4ESBA 4AD9A 3BGHA 2EN8A 3ZMDA 2XB5A 5AIPA 4XL9A 1OYYA 2XIGA 4D7MA 4BE1A 1AH5A 4UUTA 2XSDC 2VPLA 4M9SA 3N05A 1L4SA 1FJLA 3CTAA 2LY1A 2O8XA 2E72A 4CCLA 1R1TA 1UCRA 2KFDA 3DLAA 2EPFA 5GPCA 4IX7A 3IWDA 3PIPF 4F9AB 3HHHA 4G8XA 1VQLI 1FKAE 4A3DJ 1KJKA 2B63J 3Q0WA 5DNYA 1YYKA 4L0ZB 3PUBA 2YTPA 1QRYA 5KL2A 4IS1C 4WSPA 2PMHA 1R5GA 2MH2A 2VOPA 2WCC3 2CU7A 3DEWA 3F8BA 4L5IA 2NOJB 4CHUA 3PM1A 2K4JA 2LVHA 5EF6A 1YLFA 1TLHB 3THOB 3CMMA 1VQ9I 1ZLJA 1G4DA 1DQUA 3K4CA 4BDYA 2HXIA 3I64A 2HQAA 4HW0A 1MMAA 5M5XJ 1UG0A 3NARA 2RPCA 2EA4A 3JSOA 4PJ0C 1FIAA 3BR0A 3E7LA 1VZ0A 4HNUA 3TDZC 3TP3A 3SEZA 5H2FC 5E3NA 3QG5C 3CF5F 2DK5A 1HC8A 3ZN0A 3HEFA 2PMZA 5E1ZB 1GDTA 4R03A 2IVMA 4IHTA 4XOTA 2KONA 3A0HC 1KU7A 2RQPA 4I0AA 5KVRA 3LSTA 2HKXA 4CYDA 4ABZA 2A25A 3CCQI 2X6WA 2DFEA 2QENA 4AYBN 3FZVA 2EMAA 1WH7A 3C4TA 4FCYA 4HEA2 1LFUP 3DBLB 4R8OA 3JTGA 1MDMB 3ASOH 5E3LA 1STZA 1Z6TA 4FETA 2CG4A 5FKOA 1ETQA 4O3MA 3KYLA 2L3DA 2D1VA 1X3CA 2R5ZA 2HXOA 3VODA 1TWFJ 2DLKA 2OJED 3HPGA 2Q1ZB 2DW4A 1Z3XA 3J81Z 2QM3A 2LCEA 2V89A 5IV8B 2YTQA 1UJ8A 1UHWA 3J80K 2QQ9A 4UV8A 3ROUA 3M99B 3GTJJ 4EVIA 4BBSJ 3WHCA 3BTCA 4F55A 2ZNZA 3CP8A 4ZTJA 1N34E 2M0CA 4HBLA 4LG0B 1MNEA 3NAUA 1YJ9I 1ERDA 3CC4I 4KIFA 1USTA 1DQ3A 2PJPA 3ZGKA 4PK4A 5J1UA 2L3CA 4E70A 1RETA 3AG2H 2JR1A 4IHWA 2MDGA 5KL7A 4M3EA 1T98A 3ZR8X 4IQ4A 3HPHA 1QQIA 1ZKGA 2CYYA 3HOSA 4HDVA 1B8IA 2DA5A 1FEXA 4PJLA 3ZQQA 1DGWY 1IDZA 3G1OA 1GV2A 1FP2A 2KZVA 3KP2A 4YFKF 3HDDA 3JRFA 2EPMX 1D1BA 1IJWC 5L3GA 1IZ1A 3G4SI 2QF7A 2Q2EA 3MHSC 2EMLA 2K5CA 3DXJF 1WPKA 3BOQA 2V86A 2QQ8A 3F6VA 4BL0B 3M8FA 2PQ8A 3BR5A 1ZGWA 4OIPF 2BXYA 2YR2A 3RPUD 1WJAA 5DS9A 3IRQA 4M6VA 2NRAC 2WADA 3RZDJ 1Z1DA 1EH8A 2XRLA 4I99C 3OR2C 3CUQA 2NVUB 1YW7A 1YFHA 1WHQA 3H3UA 3FXRA 1FY7A 2CJJA 1HW5A 3F8NA 1T0FA 5KAIC 2KHMA 1YHQI 3MZHA 2VE9A 2Z16A 3V7CA 4DV2E 1BJAA 1GLNA 2EN2A 5A2QZ 2EJ4A 4I09A 3F23A 5HVQC 5LGUA 4M6YA 3MMYB 2XVCA 4X66E 4YG2F 1G3WA 1RPWA 3J7AY 2B9SA 2X9DA 3D5SC 2V88A 1G6NA 3TGNA 3ECHA 2EPOA 1P4WA 3AKZA 2EMZA 2ISYA 2IS1A 1YIJI 4RLFA 2EM4A 3PO2J 2F5VA 1LDKB 3MZ8A 2BYVE 4JX4A 5F0FA 2OZUA 1QZEA 1BBOA 1R6RA 4EMSA 2GAUA 4HQEA 2I5UA 3OY9A 1TQMA 3S3MA 2R7SA 4DV6E 4E7SA 2MLGA 1KONA 1MH4A 3ZMSA 4B43A 2R7ZJ 2DMYA 5K5QA 3OYNA 3K10A 2L2OA 4DBQA 3JR9A 4S04A 5BOXA 1E3OC 5FD6A 3M4OJ 1TTYA 4W1UA 4BY1J 3O2PE 2QGUA 3E0JB 4ANJA 1DP3A 2CQKA 2DRPA 5F27A 2LD5A 3DTEA 4XORA 5CJ9A 4I98B 3S14J 4DV0E 4J8ZA 1ETKA 2XKPA 3RPUA 5B66C 2Q8KA 5LRRA 4CA0A 2N8XA 4QTRA 1X6EA 3QYEA 1ETVA 4M72A 3OYBA 1W0TA 3S1RJ 2DN0A 4J01A 1JKOC 3K6GA 4BS9A 4M3DA 3CUQB 4GO1A 3THNA 1ON1A 3I58A 2L0KA 1DUXC 4M30A 4XN3A 4P9FA 4CCKA 3DPTA 4B1RA 3VK6A 1Z6RA 4E6KG 2HZDA 2XPWA 3F6OA 3MAJA 2IGKA 3WG7H 3EDPA 4M74A 1IUFA 5GAGJ 2Y2ZA 1ZAOA 2LR8A 4PFPA 5M5YJ 1AKHB 2LRSA 2VL8A 3ERED 3K6QA 4DV3E 2OPTA 2NAZA 4KISA 4XK4A 3C18A 1X4OA 4P7DA 1G59A 2GIVA 1BJZA 1IRFA 2L2MA 3F8FA 3P1XA 2E2HJ 2YPNA 2CW7A 2O9LA 3V7RA 2EOHA 5J1YA 1UG2A 2JRMA 2GZWA 2ZFUA 4XLCA 2P7CB 2VT3A 1N36E 5DCMB 3RSNA 1I1GA 3LSRA 2OTJI 4JI3E 1MBEA 3DTKA 4A3LJ 3RZOJ 3J80C 3WTSC 3W6JB 1T38A 3CP2A 1BR2A 1IV8A 5K1YA 2YWQA 3DFGA 3G2BA 4R2QA 1OCCH 2R7QA 2DT6A 4LOCA 3S2DJ 2CQXA 2Y0MA 3JTHA 3SDBA 2UXDE 2F5FA 5IPAA 4NHRA 2K85A 1HR0E 4DYQA 4NC6A 3BT9A 4DNCA 1S7OA 4N4RB 3GWZA 5JHUA 2ICWG 4FE4A 2NXNB 3GMEA 2B7EA 3OYIA 2EL5A 2LJUA 1NK3P 2IP2A 5FB2A 1JTXA 1WRJA 3HRUA 3JAMZ 3L2WA 1D1AA 2HPIA 5BS6A 2R0QC 1F43A 1O3SA 2R5YB 1Z1BA 1IO2A 4GDFA 4YIFA 1V4RA 3QAHA 4DZJA 2EIJH 4GYIA 3QPTA 1M1EB 4OAZA 4O4KA 4M71A 5KCMA 1IN8A 3OL4A 4GEQB 3HTSB 2VB6A 1D3YA 3FDYA 4K2EA 5CQEA 2E7XA 3QWLA 1JGGA 2Q8UA 4V2GA 4ZDOA 3WU1B 1STUA 2EPLX 3CO6C 4WCGA 3MZYA 1ON2A 3T0YA 3OYGA 4X0GA 3EUHA 5FKLA 1X3WB 4BC7A 4O5VA 2L7KA 4B48A 2UZKA 3Q0UA 4S05A 3OYEA 2VUMJ 2CPNA 2L33A 4OIQF 2IT0A 1SVMA 5J8FA 1A1HA 1VI0A 2VKHA 2YTEA 4DV7E 4MHGA 4JP0A 4IHVA 2VQFE 2E36A 4DBRA 1POGA 4M9VC 1VQ8I 1P4AA 3V4GA 2FNPA 1VQNI 2V9PA 3MD2A 3KE2A 2AO9A 1ZBQA 2L6MA 5TGTA 5E1WA 1B9NA 2ISZA 1BI0A 1R36A 1KYZA 2VT2A 2FOKA 5DUKA 1R1UA 3HOTA 2V9VA 3CCUI 4LF4E 3ZMUA 4ZZDA 2LNBA 1Z0XA 2EZ6A 2EPNA 1T4OA 1X2MA 4IHXA 4F6NA 2OAZA 2RAEA 3LSMA 2KOUA 4LF7E 3O8HA 2DYRH 2EPUA 3I59A 4PUSA 1BC7C 4XLFA 1GHCA 2UV1A 3QP6A 3K4LA 1KU2A 5DV5A 2EOFA 4FQGA 1MBFA 4ZYHA 3CCVI 2QKLB 2V87A 1KU3A 1R5ID 2IS2A 3L2QA 1W5TA 3BTJA 4M6XA 4RM3A 3FXLA 2LF8A 2EL6A 3DBHB 2F6CA 5C3EJ 1T39A 2VJ5A 1TP4A 1PJTA 2HNHA 2Y9ZA 4Q35B 2VBZA 2EM7A 5C4XJ 1JJ8C 3BZ6A 4KFCA 3S93A 3A01A 5HLTA 2VQLA 1X48A 2ZNYA 5EZHA 2EPKX 2E71A 1I94E 5M3MJ 1SR9A 2LJHA 1ETWA 1WXRA 3WGHA 1TWGJ 1ZN2A 1MNDA 1W5CC 2Y31A 2EM9A 2EFWA 3I4MJ 3R61A 2EFOA 2P4WA 2ENHA 3GTOJ 3MSWA 4XKBA 3GTQJ 3GLLA 2XF6A 2IA1A 1K7AA 3CD6I 3DWLE 3HUGA 3OYFA 1OLTA 2BY0A 5ICEA 1FT9A 5EZGA 4RHBB 3EPZA 5F04A 2G7UA 2JN6A 5CVJA 3OOUA 5E8GA 2FBIA 2I9IA 2NUFA 1MBKA 2FNAA 3FBNB 4LLNA 4BCAA 2DK8A 2QQAA 1I1SA 4DR7E 3SZPA 4PZJA 1FSEA 2JRTA 2EOQA 3D5RC 3QODA 3I71A 4BGDA 2GQQA 2WBMA 4RB3C 4ENJA 3F6HA 1B72A 2EQRA 3ZOBA 2EOYA 4HA8A 4GFBA 2M7AA 1TC3C 2QSGX 2WA0A 3VSLA 4M9ZA 2E34A 3A4CA 4M9XA 2O03A 1YTYA 2N3HA 2R7FA 1ETYA 2M5WA 3ABTA 1ZYRF 1BR4A 5AE1A 2VIXA 2EB7A 2MFZA 1DGCA 1CGPA 2CV1A 4FX0A 2L4AA 3CQZJ 2ECBA 2FRHA 2DPUA 4FX4A 1MJBA 2A07F 1HA8A 1RIOH 3WTTC 3KFWX 1TL8A 2W7NA 4HX4A 4F93B 1OFCX 2LBFB 4YIRX 3VWBA 1IDYA 4CUGA 3WTWC 3H0DA 2ZSHB 2JPBA 2P5KA 2LUQA 3IWBA 5IWAE 4L0YB 1OISA 5LGTA 4XRSA 1ZH5A 5LBQA 2CUZA 5EDNA 2L5QA 3CLOA 5IT9K 5KL5A 1T4LB 2H6CA 2TRTA 4XM3A 1SFXA 2ADUA 3P7NA 4LFUA 4BHPA 3JRIA 1JKRC 1P7IA 2EOEA 3KYCB 2J5OA 2EMYA 3LQQA 4WF2A 4AIKA 3P9IA 3S16J 3ZXSA 5B1BH 2DFIA 3OIOA 3CMEI 1I39A 4PGHA 4YY3E 1HOMA 3I56I 2HR3A 2FXAA 4JX5A 1VQ7I 1ZU1A 2KISA 3HC7A 2M1BA 2VQGA 2EN6A 1S72I 2MBFA 4A93J 1H8AC 2OC6A 3GO5A 1RUNA 3FIGA 3KP5A 2DT5A 4MIMA 1OCPA 3TO7A 5DD4A 1DU0A 3IH2A 1LFBA 2DU9A 3BR3A 2KIFA 2CV2A 1HDPA 5ERIA 3CJRB 3UKGA 1H9GA 2EWLA 2FE3A 4IXAA 2MC6A 4F3QA 1IMUA 1YS6A 4G7ZF 2LYCA 3PSIA 2LOOA 2PJRA 4PJNA 3M9AA 3ABKH 1GXPA 1V3FA 2H6BA 1VQOI 3UK3C 3HB9A 4V19K 4LIUA 4BQOA 5LL6R 4BQNA 3KPHA 5F1RA 3DPLC 5IP7J 4RGUA 2AHQA 4XBFA 3TKYA 4YRVA 4BE0A 3HOYJ 1YSAC 2JUGA 4IPAA 3QU6A 1PUFB 2F5DA 2IW5A 4N9HA 2HOAA 2V7FA 4ZZLA 1Z91A 4P96A 4Q47A 4UVAA 5L3BA 1ODDA 1IXCA 1TBXA 3BR6A 4WSGA 2R7DA 1O0WA 3BG3A 1GZ6A 2CGPA 3QYFA 4QSHA 1J9IA 5JLXA 2KT0A 4XKVA 4WK8F 3AG4H 3BCBA 2DSYA 4J19A 2YX7A 4KJZA 4XKCA 1AA7A 1FBUA 1MMDA 4C2UA 2OA4A 4F52A 4MFEA 1ZAAC 1YYWA 3BQYA 4LIVA 2MG4A 2FBHA 3AL0C 4LU9A 4DYRA 2Y75A 3K7AJ 4XRMA 2DB2A 1FBQA 1IC8A 2M1SA 4LFBE 2V1DA 1LVAA 3ZCOA 3MWMA 3WTUC 2IPQX 1J26A 3GXOA 3J7ZI 1BIBA 2X6OA 2LSOA 3GF2A 2XAGA 4UUSA 3FMRA 3WTZA 1T2KA 1OCZH 3E3VA 5BR8E 1A1FA 3LMLA 2QKMB 4EGZA 3GEZA 2M87A 1BOBA 3LSIA 2Z3YA 1XGNA 3FM5A 4HDUA 2R3SA 3WTVC 2Z9OA 4ZYAA 3JAMK 3TOAA 3C6MA 3MFKA 2DA2A 2XSJC 2NUGA 2V4JC 4CDGA 1X47A 1BOAA 2V6EA 2XROA 3GTKJ 3I9V2 3BBGA 2EZIA 2MH9A 1TT0A 2DLQA 5FGMA 2GBYA 4R8HA 1F9NA 5D8KB 4P1WA 2YTFA 1QGPA 1IN5A 3VYRB 3S2HJ 2EM8A 2QCOA 4EGYA 2F4MB 3I54A 4UUVA 5A2QC 1LNWA 2KDZA 4JI7E 5L3EA 4DJAA 1D0XA 3UNGC 4II3A 4WX9A 3K2ZA 4JX6A 1KQ8A 4B3RE 4BXFA 2QZ8A 4A0XA 1IRXA 3K9TA 4I01A 1HLVA 2KIQA 2M9AA 1ULYA 3HSFA 3U21A 1KQ0A 1NH3A 2DT7B 1K83J 2ZMEB 3LFUA 4W97A 2KHXA 1IW7F 4CGZA 1WFXA 5JFRA 5JI6A 2NVXJ 1RC9A 3DEUA 3BG9A 2BOLA 3M1CA 2WV0A 3TP0A 1K4TA 4QPOA 5EG0B 1I3AA 4MEYF 3OOPA 5CPRB 2VLAA 1VQMI 3F3XA 2VRDA 4MTDA 1VQKI 1D0ZA 2EE8A 2EOMA 1LDDA 5FFZA 2DODA 3LOCA 2EFPA 1W36D 3ECOA 2VPRA 4A3IJ 4A69C 4XLEA 4UB6C 3F21A 2VBXA 2WAFA 4GZNC 3MN2A 3BJAA 4NDLA 1MDMA 1FX7A 4DR5E 3ABLH 4MEXF 1IRZA 5CFFE 2BVLA 1U5TB 3TOBA 2JYAA 1B9MA 3BY6A 1YW9A 3ZQFA 1WSUA 4XSZF 1R00A 4A12A 1UN6B 4Y15A 2OZ6A 5E1XA 1T56A 2CTDA 2PI0A 1X1DA 2G0EA 1SD5A 4KN4X 2MDRA 3BPVA 4Y3OA 1JUPA 3L2UA 2ZB9A 3MKZA 4S0HB 1HW1A 4NQWB 4H0EA 1O7FA 2P5LC 1WI3A 3K70D 2RS6A 4RB2C 1HDDC 2XAQA 4LG0A 1AHDP 2EK5A 3W3CA 2BVMA 2RS7A 2E1MB 2ZM6E 3JRDA 2E2JJ 2LREA 3KCCA 2DMUA 2IXSA 1XMKA 1LJ9A 1YW8A 2ELKA 4BXXJ 2GPIA 1RZ4A 3JRCA 3EPLA 2L01A 3NWTA 3L1PA 1LLMC 5K7HA 2P6TA 3C2BA 1U78A 2K02A 2VXDA 4WXCA 3MKWB 2OF7A 4EATA 2EMCA 4F9BB 4KICA 2WAQA 2ZJ2A 4D9JA 5BPDA 5CLSA 1CF7B 1I27A 2W00A 3HYIA 5IYCJ 2MD0A 5K7ZA 4A3KJ 2M7BA 1ZHFA 2R93J 2ZCWA 2HWVA 1T33A 5ED4A 2ZXWH 1GV5A 4F92B 1JGSA 5FLXK 3EUAA 3IP4B 4YFXF 3FXKA 2XB0X 3K1PA 2XC7A 3S17J 4R2DA 1AWCA 2AS5F 2JA6J 2A05A 3W6KB 1YIOA 2MABA 3P5JA 2B9DA 1NTCA 1PP8F 1WKMA 3CUOA 1UFMA 4E7KA 5B1AH 4FT8A 2GA2A 3JW4A 4A0ZA 2EQ0A 3JAMC 4FISA 4OAYA 3RIRA 4A5MA 1BA5A 4DR4E 3DKWA 2GWRA 3VB2A 3LWFA 5J47A 2NA2A 1IUYA 2TDXA 3RYRA 2EV5A 2KLOA 3KLNA 4DIQA 4CZZA 4A3CJ 3QRFF 1BN5A 1VNDA 5DYMA 2JT1A 3RJPA 1XTAA 4J00A 4L8NA 1OJLA 3BJ6A 1Y0NA 1SANA 1BB8A 4I2OA 3GVAA 2E35A 2R4GA 4BHCA 5CYVA 4A6DA 4WXDA 2GOXB 4Z2YA 1BW5A 1WJPA 2DIXA 1L0OC 5F1JA 1MJ9A 3ZP5A 2I13A 1FTTA 2X85A 2B7TA 1JUSA 2EOZA 3D1NI 3HHGA 2Z99A 1G2FC 3HSEA 1HKQA 3HRMA 2HOTA 1IQOA 4B3ME 4BJ5C 4E7ZA 1U8BA 2H94A 5C44J 3ZQHA 3DCFA 4DMIA 5EGOB 2X6YA 2ZXIA 2TCTA 1W7PB 3A03A 1L3LA 3Q5FA 1NK2P 1R71A 3GYHX 4UNOA 2EORA 2V85A 1R7JA 5J4YA 1J7KA 1APLC 2Z2SB 4B4CA 2EOOA 1GVJA 4MNUA 3CJNA 3OYJA 2KZGA 2VBYA 2W1OA 1N77A 3K1NA 2EPPA 2HHHE 1SVOA 1Y6IA 2FF4A 2Q0OA 2EOIA 1AKHA 1W5SA 5C4JJ 1F5TA 4RGSA 5EEHA 4U7DA 1LDJA 1YITI 4GCVA 1SMYF 1IQSA 4MTEA 1W36C 1FWZA 1HCRA 1QZYA 3CCLI 1MNMC 2LKXA 1SFEA 2DPDA 1VTNC 5CVRA 1XMOE 2EMWA 3D0SA 2H09A 4BHBA 2EPZA 1FC3A 3DKXA 4HOBA 2V83A 4I7HA 5EJCA 4AUXA 1XS9A 1Z67A 5DCMA 2MKNA 2L54A 5CVIA 4E7HA 2LKSA 3BDDA 3H9GA 1WZ2A 2LG4A 3F0CA 2D45A 2KJCA 3OS1A 2LTRA 1ZELA 5HLGA 4B8XA 1XPXA 1QNTA 1PP7U 3T1HE 4AYBA 2DA7A 1JHHA 3T8TA 3V8KA 1Z7UA 1X1CA 2NS8A 2DYSH 2A3SA 3A0BC 2L3JA 4ZYGA 3LL7A 3K70C 4KA4A 3PSFA 1PJRA 4CZCA 1BBYA 2CH0A 3M7GA 5HDKA 2HZTA 2YTJA 1USSA 2L92A 1IG7A 3TO9A 1BM9A 4BC9A 5D5VB 3GFLA 3HKZA 4I6ZA 2RSIA 4LLLA 4AU7A 2YTDA 3ONQA 3E5UA 3QQAA 2R5YA 2EP3A 2JUCA 2JVAA 3CDLA 4HLXA 5LHHA 3KEQA 3VOEA 3MKLA 5GAEJ 1A04A 3SDGA 4IZZA 3G71I 1BL0A 2IBDA 4KWYA 3LMMA 2F2EA 2V1UA 2EMGA 3LNQA 3VYXA 2DAOA 1MGTA 4JOMA 1ZGAA 3IRRA 1IBKE 5FLXC 3RYPA 1LVKA 4EJWA 2XGEA 4DGWB 4RMNA 3CESA 4U88A 3IH3A 2Z33A 4KUMA 1WJEA 2AXTC 4JQFA 1RI7A 3ASNH 3HRTA 1RKTA 1TWHJ 2JA2A 1ZRFA 3V42A 2XAUA 1IF1A 3HXLA 2EV6A 2YU8A 2F48A 1JT6A 3CUQC 3S1QJ 5LMNE 4ZDLA 1T0FC 3JREA 1K78B 3LSKA 1C0WA 1N32E 3ZMTA 4IOCF 2MA3A 4XRSG 1YZ9A 3Q9VA 3GZ6A 1YQAA 4HSRA 4CYCB 1TQIA 2K9NA 2XGCA 3VSKA 4CCMA 1T8IA 4XLPF 1JE8A 4F91B 2YTOA 2JZYA 2EIKH 1SFOJ 4LF6E 1X58A 1IXRC 1TN9A 1J5YA 2XAFA 2RSMA 5D5WB 3MEXA 5TJJA 3RQIA 2DLLA 3BP8A 1KZHA 1LFPA 2FBKA 4QIWN 3LAJA 1U9NA 1H88C 3ZPLA 3HSRA 4JI4E 2DQRA 4B09A 4FTHA 2YRMA 3BR1A 2F8BA 4RAZA 1DP7P 2DDAA 4KNYA 3GUDA 3S32A 1UHSA 1AU7A 2J5PA 2M7QA 1X5WA 2YTIA 2KRCA 2JVHA 1R5HA 4V2FA 2L9VA 3H0GJ 2HVRA 5F64A 4CCOA 1FTZA 4H4KC 2CV0A 3H9QA 1J2XA 3DF6A 4XQFA 5CKTA 3L2RA 4HQMA 2BZTA 2O7OA 5IXMB 3ZQ7A 3FXUA 3RKWA 1XGMA 3ZMVA 1XC5A 3FX3A 2RQQA 4KHPE 1XD7A 3M8JA 4IJAA 1LPQA 2BBYA 2FMYA 1W0UA 2DCEA 3KEYA 1XN7A 1YUJA 2ELHA 2HI3A 2JMWA 4LF8E 3HL2A 4NC7A 4EM0B 5HLIA 1REPC 4X64E 3V8JA 2FV4B 2W57A 1JKQC 2EMBA 3K4KA 4WXHA 2ZO4A 5IP9J 2L02A 2HPMA 3TQMA 4GKKE 2DTRA 4AIHA 4HTGA 1KYQA 2YZTA 4LK1F 4IF4A 3WTYC 3C1DA 2H1KA 4HX8A 2ECCA 3D5LA 2F4OB 3K4JA 4RB0A 4ZTFA 2RV8A 3W2WA 4Q4ZF 4X6AJ 4WPYA 1YOVB 2K4BA 2LDUA 4IJDA 4PSWA 1HKTA 4OIOF 2FA5A 2LY2A 3VFZA 3X2QH 1S5LC 1OPCA 1G3SA 2E1CA 3AV0A 2KIMA 2DOAA 2EOXA 2JWOA 3KP3A 5DEQA 1G3TA 1TF3A 3FHNA 2V8QB 5FLVA 2BB8A 2R7VA 5L3DA 2HOSA 2VKDA 2K9QA 3ZQLA 1OR7A 2CSOA 4XOPA 5F08A 3TQNA 3LSJA 1NG6A 1X3ZB 2A6HF 3PIOF 5GP9A 1LEBA 3KP4A 2XAJA 4YHHE 1H0MA 4BU2A 4XLHA 4L5NC 3SYTA 3EQLF 1I3QJ 3HRSA 1BR1A 4ZYDA 4HF2A 3EPHA 4LLGF 2X48A 1IAWA 4PJJA 1MBHA 1Y8RB 1Q1VA 1NEIA 1SFUA 1XMXA 3Q9SA 5ICGA 3L09A 3TEDA 3PUFA 1BBGA 3N4MA 1YJWI 3J7YJ 4EEFG 2HQ5A 1ENHA 4LD5A 1X1AA 4OINF 5E8IA 3F22A 2HTJA 2L2KB 3L9FA 1R1VA 4IRHA 2NS0A 3GX4X 2DA6A 2VJIA 1EV7A 3I3LA 4Q28A 1U0JA 1G8XA 2LBFA 5DUIA 1VQ4I 4IEJA 3T8RA 4XLNF 2R76A 2YUSA 1BIAA 3BCAA 4HSTA 4F6MA 2OUMA 1B1BA 1RNLA 5FROA 3T5XA 2WC2A 2NNNA 5HDNA 1OCRH 2K27A 2N3GA 2CUEA 4HPQA 3HPZA 4DV5E 3OIQA 3J81K 4G94A 2IGOA 2M4GA 4OIRF 1ZREA 2EN7A 2XHKA 2EMHA 5AC4A 2LLKA 3OMYA 3CCJI 1DDNA 3JSPA 3FXOA 4IL6C 2R7WA 2EV0A 4XSXF 3GLXA 1WJDA 5IYBJ 2HDCA 1ORKA 2EOJA 2L9RA 2XAHA 3IWFA 1FBSA 2XPUA 4OMYA 2VONA 1JUMA 4JI1E 4RM2A 9ANTA 1N75A 2Y69H 2X4HA 2CRGA 2L7ZA 4CO8A 2CQ7A 2MGQA 2RGVA 1K61A 3OS0A 2BY3A 3EUHC 2IHR1 4UB8C 3B6CA 2YSRA 3NEUA 4Z6YA 4XICA 4TUGA 2CW8A 3H5RA 2JA8J 2UXBE 4L9TA 1BI2A 2W25A 1V5GA 5AE2A 2VXZA 1XX5A 2PFBA 1A5JA 2Y0SN 1Y8QB 5JVGF 5CVUA 2JK3A 1YG2A 5KAFC 3M8EA 3ZN1A 5JR3A 5J1RA 4BNCA 1XMQE 2E5ZA 4Y33A 2WB1N 5KHDA 4P5OA 2CO5A 1DPRA 2ESNA 3K4NA 5FJ8J 5IOZA 4BJ6C 1T08B 3WE2A 4AIDA 4BBRJ 4HLYA 4IKFA 4KYWA 4GKJE 3FXQA 2L2NA 3GCMA 1SAXA 4LGWA 1HKSA 2ETHA 5A2QK 1RC7A 1E17A 2Z1DA 4NC8A 1PUFA 2R7XA 2LF7A 3JCUC 3K69A 2DFHA 5ADZA 3WTXC 1WHUA 5F6FA 1OR7C 1NHAA 2H8WA 1F1ZA 4HAMA 3S2WA 5HDGA 5LRSA 3CC7I 4GYGA 3MHHC 4UXNA 3GFIA 1EH6A 2JA5J 4KIBA 1JKPC 3FBIB 2QEXI 1FIPA 3DU6A 3BG5A 2HTSA 4DYCA 5LEJA 1JJ6C 1YUIA 2HYGD 1A6QA 3HZJA 3ADIA 3Q0VA 2V79A 3C4BA 3GFMA 3SQNA 5GTHC 2K3PA 1RUOA 3BG6A 4IOAF 2E19A 4LB6B 2QUFA 1RR7A 3J80Z 1D1CA 3RTRA 1YX3A 5LEKA 2ODRD 2KMUA 4Y52J 3DF8A 2X6XA 2Z5UA 3E6CC 5LD2C 3KEOA 3F6GA 2GXAA 4G6DA 1Y0UA 3OYCA 4CSWA 2E5NA 1MW7A 5TISC 3WE3A 4BEHB 4NBQA 4XRFA 2I8DA 1T4NA 1UELB 1HNZE 2EWNA 1JT0A 1QHHD 4XNFA 4IVNA 3T1YE 2JP9A 1QVTA 3IV5A 3KP6A 4IRGA 4EJUA 1N33E 3A02A 2V9KA 2JPCA 1MZBA 2PBIA 3KP7A 4ESJA 5TRDA 1YI2I 2STTA 2EN1A 1S29A 2UWMA 4A3GJ 1ITYA 1PDAA 2X1DA 2WAEA 2QBYB 3DJWA 2H8RA 4RB1A 4FE7A 2G7HA 5H6QA 4AWXB 4LFAE 3JRHA 4Q5SF 2OU2A 4ESFA 2IGNA 1TWAJ 1B6AA 5HNHA 2IAIA 3IH4A 5M3FJ 3K0LA 3A2KA 2UXXA 4HV6A 3L2CA 2GXGA 3EETA 1V55H 3CCEI 1RQ0A 2VJ4A 2V26A 2DMPA 4A3JJ 2YSOA 2JTVA 1U8RA 1FYLA 2KDOA 2W82A 4RAGA 5CQGA 5IY5H 2VBWA 4UVCA 1V54H 3SHFA 4NXNE 3F8CA 3ABMH 1SD7A 5BMZA 2VC1A 2V1XA 3HOWJ 3OL3A 5M5WJ 2L4MA 4P9UA 2ZMEA 4IRIA 4DUZE 1P2FA 3J81C 2R7UA 2O5RA 2IS6A 1WCMJ 1LE8B 1V5EA 2GIZA 4MGRA 3U1DA 2VJJA 3CMYA 4MQVA 2JA7J 3BJOA 2ENCA 1A1LA 4IQJA 4HX7A 5FRNA 3IAS2 5EG0A 4ZDPA 1EKZA 3E5QA 2K9LA 2HYJA 3LAPA 4BUPA 1ZR2A 4WYQB 3FKIJ 3H35A 2BY2A 4U0YA 1X1PA 2KP6A 5F0CA 3REOA 2X1CA 4ZJZA 2DJNA 2BHYA 5J6XA 4B3XA 4O43A 1FLIA 4LTYA 3DEEA 4DKKA 4BH9A 3H5NA 1HSJA 2CMPA 1K6YA 2E5LE 3CC2I 1U5TA 4CCNA 2D1HA 2IS4A 4R2SA 5FKNA 4HNTA 3NWSA 3FXMA 4D5FA 2PN6A 2DJIA 2ID6A 3IHUA 4E4HA 2RDPA 2LKPA 1I6HJ 5A69A 5HS8A 2ACJA 2GLIA 3HIFA 4R2EA 5D8LB 3OSFA 2JVGA 2HDDA 1QVUA 4NQWA 2B0LA 3H5AA 2FQ3A 2WY7Q 6PAXA 4G6QA 2HU9A 4CICA 2ESHA 2FQ4A 4Y7NJ 2E2IJ 2MC3A 4BKXA 2WY8Q 3TBIA 3PNTA 3IWZA 3PQJA 1A36A 2E1MA 4JV5E 2OV7A 2ID3A 2PMZN 2BW3B 3VDXA 2WAQN 5D5UB 3M07A 4EJTA 2WBTA 4I02A 2OCEA 2M30A 4LMYA 3ZQCA 4R2PA 5LMUE 2DA3A 2EZHA 1KQ9A 3ADGA 2YSPA 3MVPA 4JI2E 2CT1A 1R58A 3BROA 3J7Yp 4A5NA 3IKTA 2ME6A 1BI3A 4X62E 1WHNA 3L00A 2NS7A 3BTIA 4R2RA 5ICFA 1T6SA 2M34A 4LITA 3DKYA 3TL4X 4A0YA 2A6TA 1TZLA 4DW6A 1CF7A 1CQTA 1QU6A 2CS3A 5GAHJ 3CJTB 2BEOA 4LF5E 2LT7A 1X1BA 5LHGA 5D5XB 2NNYA 4B3SE 1YO5C 4GRIA 2PLYA 3TW7A 1Z05A 2M2EA 2ODRC 1I5ZA 5GTIC 3JTZA 2ZXJA 5L3CA 2L9NA 1W7PD 3K4MA 4G9YA 4LJZF 5LGNA 2C6YA 2O6GE 2BV6A 4HF0A 2DOFA 5FRMA 2ZMEC 4KN7X 3B6AA 3HTXA 1XDSA 2FMLA 2DOEA 2NVYJ 1XDUA 4NNJA 1KYWA 3PQKA 2MC4A 4AC0A 2X51A 2P6SA 4YFNF 4HF1A 1IGNA 5E3MA 2EFQA 1FOWA 4IHYA 3OYHA 3G6EI 3B73A 1LB2A 1FMVA 1Z3YA 2EPXA 3TMOA 3FMSA 2XKOA 4D0PA 3H92A 1FOXA 2EM2A 4N0BA 1LUJB 3W2AA 4M73A 4HNVA 3OS2A 1KGSA 2V1NA 3M1EA 3RCOA 3HBLA 2EZLA 1R9TJ 1X19A 1J75A 1LEAA 2QLZA 5K5RA 2YTGA 3C7JA 1E3PA 2CQNA 4EM2A 1WI9A 2CW0F 4MQ9F 4OOIA 1H89C 2QA4I 1U5TC 3KYDB 3JRBA 1IBLE 2RTXA 2MSYA 4DZPA 3E97A 4RDUA 3KZIC 3WG9A 4A3BJ 3FWEA 1N78A 2JPAA 1FJGE 2NUEA 5J4VA 1ZTRA 3WODF 3HTUA 2NOGA 3VYUB 2X1EA 1TQPA 4BY7J 4GXOA 5A6JA 2IJLA 5EGOA 1VFCA 2LTSA 3F72A 4MLVA 1B59A 1W7PA 2G9WA 1X49A 1WH5A 2XUBA 1UB9A 3CZ6A 2E1MC 4TUIA 4C3HJ 3V8LA 4ENNA 2EM5A 4FHTA 1SC7A 1BW6A 2DDBA 2HFHA 2X0LA 4B3AA 3COAC 2HVSA 2JY9A 2K40A 3IKVA 1RMDA 1W4MA 1PKPA 3S3NA 3M3YJ 3HG9A 3OR1C 2QVOA 2H36X 1KA8A 2VQCA 1EH7A 3R0AA 3EPJA 4AIJA 5K7FA 3BC8A 3FISA 2FJ1A 2KQRA 4R2AA 4E7JA 1HBXG 2VC0A 2XF5A 2KJBA 3MCZA 1XGOA 3DQVC 3LQRA 4DR6E 2IA0A 3K2AA 3EUKL 3N97A 2EQ3A 3I5UA 2EMKA 1QPMA 2LY9A 2VASA 2VOOA 3QPHA 5D4SA 3GZNB 4ZYEA 1HF0A 1AAYA 1MMGA 2RKHA 4F2JC 1MBJA 3LSGA 3AG3H 3JU0A 2EBIA 3ML6A 1ZR9A 2DGCA 3H36A 1XSXA 3QOPA 4OMZA 3LSPA 3KX2A 2OQGA 1MKMA 4IO9F 2RC4A 5K5OA 1XSDA 1MIJA 1X6HA 3HKZN 4AM3A 2GHFA 2STWA 3MQ0A 1G2DC 2EOSA 1YPNA 4KZSA 4R1HA 3C2HA 2QWWA 3H3ZA 5HLHA 2HQRA 2LBSB 2K9SA 1W1WE 2HVQA 4D5CA 3E6MA 4U0WA 2P7VB 4JBAA 5H6RA 4ASNA 3FIWA 5D4RA 2HGCA 3SZTA 1P9QC 2IA2A 4BAYA 2YRKA 1MMNA 2CUFA 1FYMA 1DGRM 5DM6F 1U6GA 1FNNA 2D9HA 1JK1A 1WJCA 3I0TA 2IEKA 3NQOA 2EM3A 2JWTA 3R6SA 2WZOA 4Y13A 4G7HF 1S7AA 4HEIA 2RNJA 2A6EF 3ERMA 2LE2A 3OTOE 1R4NB 2HC5A 2EA2A 2MYSA 3PNVA 4A6EA 3P9CA 1E3HA 4C2TA 1IN6A 1A1JA 3KLOA 3FHZA 1K6OA 3S1MJ 4X65E 2P0WA 1ACIA 3BG7A 5EYRA 5KNLA 3FK6A 5ICCA 5E79C 1UAAA 2JOBA 2L9SA 3I55I 3OYMA 5KL3A 1Z9CA 1ZARA 2EMIA 3LSHA 2EN4A 2YU3A 4U0VA 3ADLA 2K7LA 2KL4A 4RGRA 4B3TE 4A2UA 4I76A 2DMIA 1K78A 4LFCE 5ILSA 1N3GA 2UU9E 2HKOA 4MO7A 1G3YA 3BLYA 5EEAA 2EQ1A 1UHMA 5H20A 4UV9A 1P6RA 4CYCA 3IAM2 2ELJA 3PNYA 4PFOA 3HJEA 1QHGA 2J7JA 4PJMA 2R7RA 4D7NA 1YYOA 1F2IG 2B3TB 3AG1H 2R5ZB 5IT9Z 4A3MJ 2XPVA 5AONA 4EJOA 2A68F 4L9VA 1FOKA 3KIOA 3WGGA 3CCSI 1DU6A 1EF4A 2ZXHA 2A69F 1J5EE 5D6FA 1K4SA 2M0MA 5DM7F 1WJBA 3DU5A 1GVDA 1R4MB 1U9OA 1S3JA 3F8MA 4EQQA 4XIDA 2EZKA 3E6BA 3GTLJ 5DDGA 2ENAA 1T95A 1RESA 1V5FA 2KKOA 2JJ7A 4M3GA 4AVZA 4CCJA 5B5EC 3QOEA 1UILA 2N8GA 2AQEA 1B8IB 3DV8A 2CFXA 2LVSA 1ETOA 2PX9A 1EJ9A 1XG1A 3GZ5A 5LLQA 4M3BA 2Q2EB 4N4OB 3ELKA 4Y4RA 4RBOA 1O3RA 4WWCA 3I53A 3BTLA 1J09A 3DPUA 2M4KA 1EKEA 3R60A 4ETSA 2YT4A 2OQRA 1HW2A 4UY8I 5ILUA 2H27A 1B69A 2EPCA 2VKVA 2CQQA 2WWYA 2BGCA 2V6CA 1OYWA 3HOXJ 4KT6A 2FSWA 4YELA 3TW6A 4BACA 1MSEC 2NVQJ 4JI5E 4NB5A 5EEGA 2UUBE 2LTPA 1HXDA 2EM0A 4RA2A 4G12A 2MD5A 1YS7A 3R0JA 2CUJA 3ZQGA 2NYXA 2ZJRF 1R22A 5E3OA 4JYKA 2RN7A 3SXYA 1XGSA 2HEOA 2Y30A 1SEUA 1AOYA 2F5EA 3VHTB 4JYAE 1B4AA 2ZJQF 2K4VA 3HGYA 2DMTA 1FSHA 4XMYA 3IUOA 2B7VA 1TWCJ 2DFFA 3L7WA 1QU3A 3LA3A 1XNRE 2BE5F 3MKYB 2COMA 1A1KA 1O57A 1IN7A 4A3EJ 4RAFA 4JI6E 1MSFC 5FD5A 4TV7A 1I50J 3BPXA 1JHFA 3E1SA 3RKXA 2ZSIB 3IL2A 1J59A 1D5VA 1G2HA 1P47A 3C6KA 2W48A 1WQ2A 3CCRI 1X2NA 1MMSA 1TW3A 2FTXB 2R1FA 4BQQA 2HJJA 1SD4A 1F4KA 1K79A 3RMPA 2JSCA 1BC8C 1OKRA 2BHZA 2GXBA 2P8TA 2ELZA 5HNFA 2LMDA 4BDZA 1H9TA 2WBUA 5BNGA 1TNSA 3FK7A 3U2RA 3ZMZA 1ZK8A 5HODA 4Q48A 3W2VA 3RPQA 4X8WA 4KT5C 4L5JA 1E0EA 3PFYA 3VYSB 5HOOA 2IRFG 2Y9YA 3ZRGA 1A1IA 4OOGC 4M2ZA 1XCVA 3QPSA 2FU4A 3GFJA 2XGXA 1R23A 1Z77A 3GTMJ 2VKEA 2QSHX 2RQLA 4OU0A 2M8GX 3HM5A 1ZLKA 1Y1VJ 2EH3A 1QPIA 4NUBA 4FK5C 1SMTA 4O6JA 4RAYA 1TNTA 3OV8A 3EPKA 3I4PA 1OMIA 1PUEE 2M4IA 1JK2A 4AVPA 4F9CB 2KRHA 1A6IA 2LUPB 1BI1A 3WU0A 5IOYA 2DA1A 5GADJ 1SFKA 4C2MJ 5IYDJ 2DMNA 2CFOA 3JRGA 1HQCA 3UR3C 5BPIA 2RREA 3NRVA 2YPRA 5JHFA 3JRAA 2UUCE 2P5VA 2K86A 1YJNI 2VQEE 2IGMA 1KU9A 3EYYA 4RGXA 1XB4A 3H1CA 3FKJA 4QLCU 3QU3A 4MFDA 3H3VK 1LKXA 3BQZA 4QPQA 5ILVA 1ZRCA 4RLQA 3O6BB 3T1BA 2MLKA 2ZKZA 5LHIA 2DXIA 3BZKA 4D1QA 3EQ1A 3GBGA 3HGGA 2UXNA 1MD0A 1F36A 3U9GA 4ZH4F 1YRNA 2EN3A 3OYDA 2LV2A 3ADJA 2O61A 1RRJA 2VN2A 2D2WA 4BJTA 5AASA 1ZGJA 4KMUX 5L3FA 1TW2A 3CCYA 3O3KA 3S1NJ 4BE2A 2NABA 3S3OA 3AAFA 3LLHA 2W24A 1I6XA 4XONA 2ZFWA 2DTZA 3SFZA 2VI6A 3A1YA 1OCOH 1WJ5A 5AIQA 3S8PA 3U1KA 4YEJA 1N25A 1VF9A 1FOYA 2KPMA 1MEYC 1XMAA 2VQHA 2COBA 4F54A 3CCMI 1FMWA 2XASA 5E20A 1R49A 2H1LA 4F7ZA 1X6FA 2WV1A 5A6KA 4PSXA 2YTNA 3E6DA 5AE3A 1HNXE 1GQEA 2EPAA 3AUZA 1XNQE 2ADRA 2OD5A 2E1OA 3G73A 4LF9E 1WVRA 5A6BD 3ISPA 2HGHA 3TO6A 2FGGA 3ULQB 4LK0F 4JI0E 4L9JA 4QWQA 1RKWA 3WHBA 5FLMJ 4DUYE 2GA1A 4C9YA 1WJFA 4ENMA 3ZQIA 2PEXA 5FFXA 3SJMA 2DA4A 4A3FJ 2FD5A 4U87A 3VPRA 4AQYE 4B47A 1D0YA 1GXQA 4DOZA 1Z21A 3EYIA 4BEHA 1VQ6I 1GTKA 1OQYA 2E1NA 2FOWA 1U3EM 3GTGJ 3J7AG 4LG3A 2FUG2 1RR8C 5J40A 5HS9A 3BF2A 1PYVA 4BMJA 3OYAA 3FF5A 4Y17A 4BQAA 3FMQA 1JTYA 2W85A 3F9KA 2WTEA 1SVLA 3KETA 4R79A 2K7IA 5FKMA 3DP7A 1ZG3A 3CF2A 4PGGA 1YRNB 4XN0A 2EL4A 2EM6A 2EINH 1Y39A 2JOXA 5CVVA 1D8JA 3SZGA 4DR1E 2QBYA 2EMXA 3CO7C 2YX4A 5FLXZ 1QO0D 3I59B 4JK1X 3GTPJ 2DQLA 1Y56A 5J3LA 1MJAA 2JQ7A 1S9HA 1P7JA 4ENKA 2L7MP 3C2GA 1ZBTA 1XSVA 2RNGA 5E18F 4UVBA 2GLOA 4C3IJ 2M8EA 2R7TA 1ETXA 2LRDA 2GM4A 2MC5A 2I10A 2XRNA 4KDPA 5A6BA 3QP5A 2EPRA 2PRTA 4C30A 4L9NA 4L18B 2EILH 5B3SH 4XR6A 2HS5A 1S7EA 2OTLI 2WBSA 1QA6A 3QPLA 4E7IA 3C3WA 4M3FA 1O3QA 4HG2A 5HS7A 2VF1A 2BBGA 5IP6A 3A01B 1ZRDA 2LO3A 2KIUA 2M9HA 1LE8A 3DLLF 2O0YA 1VQ5I 2K3FA 4X1EA 2F4VE 2E7WA 5E17F 1P92A 1S6LA 5F3WA 4O5GA 4C3JJ 4LB5A 1YE9A 2LMZA 5FKKA 2HOEA 2YU9J 4YIIA 2VE8A 2ZJPF 3Q3SA 2AXLA 3BWGA 4DR3E 4E7LA 5FO5A 2M3AA 4BBYA 3PJRA 1HSTA 2L8TA 3CLQA 3HOZJ 1FP1D 1UBDC 2CWEA 4JI8E 4OX9E 2O3FA 1MH3A 3HUGB 2XV4S 4PDKA 1HNWE 3WGIA 3H9JA 2AQFA 2HYFA 3G3ZA 1A35A 1FZPB 3ZOQB 2PG4A 1IRGA 3IWCA 3K4BA 2OCCH 1YX5A 3I4NJ 1O4XA 2VODA 2LC2A 1ZG1A 2P81A 4ON0A 4I0BA 1ZQ3P 2OBPA 1ONVA 3LFKA 1YYVA 1Q1HA 1IXSB 4RS8A 2E60A 4OWRB 3VYTB 2D5VA 1B72B 4N4NB 3SFIA 4P55A 2BY1A 1TT5B 1MBGA 1NG7A 2YS9A 2ZBKA 4O24A 4DR2E 3LA2A 2EMFA 1WGXA 3FXJA 4X9JA 2BW3A 2DO7A 2FX0A 4EJVA 4CXFA 3KWRA 1OCTC 3WU2C 4NXME 4BXUA 2RVCA 2Y0SA 4HZFA 1JI8A 5DCFA 1P4XA 2MKDA 1J0RA 1DI2A 5AC5A 3AL0B 2XDVA 1Y1WJ 5GPAA 4NZVA 3OYKA 2WB1A 2DMQA 2KRFA 3TDUC 3V7SA 2ELYA 2XGDA 3VYYA 1U2WA 2A61A 1SD6A 1UMQA 3HOUJ 3K1MA 4I8OA 3G1MA 3DBRB 4XLAA 3OIPA 3RQ4A 4NHJA 2QQBA 3P9KA 4G6TB 3ABUA 3FM3A 5JLWA 3RI4A 4HRIA 2QYOA 2W84A 2PMUA 1A1GA 5A6AA 1FPQA 1XCBA 3GW2A 3PFIA 5BQTA 4MLOA 3ESWB 2QSFX 1PDNC 1Z7LA 1O3TA 1D5YA 1VQPI 3B02A 3BZCA 2HDWA 1IV6A 3RKQA 2LFBA 4B44A 5JVTA 4IHSA 5D6EA 3HPSA 4KIGA 3KZZA 2A5WA 3PL8A 4U7BA 2LK2A 5KL4A 2Y48A 5KK1A 2UXCE
chains in the Genus database with same CATH topology
4BYYA 1O7LA 4HYEA 3KZYA 4G7OF 4HV5A 2DI3A 2FEZA 3J7AO 5IT3A 3R4KA 4KMFA 2M45A 2DBBA 3VEPA 4N9IA 3LA7A 4GGGA 1FYKA 1ZG5A 4UHTA 1QZZA 5J8CA 3CDHA 1X3UA 1D8KA 4EM1A 2HQNA 2EFNA 3RKYA 4DQ2A 1LQ1A 2F5CA 1QBJA 1IN4A 1DPUA 2EJRA 4PCQA 1S8NA 1WWXA 1OYIA 3E5XA 3RDIA 1E2XA 1JXSA 5DD8A 4EV0A 3IC7A 2A5YB 4ESBA 4AD9A 3ZMDA 5AIPA 1OYYA 2XIGA 4M9SA 3CTAA 2O8XA 1R1TA 1UCRA 3HHHA 4G8XA 4L0ZB 2PMHA 1R5GA 2MH2A 2VOPA 3F8BA 4L5IA 4CHUA 2K4JA 1YLFA 1TLHB 1ZLJA 1G4DA 3I64A 4HW0A 2EA4A 3JSOA 3TDZC 2DK5A 3ZN0A 5E1ZB 2IVMA 4IHTA 1KU7A 2RQPA 4I0AA 5KVRA 3LSTA 2HKXA 4CYDA 2QENA 3FZVA 3JTGA 1MDMB 1STZA 1Z6TA 2CG4A 4O3MA 2L3DA 2D1VA 3VODA 2DW4A 3J81Z 2QM3A 1UHWA 3J80K 2QQ9A 4UV8A 3ROUA 4EVIA 2ZNZA 4HBLA 4LG0B 4KIFA 1USTA 2PJPA 4E70A 1T98A 1QQIA 2CYYA 3HOSA 4HDVA 4YFKF 1FP2A 3KP2A 5L3GA 1IZ1A 2Q2EA 3DXJF 3BOQA 3F6VA 3M8FA 2PQ8A 4OIPF 2YR2A 2NRAC 3IRQA 1Z1DA 1EH8A 3CUQA 1YW7A 1YFHA 3H3UA 3FXRA 1FY7A 3F8NA 1HW5A 1T0FA 3MZHA 2VE9A 3V7CA 1BJAA 5A2QZ 4I09A 3F23A 5HVQC 5LGUA 4M6YA 2XVCA 4YG2F 1G3WA 1G6NA 3TGNA 3ECHA 1P4WA 2ISYA 1LDKB 2BYVE 2OZUA 4EMSA 2GAUA 4HQEA 1TQMA 2MLGA 3ZMSA 5K5QA 4S04A 5BOXA 5FD6A 1TTYA 3O2PE 2CQKA 5CJ9A 4I98B 2XKPA 3RPUA 2Q8KA 5LRRA 4M72A 3CUQB 4GO1A 1ON1A 3I58A 1DUXC 4P9FA 3DPTA 1Z6RA 3F6OA 3MAJA 3EDPA 4M74A 1ZAOA 3ERED 2NAZA 3C18A 2GIVA 1IRFA 3F8FA 3V7RA 2GZWA 2P7CB 2VT3A 5DCMB 1I1GA 3WTSC 3W6JB 1T38A 5K1YA 3DFGA 2Y0MA 3JTHA 2F5FA 4DNCA 1S7OA 3GWZA 5JHUA 2IP2A 5FB2A 1WRJA 3HRUA 3JAMZ 5BS6A 1O3SA 4YIFA 1V4RA 3QAHA 4GYIA 3QPTA 4M71A 1IN8A 3HTSB 1D3YA 4K2EA 2E7XA 3WU1B 3CO6C 4WCGA 3MZYA 1ON2A 3T0YA 3EUHA 4O5VA 2UZKA 4S05A 4OIQF 2IT0A 5J8FA 4MHGA 1P4AA 3V4GA 2FNPA 3KE2A 5E1WA 1B9NA 2ISZA 1BI0A 1R36A 1KYZA 2VT2A 2FOKA 5DUKA 1R1UA 3HOTA 2V9VA 3ZMUA 4ZZDA 2LNBA 2OAZA 3I59A 1BC7C 1GHCA 3QP6A 1KU2A 5DV5A 4ZYHA 1KU3A 1W5TA 4M6XA 2LF8A 1T39A 2VBZA 3BZ6A 4KFCA 2ZNYA 3WGHA 1ZN2A 2EFWA 3R61A 2EFOA 2P4WA 2IA1A 1K7AA 3HUGA 5ICEA 1FT9A 2G7UA 5CVJA 5E8GA 2FBIA 4LLNA 2FNAA 2DK8A 2QQAA 1I1SA 3SZPA 4PZJA 1FSEA 2JRTA 3I71A 2GQQA 4RB3C 4ENJA 4HA8A 4M9ZA 4M9XA 2O03A 1YTYA 2R7FA 2M5WA 3ABTA 1ZYRF 2EB7A 1CGPA 4FX0A 2L4AA 2FRHA 2DPUA 4FX4A 1MJBA 2A07F 1RIOH 3WTTC 3KFWX 4HX4A 3WTWC 2JPBA 2P5KA 4L0YB 5LGTA 1ZH5A 5LBQA 5IT9K 3CLOA 2H6CA 1SFXA 2ADUA 3P7NA 4LFUA 4BHPA 2J5OA 3LQQA 4WF2A 4AIKA 3P9IA 2DFIA 4PGHA 2HR3A 2FXAA 2M1BA 2MBFA 3GO5A 1RUNA 3KP5A 2DT5A 3TO7A 5DD4A 2DU9A 2KIFA 5ERIA 1H9GA 2FE3A 4IXAA 1YS6A 4G7ZF 3M9AA 1GXPA 1V3FA 2H6BA 5F1RA 3DPLC 4RGUA 4XBFA 3TKYA 3QU6A 2F5DA 2IW5A 4N9HA 4ZZLA 1Z91A 4P96A 4Q47A 4UVAA 5L3BA 1ODDA 1IXCA 1TBXA 2R7DA 2CGPA 1J9IA 4WK8F 2YX7A 1FBUA 2OA4A 2FBHA 2Y75A 1FBQA 2V1DA 1LVAA 3MWMA 3WTUC 2IPQX 3GXOA 1BIBA 3GF2A 2LSOA 2XAGA 3FMRA 3WTZA 1T2KA 3E3VA 4EGZA 3GEZA 2M87A 2Z3YA 1XGNA 3FM5A 4HDUA 2R3SA 3WTVC 2Z9OA 3JAMK 3TOAA 3MFKA 4CDGA 1BOAA 2XROA 2MH9A 5FGMA 4R8HA 1F9NA 5D8KB 1QGPA 1IN5A 4EGYA 4UUVA 3I54A 1LNWA 5L3EA 4WX9A 3K2ZA 1KQ8A 2QZ8A 4A0XA 3K9TA 4I01A 1ULYA 3HSFA 1KQ0A 2ZMEB 1IW7F 4CGZA 5JFRA 5JI6A 3DEUA 2WV0A 4MEYF 3OOPA 3F3XA 4MTDA 1LDDA 5FFZA 2EFPA 3ECOA 3F21A 2VBXA 3BJAA 1MDMA 1FX7A 4MEXF 3TOBA 1U5TB 1B9MA 3BY6A 1YW9A 1WSUA 4XSZF 1R00A 4A12A 4Y15A 2OZ6A 5E1XA 2PI0A 1SD5A 4KN4X 3BPVA 1HW1A 4H0EA 1O7FA 2P5LC 4RB2C 2XAQA 4LG0A 2EK5A 3KCCA 1XMKA 1LJ9A 1YW8A 1RZ4A 2L01A 2P6TA 1U78A 2K02A 4WXCA 4KICA 2ZJ2A 5BPDA 1CF7B 5CLSA 1I27A 3HYIA 1ZHFA 2ZCWA 2HWVA 5ED4A 1JGSA 5FLXK 4YFXF 3K1PA 1AWCA 2AS5F 3W6KB 1YIOA 1PP8F 1WKMA 3CUOA 1UFMA 4A0ZA 2GA2A 3JW4A 4FT8A 3RIRA 4A5MA 3DKWA 2GWRA 3VB2A 3LWFA 1IUYA 2TDXA 3RYRA 2EV5A 3KLNA 4CZZA 3QRFF 1BN5A 5DYMA 2JT1A 3RJPA 3BJ6A 4I2OA 3GVAA 4BHCA 5CYVA 4A6DA 4WXDA 4Z2YA 1L0OC 1MJ9A 3ZP5A 3HHGA 2Z99A 3HSEA 1HKQA 3HRMA 2H94A 1W7PB 1L3LA 3Q5FA 4UNOA 3GYHX 1R7JA 1J7KA 1GVJA 4MNUA 3CJNA 2VBYA 3K1NA 2FF4A 2Q0OA 1W5SA 1F5TA 4RGSA 5EEHA 4U7DA 1LDJA 4GCVA 1SMYF 4MTEA 1FWZA 1QZYA 2DPDA 1SFEA 1VTNC 5CVRA 3D0SA 2H09A 4BHBA 1FC3A 4HOBA 4I7HA 5DCMA 2L54A 5CVIA 3BDDA 2D45A 2KJCA 5HLGA 4B8XA 1QNTA 1PP7U 1JHHA 3T8TA 3V8KA 1Z7UA 2A3SA 4ZYGA 4KA4A 1BBYA 3M7GA 5HDKA 2HZTA 1USSA 3TO9A 1BM9A 5D5VB 3GFLA 4LLLA 3E5UA 4HLXA 5LHHA 3KEQA 3VOEA 1A04A 2F2EA 2V1UA 2DAOA 1MGTA 1ZGAA 3IRRA 3RYPA 4EJWA 4U88A 2Z33A 4KUMA 4JQFA 1RI7A 3HRTA 1ZRFA 1IF1A 2EV6A 3CUQC 1K78B 1C0WA 3ZMTA 2MA3A 3Q9VA 3GZ6A 1YQAA 1TQIA 4XLPF 1JE8A 2JZYA 1IXRC 1J5YA 2XAFA 5D5WB 3MEXA 5TJJA 2DLLA 3BP8A 3ZPLA 2FBKA 3LAJA 3HSRA 2DQRA 4B09A 4RAZA 1DP7P 4KNYA 3GUDA 2J5PA 1R5HA 5F64A 1J2XA 4HQMA 3ZQ7A 3FXUA 3RKWA 1XGMA 3ZMVA 3FX3A 1XD7A 4IJAA 2BBYA 2FMYA 1XN7A 2ELHA 4EM0B 5HLIA 1REPC 3V8JA 2W57A 4WXHA 2ZO4A 2L02A 2DTRA 4AIHA 4LK1F 4IF4A 3WTYC 3C1DA 4HX8A 3D5LA 4RB0A 2RV8A 4Q4ZF 2K4BA 2LDUA 1HKTA 4OIOF 2FA5A 3VFZA 1OPCA 1G3SA 2E1CA 2KIMA 3KP3A 5DEQA 1G3TA 5L3DA 1OR7A 2CSOA 3TQNA 2A6HF 1LEBA 3KP4A 2XAJA 1H0MA 3EQLF 4HF2A 3HRSA 4ZYDA 4LLGF 1IAWA 1SFUA 2Y48A 3Q9SA 5ICGA 3L09A 3N4MA 4LD5A 5E8IA 4OINF 3F22A 2HTJA 3L9FA 1R1VA 4IRHA 2NS0A 3GX4X 1EV7A 5DUIA 3T8RA 4XLNF 1BIAA 1B1BA 1RNLA 3T5XA 2WC2A 2NNNA 5HDNA 2K27A 3J81K 4G94A 1ZREA 4OIRF 2XHKA 1DDNA 3JSPA 2EV0A 4XSXF 3GLXA 2HDCA 3IWFA 2XAHA 4OMYA 1FBSA 2VONA 2X4HA 4CO8A 2RGVA 3NEUA 2YSRA 4L9TA 1BI2A 2W25A 2VXZA 2PFBA 5CVUA 1YG2A 3M8EA 3ZN1A 5JR3A 4BNCA 4P5OA 2CO5A 1DPRA 2ESNA 4HLYA 3WE2A 4KYWA 3FXQA 1SAXA 4LGWA 1HKSA 2ETHA 5A2QK 1E17A 2LF7A 3K69A 3WTXC 5F6FA 1NHAA 1F1ZA 4HAMA 3S2WA 5HDGA 5LRSA 4GYGA 4UXNA 3GFIA 1EH6A 4KIBA 2HTSA 5LEJA 2HYGD 2V79A 3GFMA 3SQNA 1RUOA 4LB6B 2QUFA 3J80Z 3RTRA 5LEKA 3DF8A 2Z5UA 3E6CC 3KEOA 4G6DA 1Y0UA 3WE3A 4XRFA 2EWNA 4IVNA 3KP6A 4IRGA 4EJUA 2JPCA 1MZBA 2PBIA 4ESJA 5TRDA 3KP7A 2STTA 1S29A 2UWMA 2QBYB 4RB1A 2G7HA 5H6QA 4AWXB 4Q5SF 2OU2A 4ESFA 1B6AA 3K0LA 2UXXA 4HV6A 3L2CA 2GXGA 3EETA 2JTVA 1U8RA 1FYLA 2VBWA 4UVCA 3SHFA 3F8CA 1SD7A 5BMZA 2VC1A 2V1XA 2L4MA 4P9UA 2ZMEA 4IRIA 1P2FA 4MGRA 3U1DA 4MQVA 3BJOA 4HX7A 3E5QA 3LAPA 4U0YA 3REOA 5J6XA 1FLIA 4BH9A 1HSJA 1U5TA 2D1HA 2PN6A 3IHUA 2RDPA 2LKPA 5HS8A 2ACJA 3HIFA 5D8LB 4NQWA 2B0LA 2FQ3A 6PAXA 4G6QA 4CICA 2ESHA 2MC3A 3IWZA 3PQJA 5D5UB 4EJTA 4I02A 4LMYA 2M30A 1KQ9A 1R58A 3BROA 4A5NA 3IKTA 1BI3A 3L00A 5ICFA 1T6SA 4A0YA 1CF7A 2BEOA 5LHGA 5D5XB 2NNYA 1YO5C 2PLYA 1Z05A 1I5ZA 2ZXJA 5L3CA 4G9YA 1W7PD 4LJZF 5LGNA 2C6YA 2O6GE 2BV6A 4HF0A 4KN7X 1XDSA 2FMLA 1XDUA 1KYWA 3PQKA 2P6SA 4YFNF 4HF1A 2EFQA 3B73A 1LB2A 3FMSA 2XKOA 4D0PA 3H92A 4N0BA 4M73A 1KGSA 3M1EA 1J75A 1LEAA 2QLZA 5K5RA 3C7JA 4EM2A 1WI9A 2CW0F 4MQ9F 4OOIA 1U5TC 3E97A 3WG9A 3FWEA 3WODF 3HTUA 1TQPA 4GXOA 2IJLA 3F72A 1B59A 1W7PA 2G9WA 2XUBA 1UB9A 3V8LA 4ENNA 4FHTA 2X0LA 2HFHA 3COAC 3IKVA 1W4MA 2QVOA 1KA8A 1EH7A 3R0AA 4AIJA 1HBXG 2VC0A 2KJBA 3MCZA 1XGOA 3DQVC 3LQRA 2IA0A 3N97A 3I5UA 1QPMA 2VOOA 3QPHA 5D4SA 4ZYEA 2RKHA 3ML6A 1XSXA 3QOPA 4OMZA 2OQGA 1MKMA 2RC4A 5K5OA 1XSDA 2STWA 3MQ0A 4R1HA 2QWWA 3H3ZA 5HLHA 2HQRA 3E6MA 4U0WA 2P7VB 4JBAA 5H6RA 4ASNA 5D4RA 2HGCA 3SZTA 2IA2A 4BAYA 1FYMA 1U6GA 1FNNA 3I0TA 3NQOA 3R6SA 4Y13A 4G7HF 1S7AA 2RNJA 2A6EF 2EA2A 4A6EA 3P9CA 1IN6A 3KLOA 3FHZA 1K6OA 5ICCA 1Z9CA 1ZARA 2YU3A 4U0VA 2K7LA 4RGRA 4A2UA 1K78A 5ILSA 2HKOA 1G3YA 1UHMA 5H20A 4UV9A 1P6RA 5IT9Z 5AONA 4EJOA 2A68F 4L9VA 1FOKA 3WGGA 2A69F 5D6FA 1S3JA 3F8MA 4EQQA 3E6BA 5DDGA 2KKOA 3DV8A 2CFXA 3GZ5A 5LLQA 3ELKA 1O3RA 4WWCA 3I53A 3R60A 4ETSA 2OQRA 1HW2A 5ILUA 2H27A 2WWYA 2BGCA 2V6CA 1OYWA 2FSWA 4NB5A 5EEGA 1HXDA 2MD5A 1YS7A 3R0JA 2NYXA 1R22A 2RN7A 3SXYA 1XGSA 2HEOA 1AOYA 2F5EA 1B4AA 1FSHA 3L7WA 3LA3A 2BE5F 2COMA 1O57A 1IN7A 5FD5A 4TV7A 3BPXA 1JHFA 3RKXA 1J59A 3IL2A 1D5VA 1WQ2A 1TW3A 1SD4A 1F4KA 1K79A 2JSCA 1BC8C 1OKRA 2GXBA 2P8TA 1H9TA 1TNSA 3U2RA 3ZMZA 4Q48A 3RPQA 4KT5C 4L5JA 5HOOA 2IRFG 1XCVA 2FU4A 3GFJA 2XGXA 1R23A 4OU0A 1ZLKA 1SMTA 4O6JA 4RAYA 1TNTA 3OV8A 3I4PA 1OMIA 1PUEE 4AVPA 1BI1A 3WU0A 1HQCA 5BPIA 3NRVA 2YPRA 2P5VA 2K86A 1KU9A 3EYYA 4RGXA 1XB4A 4QLCU 3QU3A 5ILVA 1ZRCA 3O6BB 3T1BA 2MLKA 2ZKZA 5LHIA 2UXNA 1MD0A 3U9GA 4ZH4F 2O61A 2VN2A 2D2WA 1ZGJA 4KMUX 5L3FA 1TW2A 3O3KA 3AAFA 2W24A 1I6XA 2ZFWA 3SFZA 5AIQA 1XMAA 2XASA 5E20A 4F7ZA 3E6DA 2OD5A 3G73A 3ISPA 3TO6A 3ULQB 4LK0F 4L9JA 4QWQA 2GA1A 4ENMA 2PEXA 5FFXA 1GXQA 3EYIA 2E1NA 1U3EM 5HS9A 3FF5A 4Y17A 4BQAA 3FMQA 2W85A 2WTEA 3KETA 4R79A 3DP7A 1ZG3A 4PGGA 5CVVA 1D8JA 2QBYA 3CO7C 2YX4A 5FLXZ 1QO0D 3I59B 4JK1X 2DQLA 1MJAA 4ENKA 1XSVA 5E18F 4UVBA 2M8EA 2XRNA 4KDPA 3QP5A 4L9NA 4L18B 2HS5A 3C3WA 1O3QA 5HS7A 1ZRDA 2KIUA 2O0YA 2E7WA 5E17F 1P92A 1S6LA 4LB5A 2HOEA 4YIIA 2VE8A 2AXLA 3BWGA 5FO5A 1HSTA 1FP1D 2CWEA 2O3FA 4PDKA 2XV4S 3WGIA 2HYFA 3G3ZA 1FZPB 2PG4A 1IRGA 2VODA 1ZG1A 4ON0A 4I0BA 2OBPA 1ONVA 3LFKA 1YYVA