1T39A

Human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
151
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA binding and nucleotide flipping by the human DNA repair protein AGT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3'
total genus 30
structure length 151
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t39A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1t39A01
2OU2A 3KP6A 4IF4A 4A0ZA 5J8CA 2O0YA 3TKYA 1DP7P 2CWEA 2HYGD 4OIPF 3L2CA 3MQ0A 4I7HA 2L4MA 2BBYA 3GFIA 4L9NA 3ZMDA 3IL2A 4P96A 3E5UA 4BHBA 3I59B 2AS5F 1YFHA 4UV9A 1Y0UA 5CYVA 1KGSA 2COMA 4WXCA 1O3QA 1P4AA 2BE5F 1TNTA 4OOIA 4IRIA 3OOPA 2K02A 5DYMA 4KNYA 1EH8A 2VC1A 2M45A 2KRFA 3JSOA 3DKWA 1U5TA 2HGCA 2DBBA 4I2OA 1OYIA 1BM9A 5IT9Z 2L3DA 3Q9SA 4U0VA 1LEAA 4P9UA 2P5KA 4L5IA 3DXJF 5CVIA 1R36A 1I1GA 1T0FA 1C0WA 2IA0A 2HKXA 1BC8C 3TOAA 4HW0A 3V8LA 2OA4A 3ZMUA 4MEXF 1UHMA 2GA1A 3HSEA 5FFZA 1B4AA 3WU1B 4Q48A 2FA5A 5ILVA 5HOOA 2CSOA 2ZJ2A 1BN5A 4MEYF 4PGHA 4ENJA 4GCVA 4RS8A 1T6SA 5CVRA 3BPXA 2VT2A 5LEKA 4MQVA 3N4MA 2FF4A 3FXQA 2F5EA 4M9XA 4A0YA 2XAGA 4UVBA 1IRFA 2IJLA 3DV8A 1QPMA 1TQPA 1R7JA 1FT9A 1HSTA 1R23A 3CLOA 2HOEA 4G6QA 5LRRA 1LDKB 4GGGA 5E1ZB 2G7UA 5D8LB 4WXHA 5BMZA 3R6SA 5TRDA 1MGTA 1MD0A 4LK1F 4FHTA 2L02A 2ISZA 2R7FA 4GXOA 2HQNA 1WSUA 2EK5A 2NAZA 4FT8A 3HIFA 3EETA 5BS6A 2Y75A 3F23A 4O6JA 4U0WA 4KIGA 3RKWA 3ZPLA 4ESBA 4Y13A 4ZZLA 5J8FA 3WODF 3IKVA 2ETHA 2P5VA 3ZMVA 2P6SA 4BQAA 2Y48A 4UVCA 2QQ9A 1K7AA 2W84A 1KU2A 2J5PA 1CF7A 4P5OA 5HDKA 3QPTA 1YIOA 4NQWA 2CGPA 3KEOA 3M9AA 2QLZA 3LA7A 5BOXA 3FHZA 3U1DA 3VFZA 2QBYA 1T38A 5E8IA 4TV7A 3RKXA 2ZCWA 1U2WA 4BH9A 2E7WA 1TTYA 3WG9A 1Q1HA 1XB4A 2PI0A 3QPHA 1FPQA 5BQTA 3KLNA 3SXYA 4A0XA 1J59A 2V1DA 5H6QA 1V3FA 3F3XA 3GLXA 1IN5A 3KEQA 1QBJA 5E8GA 1G3TA 1IN4A 2L4AA 5FLXK 4HOBA 3IHUA 1B6AA 2KIUA 1B9MA 4EVIA 3KFWX 3GFJA 3T5XA 2RV8A 1HBXG 5D5XB 1A04A 4Q5SF 1YS7A 2FSWA 3J80Z 2DTRA 2MLGA 4XRFA 3QU6A 3BOQA 2NNNA 4M72A 2VE9A 4GYGA 1P4XA 2FEZA 1F1ZA 1K78B 1YW9A 3F8NA 1J7KA 3H3UA 1W4MA 2VC0A 3GUDA 5D5WB 4G6DA 4AIHA 2FXAA 2H6BA 1E17A 2F5DA 5BPDA 1F5TA 2VT3A 4Q4ZF 3WTVC 1SFUA 5ICGA 2NYXA 3KP7A 4LMYA 4HV5A 1ZYRF 1U6GA 3FMQA 1LQ1A 2DAOA 5EEHA 2LKPA 5IT9K 3GFLA 3F8CA 1O7FA 2EA2A 2JTVA 5JI6A 4RAYA 4UHTA 2A68F 2OQGA 1LNWA 2H94A 2YPRA 1WQ2A 3RYPA 4FX0A 1ZGJA 3FMSA 3V7RA 3F21A 2MC3A 3SZTA 5LGTA 2EWNA 4HDUA 3RDIA 2KJCA 3L09A 5HS8A 4KDPA 1IXSB 2A3SA 2QENA 2FNAA 1FYMA 2O8XA 1H0MA 3FM3A 1MDMA 1SD7A 2PBIA 1J0RA 3I71A 2VE8A 4HV6A 3M7GA 4O3MA 2D45A 4HF0A 2ZNZA 3F72A 2A6EF 1BIBA 1YS6A 3V8JA 2XGXA 1D3YA 5L3DA 1IW7F 2RC4A 1MZBA 1XSXA 2W24A 5DCMA 4XLPF 3KETA 2CYYA 2EV5A 1YYVA 3EDPA 1CGPA 4RGSA 2QM3A 5D6EA 5D4SA 2ACJA 2EFNA 3R0JA 3EQLF 5D8KB 4EM0B 1ZG3A 3TQNA 3CUQC 3C7JA 4E70A 1YTYA 1FNNA 4ZH4F 2XROA 1FC3A 5EEGA 5K5QA 1SFXA 2IRFG 2DU9A 2XUBA 4MNUA 1PP8F 1T39A 2EFOA 4L5JA 2YX4A 5ILSA 1D5VA 3HRUA 4KUMA 3MEXA 1K78A 5BPIA 3T8RA 3K9TA 1FX7A 1XGNA 1J5YA 2OD5A 3LA3A 1AWCA 1LDDA 1S8NA 1I1SA 1AOYA 3JSPA 2DT5A 4HQMA 3IRRA 3CJNA 1LEBA 3D0SA 4YG2F 1Z7UA 3FF5A 4YFKF 2CQKA 2PEXA 2C6YA 3C1DA 2Q2EA 4EM1A 2FE3A 1I6XA 1K6OA 4MTEA 1U8RA 5ILUA 5L3GA 5A2QK 1H9GA 4ETSA 1G3YA 5J6XA 4G7ZF 3WTZA 1GVJA 4ZZDA 1ZHFA 1J2XA 5KK1A 4WX9A 2ZMEA 1RI7A 5AIPA 3SHFA 5DDGA 3V7SA 1BIAA 4M6XA 1JE8A 3C3WA 2Z99A 2Z33A 2X0LA 5DD8A 1QQIA 2CO5A 3T0YA 3OV8A 3WE2A 3HHHA 4MHGA 1HXDA 1TLHB 2ADUA 4M6YA 2GXGA 2IA2A 3K0LA 2DK5A 1FOKA 3COAC 1KU3A 2ZFWA 2BEOA 2XIGA 5LEJA 2BV6A 3QU3A 3TDZC 2IW5A 4PZJA 1DUXC 4I01A 3F6OA 3KZYA 2AXLA 3F22A 1KU7A 2ISYA 1PUEE 4CYDA 1BBYA 2X4HA 4M74A 2Z3YA 4KFCA 3DQVC 5LHIA 1PDNC 1S3JA 3LA2A 4HQEA 3J81K 1P92A 2XVCA 2ZNYA 4BHCA 1R5HA 1YG2A 5D5UB 1LJ9A 4L0YB 2O6GE 3M8FA 3E3VA 2VXZA 4OMYA 5JVTA 2WV0A 2V1UA 4AWXB 3KE2A 2XV4S 2R3SA 1B59A 3E6BA 3NRVA 2G7HA 5DEQA 3G73A 2WWYA 4LLGF 3FXUA 1Z6RA 2D1HA 3E5XA 3BJOA 4U88A 2DW4A 3CDHA 1ZRFA 3LFKA 1XCBA 3DEUA 3WTSC 5CJ9A 3LWFA 3FXRA 2QZ8A 2DPUA 3J7AO 1U3EM 3ULQB 4A6EA 5L3CA 4CDGA 3SFZA 1G3SA 2IPQX 5HLHA 4K2EA 3P9IA 1B1BA 1TW2A 3BROA 4AIKA 4ENNA 3JW4A 2GAUA 3IWFA 2PMUA 1XN7A 1KA8A 2V1XA 1GXPA 5E20A 1STZA 3RJPA 3TDUC 3VOEA 3R60A 1MJAA 1ZG1A 2P7CB 3SZPA 1LDJA 3GXOA 4KMFA 2A69F 2VBXA 2KJBA 2Y0MA 3BJ6A 4KN7X 4IJAA 3ZP5A 4CICA 2W25A 2D2WA 3K1MA 3F8FA 1MKMA 3DPTA 1ZRCA 4LLLA 1R1VA 1TQMA 1HQCA 5LBQA 4I0BA 5JHUA 3U9GA 1MJ9A 3VODA 4XSZF 4NB5A 4LG0A 2M5WA 2RVCA 4OINF 5CLSA 4GYIA 2CFXA 4OIQF 1G4DA 2FNPA 3ECOA 5KVRA 4B09A 4ENMA 1BI0A 3ZMZA 1ULYA 2VBWA 3CO6C 4U7DA 2OZ6A 3R0AA 3ZMSA 2EFQA 2Q8KA 3JTHA 2XKPA 2QYOA 2QBYB 2E1CA 2LNBA 1V4RA 3HUGA 1IXRC 3IWZA 3IKTA 4AIJA 1XCVA 2D1VA 5FB2A 3WTUC 2JPBA 4L9VA 3I4PA 2HTJA 1FZPB 3G3ZA 3N97A 1EV7A 2EJRA 1FBSA 1TQIA 1ZRDA 1FP2A 5HDNA 1XSDA 1O57A 1DPUA 2KIMA 3I64A 5DV5A 2UZKA 2KKOA 4M9SA 5FGMA 3P9CA 2FBIA 1F9NA 4BHPA 3MCZA 1MJBA 2A5YB 1S7OA 3K69A 2HZTA 1IN7A 2DPDA 3GWZA 3SQNA 1W5SA 4EJWA 5DCFA 2XAHA 3K2ZA 1XSVA 2RQPA 4O5VA 3VB2A 2JRTA 1R1UA 3D5LA 1S29A 1W7PA 5IT3A 5K5RA 4A5MA 1FYLA 1R00A 2VBZA 5F6FA 4KIFA 2K7LA 3WTYC 2XAJA 1RUOA 2K86A 5A2QZ 1ZAOA 4M9ZA 3L00A 4G7HF 2EA4A 1K79A 4CZZA 1L3LA 2PMHA 1KQ8A 1ZARA 2EV0A 4F7ZA 1OKRA 1OPCA 5E1WA 1G6NA 1W7PD 4N9IA 1DDNA 1FBUA 3W6JB 2J5OA 4G9YA 2M8EA 1Z05A 5HVQC 5DUKA 2XRNA 2H09A 5AIQA 1HKSA 1XDUA 5TJJA 1R5GA 4U0YA 2O03A 2MA3A 2V6CA 1KYWA 4L0ZB 3F8MA 4CGZA 1USSA 4HX4A 2PJPA 5L3BA 3WTTC 2L01A 2IVMA 2M30A 4I0AA 1I27A 2JSCA 2PQ8A 4RGXA 5K5OA 2FMLA 2DLLA 3BJAA 3L7WA 3NEUA 1QNTA 2OZUA 1BI3A 4G8XA 1HW5A 4L18B 1D8JA 3I0TA 3RIRA 2RN7A 2HEOA 3KP3A 4WWCA 2ZXJA 3F8BA 5E18F 4EJTA 2E1NA 1HW2A 3H3ZA 2P5LC 2DI3A 2B0LA 3VEPA 2PG4A 4UUVA 3B02A 3GF2A 4LB6B 4ESFA 3RPQA 4OU0A 1GXQA 4HX7A 3TO7A 3HSFA 3QRFF 3L9FA 3NQOA 1IZ1A 5ICEA 4CXFA 2F5FA 3S2WA 1OYYA 2BGCA 5HLIA 2IP2A 4ESJA 3ROUA 3MZYA 2YR2A 5DUIA 3HOSA 1T98A 4A2UA 4KICA 2FU4A 3BP8A 1EH6A 2IT0A 5L3EA 3FWEA 2XKOA 3CTAA 5JR3A 2OBPA 4RB0A 3ZMTA 3ABUA 1O3TA 4BAYA 4LG0B 3HHGA 2IA1A 3O6BB 2RNJA 1CF7B 5ED4A 3K1PA 1P6RA 4L9TA 5HDGA 4KT5C 5LRSA 1XMKA 1IXCA 2CG4A 1BI1A 2GZWA 2Z5UA 1O3RA 1LB2A 3EUHA 2LF8A 4I98B 5LHGA 2NS0A 4IHSA 1FSEA 4MGRA 1ZLJA 4KYWA 3BDDA 2LSOA 4JQFA 1SMTA 3I58A 3EYIA 1FSHA 3E5QA 4CO8A 2WC2A 4RGRA 2L54A 3RYRA 1FWZA 2OAZA 4GO1A 4HYEA 3O3KA 3Q9VA 1R58A 1BOAA 3V4GA 4NHJA 4Y15A 4LFUA 1O7LA 1YLFA 5E1XA 2NRAC 2R7DA 1L0OC 5CVJA 2FOKA 1J75A 4D0PA 4YFXF 3MZHA 1Z9CA 3GZ5A 4IHTA 4JK1X 5FD5A 5FLXZ 2A61A 2MH9A 3KP5A 4P9FA 1FY7A 1KYZA 4YIIA 4ZYDA 1XD7A 6PAXA 1I5ZA 4KMUX 4LGWA 1S6LA 5ICCA 4LB5A 3ABTA 2HKOA 3TGNA 3WU0A 2VN2A 2K27A 3PQKA 3M1EA 5F1RA 5D5VB 1ZN2A 1USTA 3WGIA 4A6DA 1IF1A 2O3FA 3LSTA 5DCMB 3ZN1A 2LDUA 1R1TA 1IUYA 1FBQA 3HSRA 2NNYA 1TBXA 1TW3A 3E97A 1QO0D 2BYVE 3BWGA 1SD4A 2DO7A 1ZLKA 3I54A 1S7AA 2A07F 3ERED 4BXUA 4R79A 2ZO4A 4WF2A 2WTEA 4UXNA 1ZGAA 3BZ6A 3GX4X 4RB1A 2PFBA 4H0EA 1UB9A 4QLCU 3DFGA 4MQ9F 4WXDA 1UCRA 3WTWC 1OR7A 3MWMA 4PCQA 1SFEA 1ZG5A 2OQRA 2DFIA 4HX8A 4EJOA 1O3SA 1OYWA 4YFNF 3FM5A 5DD4A 4ZYEA 1IRGA 4P55A 2M87A 3EYYA 4HAMA 4AD9A 4LD5A 4XBFA 1W5TA 3T1BA 1RIOH 2DQLA 2ESHA 4OIOF 1YW8A 4UVAA 2HR3A 3BY6A 4I09A 3REOA 1FLIA 1D8KA 3PQJA 2ZMEB 5L3FA 3DP7A 5LHHA 1KQ0A 3RKYA 5E17F 2XAQA 2UXNA 4RB2C 3KP2A 2F5CA 2EFPA 3RTRA 1FYKA 4JBAA 3KLOA 3DPLC 3TOBA 1U5TB 3LQRA 4HZFA 5HS7A 3GYHX 4OMZA 1T2KA 4YIFA 4IVNA 2XHKA 2P7VB 1WRJA 1QZYA 3HOTA 4LK0F 3E6CC 4R1HA 3LQQA 2JZYA 3CUOA 5CVUA 2QVOA 1BI2A 2VODA 1IN8A 1NHAA 1GHCA 4BYYA 2W85A 2ELHA 1JHHA 3MAJA 3K1NA 5JFRA 1XGMA 2YX7A 1TNSA 4ENKA 3TO9A 1P2FA 4QWQA 2FMYA 3BPVA 3GEZA 4Y17A 3Q5FA 2FBKA 3J80K 2TDXA 3QP6A 4U7BA 4B8XA 4HLXA 4EGYA 3GO5A 1RNLA 1JXSA 1B9NA 1R22A 2QQAA 3LAJA 3I5UA 4KIBA 2RDPA 4G94A 4ZYHA 2G9WA 1SMYF 2STWA 1SD6A 2EFWA 2H27A 2FRHA 1ZH5A 3B73A 1BJAA 2QQBA 3H92A 3V7CA 1HW1A 3QOPA 1UFMA 5HS9A 4PGGA 5LLQA 4IRGA 2VOPA 2PLYA 3FMRA 1RUNA 4S04A 1E2XA 1DPRA 1KU9A 3M8EA 2GQQA 1BC7C 1KQ9A 3CUQB 4LLNA 3IRQA 3F6VA 1HSJA 1F4KA 3WTXC 1WKMA 2H6CA 4KA4A 2V79A 1W7PB 1XMAA 4IXAA 2HQRA 1WWXA 2FQ3A 2W57A 4HF2A 1EH7A 4M73A 5D4RA 1JHFA 3WE3A 4Z2YA 2MH2A 2RKHA 2HFHA 1SAXA 3C18A 1WI9A 4EMSA 1MDMB 2GIVA 2K4BA 4IRHA 4M71A 2FBHA 2K4JA 2YSRA 1P4WA 4MTDA 1YQAA 4LJZF 1J9IA 5K1YA 2P4WA 2QWWA 2UXXA 3CO7C 3I59A 5FFXA 1U5TC 1Z91A 5H20A 4R8HA 1LVAA 4ZYGA 1IN6A 2UWMA 2JPCA 3QP5A 3E6DA 3HRTA 2XASA 4EJVA 3R61A 5FO5A 4HF1A 2MBFA 4KN4X 4G7OF 1IAWA 1SD5A 1ODDA 3GZ6A 3E6MA 1XGSA 2HS5A 5D6FA 1QZZA 4Q47A 4WK8F 2GA2A 2GWRA 2KIFA 1HKTA 1HKQA 3HTSB 3T8TA 3DF8A 3GFMA 1FP1D 3KZZA 2PN6A 2A6HF 2Q0OA 3AAFA 5FD6A 1REPC 2EV6A 3IC7A 4IPAA 2STTA 5F64A 3JAMK 3I53A 4HDVA 3ZN0A 2VONA 1YW7A 1XDSA 3U2RA 4XLNF 4UNOA 5ICFA 1XGOA 4RB3C 4HBLA 3FX3A 3V8KA 4N9HA 2HDCA 2XAFA 2HWVA 2HTSA 5LGUA 4FX4A 4DQ2A 2P6TA 4EM2A 4N0BA 2Z9OA 3FZVA 3HTUA 3JAMZ 2O61A 4EGZA 2DQRA 2MD5A 1Z1DA 2JT1A 2QUFA 3KP4A 5HLGA 3HRSA 4S05A 2ZKZA 3KCCA 2HYFA 4RAZA 3O2PE 3ML6A 3JTGA 4RGUA 3MFKA 2VOOA 4ASNA 2F2EA 1Z6TA 4XSXF 4HA8A 5H6RA 3ELKA 1ONVA 3P7NA 2YU3A 4EQQA 1G3WA 5AONA 4A5NA 2P8TA 4EJUA 1VTNC 3ZQ7A 2V9VA 1ZREA 5ERIA 3LAPA 3CUQA 1RZ4A 1JGSA 1ON2A 4ON0A 3ECHA 4UV8A 3GW2A 3W6KB 4L9JA 2CW0F 1UHWA 1OMIA 3PFIA 2RGVA 1PP7U 2VBYA 2DK8A 4DNCA 4EV0A 4WCGA 4CHUA 3J81Z 3WGHA 2GXBA 4OIRF 4A12A 3HYIA 1YO5C 3P9KA 3QAHA 2M1BA 5CVVA 4AVPA 4BNCA 4PDKA 4HLYA 3RPUA 4I02A 3RI4A 2LF7A 3HRMA 2ESNA 2E7XA 2EB7A 3R4KA 3ISPA 1QGPA 2MLKA 1U78A 1H9TA 2ZBKA 1X3UA 3GVAA 1ON1A 5LGNA 3TO6A 3WGGA
chains in the Genus database with same CATH superfamily
2K40A 2OU2A 3KP6A 2IAIA 4IF4A 4A0ZA 2R0QC 5J8CA 2O0YA 4FTHA 2OJED 3CCSI 2ECBA 2YTQA 3TKYA 2KONA 3OYDA 1DP7P 2CWEA 2ELJA 2HYGD 4BUPA 4OIPF 3BTJA 1YJWI 3L2CA 2KLOA 3MQ0A 1A35A 4I7HA 4CCNA 2Q2EB 1X49A 2L4MA 3VDXA 2R7XA 2BBYA 1OCPA 2L8TA 2KFDA 3GFIA 4L9NA 3ZMDA 3IL2A 4P96A 2NOJB 2MC6A 4PJLA 3E5UA 1OFCX 4DZJA 4UY8I 2EMZA 2NA2A 4BHBA 3I59B 2B9DA 2AS5F 1YFHA 5LL6R 4UV9A 2LC2A 1VQPI 1ACIA 3BBGA 1Y0UA 3VYRB 5CYVA 1KGSA 2COMA 3AV0A 3AG3H 5FLXC 1NTCA 1LUJB 3ABLH 2OCEA 2JQ7A 4WXCA 4B47A 1NH3A 3IAM2 1O3QA 1P4AA 4WPYA 2BE5F 5GPAA 1TNTA 4OOIA 2EPNA 4JI6E 2VJIA 4IRIA 2RPCA 3OOPA 1D0XA 2K02A 5DYMA 2DA6A 1T4LB 4KNYA 4LF4E 1EH8A 3W6VA 3PO2J 2VC1A 2M45A 4UUSB 3CJQB 1IGNA 1UG2A 2KRFA 1S72I 3ADJA 3G1OA 3JSOA 3DKWA 1U5TA 2HGCA 5FLMJ 2DBBA 4I2OA 1XMXA 3HEFA 1OYIA 2KPMA 3KYDB 4I99C 2B3TB 1BM9A 3H5AA 2L3DA 5IT9Z 2XAUA 3AG4H 5B1BH 3Q9SA 4U0VA 1ZU1A 3JRCA 1LEAA 4P9UA 2P5KA 1X58A 4L5IA 3DXJF 2GPIA 5CVIA 1R36A 2ZJRF 1FOXA 2K9SA 5GTIC 3ABKH 2FTXB 1I1GA 1T0FA 2V9KA 3QG5C 1C0WA 2IA0A 4F9AB 2HKXA 3H9GA 1BC8C 2JRMA 3TOAA 3OYKA 4HW0A 3V8LA 4BE2A 4FETA 2IGKA 2OA4A 3HPSA 3ZMUA 2CUJA 2EPZA 4MEXF 5KL7A 1UHMA 2GA1A 5BR8E 3HSEA 3ECRA 5FFZA 2A25A 1ZQ3P 4UB6C 1B4AA 1TL8A 3WU1B 3CDLA 1AKHB 5FRNA 2K4VA 1S5LC 3IH4A 4V19K 3CF2A 3N05A 4Q48A 2FA5A 4LF5E 5ILVA 2EPOA 3CQZJ 2E36A 4LIVA 1SVMA 2EWLA 5HOOA 2CSOA 1N34E 1U9NA 1BN5A 2R4GA 2ZJ2A 4MEYF 4PGHA 2LY2A 4ENJA 2EILH 4GCVA 2F4IA 4F91B 4RS8A 1OCTC 2EM0A 3RQIA 1NG6A 2JUGA 2Z1DA 1TWCJ 1T6SA 5CVRA 3BPXA 2VT2A 5LEKA 4MQVA 3N4MA 1FMVA 3E7LA 3MVPA 2VKEA 2GIZA 4A3MJ 2FF4A 2M2EA 3PUFA 5IOZA 1X1CA 3FXQA 4RA2A 1OCCH 4J00A 2F5EA 4M9XA 3J7ZI 5AE2A 4A0YA 2XGDA 2XAGA 4NUBA 4BU2A 2DLQA 4UVBA 1IRFA 3JRAA 2EIKH 2IBDA 2X6WA 2IJLA 3BT9A 3DV8A 3LSGA 4QTRA 1QPMA 1TQPA 1R7JA 1FT9A 2UUZA 1HSTA 1R23A 3CLOA 3PFYA 2WB1N 4CCJA 1SFOJ 2XC7A 2GXAA 4FQGA 3GTJJ 1ETWA 4BBRJ 3LNQA 1AA7A 3H9JA 2JOXA 2HOEA 4G6QA 3CCRI 1SVOA 2COBA 1W0UA 3QYEA 5DNYA 2QSGX 5LRRA 4DV3E 1P7JA 2GM4A 4DYCA 4R2CA 2VKDA 1ZR4A 2UUAE 1LDKB 4DV1E 1Y8QB 2ZXHA 5EEAA 4BJ6C 2DDAA 4GGGA 5E1ZB 1U8BA 4DYQA 1DGCA 2G7UA 5D8LB 4WXHA 2LLKA 3OYCA 1YRNB 5BMZA 3R6SA 5TRDA 1MGTA 2YS9A 1MD0A 4D5CA 4LK1F 4FHTA 4E7KA 2E2HJ 2L02A 3G1LA 3SZGA 3IWCA 2KISA 2VLAA 2EMFA 4A3JJ 3K10A 1B8IA 2ISZA 1ETOA 3CCUI 2R7FA 4GXOA 2X1CA 3TQMA 2HDDA 1NEIA 1K4TA 5K7HA 4X0GA 3L2QA 2HQNA 2E2JJ 2CRGA 1G2HA 4FK5C 4BY1J 5JVGF 2JA2A 4E6KG 1R4NB 1WSUA 2EK5A 2NAZA 1PDAA 4FT8A 1PKPA 3G2BA 3HIFA 4NC7A 1GLNA 2EN6A 2K9NA 3EETA 5BS6A 3HL2A 2Y75A 3F23A 4O6JA 4U0WA 3HPHA 2FQ4A 4KIGA 3GZNB 3RKWA 3ZPLA 5IYCJ 4ESBA 4Y13A 3UNGC 2ODRD 1RC7A 4X1EA 4ZZLA 2GOXB 3H36A 5J8FA 1IBLE 1DGWY 3IKVA 3WODF 4Y52J 1WJPA 2ETHA 2P5VA 5ADZA 4ANJA 3ZMVA 1B72B 2HHHE 4JI4E 2RSIA 2P6SA 4P78A 4BQAA 2Y48A 4UVCA 2QQ9A 3PUBA 1BJZA 1K7AA 2W84A 1KU2A 2J5PA 1CF7A 4P5OA 4L5EA 2NVYJ 5HDKA 4NZVA 3DLAA 3QPTA 3ZOQB 3CD6I 3RSNA 4AC0A 3SEZA 1RPWA 4K0KE 2LBFB 1YIOA 4NQWA 2CGPA 3KEOA 3M9AA 1K61A 2QLZA 4Y3OA 3LA7A 5BOXA 2JY9A 3FHZA 3U1DA 3VFZA 2QBYA 2Y30A 3K4JA 1MMSA 2QCOA 3F6GA 1T38A 2XF5A 2Z16A 4YEJA 2VXDA 4TV7A 3RKXA 5E8IA 5F0HA 2ZCWA 3BG5A 2H36X 2RNGA 1X3ZB 1MW7A 1S7EA 1H89C 1U2WA 4BH9A 2DFHA 4NDLA 2BW3A 3Q0UA 2E7WA 3PNYA 1TTYA 3WG9A 5BNGA 1Q1HA 1XB4A 4BMJA 2PI0A 4BS9A 3QPHA 1J09A 1FPQA 5BQTA 3DWLE 3KLNA 3SXYA 4A0XA 1J59A 5IWAE 2V1DA 3CP2A 5H6QA 1V3FA 3F3XA 3FXJA 4J19A 2ZSIB 3G4SI 2IS4A 3GLXA 2O5RA 1IV8A 2DMIA 1IN5A 3KEQA 1VQ9I 3BTIA 1QBJA 2WBSA 5E8GA 1MH4A 1G3TA 1IN4A 2L4AA 5FLXK 1T08B 3CMAI 2ENAA 4B43A 1D5YA 1K4SA 4HOBA 3IHUA 3CESA 1B6AA 2KIUA 1WHQA 2LMDA 1JT6A 4R2AA 3CP8A 2VI6A 4XLAA 1B9MA 2JMWA 1I6HJ 4EVIA 2RTXA 3KFWX 3EPZA 3GFJA 3T5XA 2RV8A 3J7AG 1B72A 1HBXG 5D5XB 1A04A 4Q5SF 1YS7A 2FSWA 2BBGA 1EKEA 3IAS2 3J80Z 1OQYA 1MBKA 2DTRA 3SFIA 2MLGA 4XRFA 5M5YJ 3QU6A 3BOQA 4XOPA 1TN9A 2NNNA 4PFOA 4DUZE 4M72A 5CFFE 2EPAA 2KL4A 2MSYA 1TF6A 2E34A 3OYAA 4DKKA 4NQWB 2VE9A 2EM3A 4GYGA 5CPRB 3HOYJ 1VQ6I 1N33E 1P4XA 3CCEI 1A1HA 2FEZA 1F1ZA 1K78B 1X48A 1UHSA 1YW9A 2FD5A 3W3CA 1E3HA 2EM7A 3A1YA 3F8NA 3K4MA 3S1MJ 3M1CA 2EOEA 1WHNA 4B44A 3EPHA 1J7KA 2ZMEC 4KT6A 2CV0A 3CC4I 2L0KA 2QGUA 3H3UA 1W4MA 2VC0A 4ZYAA 3W2WA 5KHDA 5E79C 1YHQI 3L2RA 2VPLA 5AASA 3GUDA 5D5WB 4G6DA 4AIHA 2FXAA 2M8GX 1J26A 1T95A 1V5GA 2H6BA 1E17A 1GZ6A 2F5DA 3A01B 5BPDA 5A2QC 4NXME 3DBLB 4HSRA 1FIPA 3MKZA 1F5TA 4HRIA 2MW8A 2NUFA 2VT3A 5EG0B 4Q4ZF 3WTVC 2R93J 3GLLA 2HU9A 2ZXIA 3S3MA 1SFUA 2R7WA 2HOAA 3IH2A 5ICGA 2NYXA 3KP7A 3THOB 4LMYA 4HV5A 3M8JA 1PJTA 1H8AC 4GDFA 3KPHA 1SC7A 1MIJA 4F92B 1YPNA 1A1IA 3OYNA 2F8BA 1ZYRF 3DU6A 5FJ8J 4M3FA 3KYLA 1I3QJ 4LOCA 1U6GA 3FMQA 1LQ1A 4JI0E 2DAOA 5K7FA 5F27A 2P0WA 5EEHA 2ZJQF 3RKQA 2LKPA 3JRFA 5IYDJ 3JRDA 1VF9A 3A4CA 1Z7LA 3HM5A 5IT9K 1QHGA 3GFLA 2Y69H 3F8CA 3ZCOA 1XNQE 3EPJA 3PIOF 1O7FA 2EA2A 2JTVA 1MNDA 3CCJI 2IGNA 5JI6A 4RAYA 4UHTA 4A3KJ 4BCAA 4CSWA 2A68F 2Y31A 4BL0B 1Y56A 4HEA2 2OQGA 1X4OA 1LNWA 2H94A 2YPRA 2R5ZA 2R92J 1WQ2A 3BR5A 2DFFA 2EIMH 1Y0NA 2K9LA 1T0FC 3JTZA 5JHFA 3RYPA 4FX0A 3OYJA 1ZGJA 1D1CA 4CCOA 3FMSA 3IWDA 3V7RA 3DKXA 2EQ3A 2MC3A 3SZTA 3F21A 3U1KA 3HPGA 1ITYA 5LGTA 1WJDA 1Z21A 2EWNA 4HDUA 3RDIA 2KJCA 2DMUA 3L09A 5HS8A 3BIDA 2WAQN 4KDPA 1IXSB 2A3SA 2CFOA 2FNAA 2QENA 3TW7A 3ZOBA 2WY7Q 3AG2H 3OYFA 5KNLA 1FYMA 9ANTA 2CSHA 4BXFA 2KT0A 2O8XA 2ZJPF 1H0MA 1N25A 3FM3A 2EL4A 1MDMA 2BHYA 1SD7A 2PBIA 2ELYA 1J0RA 3I71A 1WJCA 2AO9A 2VE8A 3M3YJ 4HV6A 4AYBN 1IMUA 3ZQIA 4M6VA 3M7GA 4O3MA 1HC8A 2JSPA 4B3ME 1R6RA 1WH7A 2IGMA 2D45A 2B7VA 4HF0A 5AC4A 1HF0A 4A3LJ 2ZNZA 3OOUA 1OISA 3F72A 2A6EF 1BIBA 1YS6A 3V8JA 2XGXA 1WH5A 4CH7A 2WAFA 2M34A 1D3YA 5L3DA 4Q35B 3AL0B 3ABMH 1N32E 1IW7F 2ME6A 2RC4A 2QQ8A 4FE4A 3H0DA 3OSGA 3BZKA 1MZBA 2JVGA 2M9HA 1X3WB 2EN1A 4G12A 1UBDC 2CQQA 2VQEE 2JR1A 2JWTA 1XSXA 2I13A 1D1BA 3GTLJ 2MG4A 2W24A 1JI8A 5DCMA 3I3LA 4XLPF 1WVRA 2CYYA 2EV5A 1YYVA 3KETA 3S8PA 2KRCA 3EDPA 1CGPA 3MHSC 2EMKA 4RGSA 2EMCA 2QM3A 5D6EA 5D4SA 2ACJA 2LTRA 1FTZA 1MBEA 2EFNA 2Q8UA 4CCMA 2R5YA 3SDBA 1PUFB 3MHHC 1G8XA 4WFTA 4JP0A 3R0JA 4F9CB 2DA7A 3EQLF 5D8KB 4EM0B 4B4CA 1ZG3A 3OYIA 3TQNA 3CUQC 2WV1A 3C7JA 1OJLA 4E70A 1YTYA 1FNNA 4ZH4F 2XROA 2VQCA 1FC3A 2DU9A 2XUBA 1SFXA 2CW7A 5EEGA 3BQYA 5K5QA 1X19A 5TISC 2IRFG 4MNUA 3L2VA 1T39A 1PP8F 2EFOA 4L5JA 1X5WA 3DEEA 2UXCE 2YX4A 2EMHA 3J7YJ 5ILSA 1D5VA 3HRUA 4KUMA 3MEXA 3VPRA 1K78A 5BPIA 3HDDA 4I6ZA 3T8RA 4B3RE 3K9TA 1FX7A 1XGNA 1J5YA 2OD5A 3LA3A 4N4NB 1AH5A 2VE7C 1ZTRA 3M07A 1AWCA 1LDDA 3DPUA 1S8NA 2B7EA 1AOYA 1I1SA 3JSPA 2L5QA 2LY1A 2DSYA 4LF6E 2LKSA 1MMGA 2DT5A 4HQMA 3HJEA 2LRDA 2M4KA 1P7IA 5FLVA 4I76A 3IRRA 3CJNA 3QPSA 1LEBA 1WGXA 4C3JJ 1QU6A 3D0SA 4YG2F 1Z7UA 3BG6A 3OIOA 3B6AA 4H4KC 3FF5A 4HSTA 3PJRA 4YFKF 2CQKA 2WZOA 2LYCA 2PEXA 5J1RA 3P5JA 5GADJ 2C6YA 1XS9A 3C1DA 4LF7E 2Q2EA 2R7UA 4EM1A 2FE3A 2E1MC 3S93A 3J7Yp 1I6XA 3B6CA 1GV2A 1K6OA 4MTEA 4Q28A 4FCYA 2TRTA 5ILUA 1U8RA 2BB8A 4KWYA 3BQZA 5L3GA 5A2QK 2DOEA 2FV4B 1H9GA 4ETSA 1G3YA 5J6XA 4G7ZF 2CH0A 1A36A 3WTZA 1ZELA 1GVJA 4ZZDA 2KHMA 3A0HC 5F08A 5KCMA 3UK3C 2L2KB 1ZHFA 3K6GA 3H35A 1J2XA 5KK1A 2Z2SB 4WX9A 1SEUA 2ZMEA 1UG0A 1Z1BA 1WCMJ 1RI7A 3PNTA 5AIPA 1IUFA 3SHFA 5DDGA 3VSKA 1VI0A 4RHBB 2K7IA 2VIXA 4GKJE 3V7SA 1BIAA 2E5ZA 2JA5J 3DCFA 2KIQA 4M6XA 1JE8A 4F55A 3C3WA 2Z99A 3H9QA 2Z33A 2X0LA 5DD8A 1QQIA 2CO5A 3T0YA 2LBFA 3OV8A 3MZ8A 5TSEA 2ADRA 3WE2A 3PSFA 3S2HJ 5KL4A 2TCTA 3HHHA 3IP4B 3K4LA 1QVTA 4NNJA 3BLYA 5KL3A 4XNFA 4MHGA 2KMUA 1HXDA 3J7AY 3UKGA 1TLHB 2ADUA 2DYRH 1GUUA 1X6EA 4KITB 2K3FA 4M6YA 4QSHA 2GXGA 2JOBA 2IA2A 4V2GA 1OCRH 3K0LA 3IH3A 2DK5A 1FOKA 2OC6A 4R2QA 4PJNA 3FBIB 1Z67A 1XX5A 1KU3A 4PJMA 2X6OA 3COAC 1A1KA 4B3SE 1UAAA 2CQXA 1LFPA 5IPAA 1W5CC 2ZFWA 2OF7A 2BEOA 2XIGA 1A5JA 3AUZA 5LEJA 4B48A 4DR2E 2BV6A 2W4SA 3QU3A 1WJAA 2HQ5A 2DJNA 3TDZC 2IW5A 3I56I 1MMDA 2EH3A 4PZJA 2WAQA 5JLWA 1JJ8C 1DUXC 3C2GA 4I01A 1X6HA 2NUEA 5A6KA 1JJ6C 1DU0A 3F6OA 3KZYA 1A6QA 2AXLA 1R71A 3F22A 2JVAA 1KU7A 1ZK8A 2ISYA 3KIOA 3VYTB 3H09A 4DV7E 1GQEA 2HPIA 1PUEE 4CYDA 1BBYA 1XPXA 3LSJA 2XF6A 2YU5A 1T4NA 2X4HA 2R7QA 4BDZA 3P1XA 4M74A 1OCZH 2Z3YA 4KFCA 2XPVA 2VRDA 2UXDE 2L7MP 3DQVC 2CT1A 2VF1A 5LHIA 1PDNC 3ASOH 3LOCA 5E3MA 1S3JA 2R7RA 3IWBA 3LA2A 2XSJC 3H1CA 1AHDP 2N3HA 5IP6A 2XPWA 3AL0C 4HQEA 1JUSA 4DV5E 3J81K 2RQLA 1P92A 2XVCA 2ZNYA 4BHCA 1R5HA 1YG2A 5D5UB 1LJ9A 4XKVA 2EN3A 4L0YB 3OYGA 1A1GA 2O6GE 3M8FA 3E3VA 4DZPA 1R4MB 2VXZA 4OMYA 4Z6YA 4CZCA 4BC9A 1VQ5I 5JVTA 2I8DA 2CS3A 2WV0A 1A31A 3OS2A 3VYYA 4M0VA 2V1UA 1YRNA 5J3LA 2XB5A 1EJ9A 2OPTA 4XQFA 4AWXB 1I3AA 1MBJA 3KE2A 5IT9C 2XV4S 2W48A 3CCMI 2LV2A 2JA8J 2R3SA 1B59A 3E6BA 3NRVA 2LCEA 2UU9E 2G7HA 5DEQA 3HPZA 4JOMA 3IV5A 3G73A 2WWYA 4LLGF 3S17J 3FXUA 1Z6RA 2EOYA 2D1HA 3E5XA 3BJOA 2IS1A 5E3LA 4U88A 1S9HA 2N3GA 3CC2I 2DW4A 3S1RJ 5IY5H 3CDHA 4BBSJ 2EZHA 1UJ8A 1ZRFA 3LFKA 1XCBA 2PMZN 3DEUA 4IHYA 3WTSC 4MLOA 5CJ9A 3LWFA 3U21A 1ZR2A 3FXRA 4EATA 2QZ8A 3OR1C 2DPUA 2HOSA 4ZDPA 3LSRA 5A6AA 2CQNA 3J7AO 4AQYE 1U3EM 4W1UA 2ID6A 3ULQB 4A6EA 5J47A 5L3CA 3VHTB 4CDGA 2LVHA 3SFZA 1G3SA 2AXTC 2EMIA 3HQ1A 2IPQX 4DR6E 2ENCA 5HLHA 1OR7C 4K2EA 3P9IA 1VQMI 1B1BA 1TW2A 4NC6A 3BROA 4ABZA 3C6KA 1A1FA 3THNA 2L33A 4F6NA 4AIKA 4ENNA 3JW4A 2GAUA 3IWFA 2LMZA 2PMUA 1XN7A 2LJHA 1KA8A 4LFCE 2EMLA 4XMYA 2V1XA 1GXPA 5EG0A 1DQUA 5AE3A 1WI3A 5E20A 1STZA 2I10A 3RJPA 2E60A 3TDUC 2DLKA 1N3GA 2UUBE 3VOEA 4DIQA 3NWTA 3R60A 1NK3P 2OTJI 2KZGA 1MJAA 1ZG1A 3CF5F 2P7CB 5JLXA 3SZPA 3K4BA 2W00A 1LDJA 2CJJA 2OTLI 2B63J 3RCOA 1HDDC 3GXOA 4KMFA 1EA3A 2A69F 2VBXA 1A6IA 2KJBA 2EMXA 2QKLB 2Y0MA 2Q1ZB 3BJ6A 4KN7X 2HPMA 1FMWA 4IJAA 3ZP5A 4CICA 1AU7A 2EQ1A 2KRHA 3EPKA 2EZKA 5IYBJ 1VQOI 2Y0SA 2EPCA 2W25A 4TUIA 4NHRA 2D2WA 3AFHA 1IG7A 1TZLA 3K1MA 1XTAA 1SR9A 3F8FA 1MKMA 3DPTA 1ZRCA 4DR4E 4IEJA 1R1VA 4LLLA 1TQMA 4ZDLA 1HQCA 4BJTA 5CKTA 2NVQJ 2MC4A 5LBQA 1LPQA 4HNTA 5LMUE 4I0BA 4U87A 4A69C 3KYCB 5JHUA 3U9GA 1MJ9A 1MSEC 3VODA 4XSZF 4NB5A 4LG0A 2M5WA 4BQNA 2MD0A 3MD2A 4M3GA 2RVCA 2HGHA 2JXPA 1JKPC 5B66C 4OINF 5CLSA 2UUCE 4GYIA 2CFXA 2VPRA 1G4DA 2GBYA 4OIQF 1HR0E 4DW6A 2FNPA 2ZSHB 2DGCA 3VYXA 2L9SA 1LVKA 3ECOA 1DU6A 2MDGA 2L3JA 5KVRA 4B09A 3K70D 1PJSA 1V5EA 4YHHE 4ENMA 2EPFA 3AKZA 1BI0A 4JX5A 3ZMZA 3K4CA 1ULYA 2VBWA 3CO6C 2EE8A 4U7DA 1Z3XA 1TT5B 4IJDA 2OZ6A 3R0AA 3ZMSA 2EFQA 2Q8KA 1O0WA 3JTHA 2XKPA 2XGEA 2QYOA 2QBYB 2M1SA 2YTFA 1YIJI 4DV2E 3S2DJ 1IRXA 2E1CA 2LNBA 1V4RA 5EZGA 3HUGA 1IXRC 3IWZA 2YT4A 4I8OA 3IKTA 1Q1VA 4AIJA 1ETXA 1IC8A 1XCVA 3BTCA 3ADLA 2D1VA 2BW3B 2IS2A 5FB2A 3D1NI 1VQLI 4D7NA 3ONQA 3WTUC 1X3CA 2JPBA 2EPXA 1XMOE 4L9VA 5IOYA 1Y1WJ 1W36D 4PJJA 3I4PA 2HTJA 3IUOA 5EJCA 3E0JB 2XB0X 2CV1A 4MO7A 1FZPB 2PJRB 3DTEA 3G3ZA 5M3MJ 3N97A 1VQ7I 1F36A 1EV7A 1X2MA 1LFUP 2EJRA 1M1EB 1FBSA 1TQIA 1ZRDA 4AM3A 1FP2A 2WB1A 1JK2A 3BZCA 2I5UA 5HDNA 1JGGA 1XSDA 1O57A 2FGGA 1DPUA 2KIMA 3I64A 5DV5A 2X6YA 2KKOA 2UZKA 3MSWA 3BR6A 4M9SA 5FGMA 2YU9J 3P9CA 2FBIA 1F9NA 1ENHA 4RM2A 3QYFA 1FEXA 2EOZA 4X66E 1X1DA 1ZAAC 3SDGA 4LF9E 2QKMB 4BHPA 1VNDA 2F4MB 4KZSA 3MCZA 1GTKA 2OV7A 4F3QA 2DMTA 1MJBA 2A5YB 5HNHA 1S7OA 2RREA 3K69A 4GFBA 1BOBA 2HZTA 1IN7A 1RC9A 2DPDA 3GWZA 1ETVA 2DCEA 3CCYA 3SQNA 1W5SA 2CPNA 1V55H 4DYRA 1Y39A 4EJWA 4O5GA 4IL6C 2V6EA 1HLVA 4BBYA 5DCFA 3G71I 2WCC3 2A05A 2XAHA 4M3BA 4W97A 1E3PA 3K2ZA 4R2RA 1XSVA 4BJ5C 1JTXA 3GMEA 2NS8A 2E71A 2RQPA 4O5VA 3L2WA 1G59A 2EN2A 4NBQA 3K4KA 1P47A 3VB2A 2JRTA 1R1UA 1IO2A 3D5LA 2EL6A 1GT0C 4JI1E 4P7DA 1S29A 1ETQA 4IX7A 1W7PA 3FBNB 3DEWA 2EIJH 5IT3A 1FJGE 4WYQB 2CUFA 5K5RA 4A5MA 1FYLA 1G2FC 1R00A 2VBZA 5F6FA 4KIFA 5AE1A 2CU7A 2K7LA 2X85A 3QQAA 3WTYC 4CA0A 4JX4A 2GHFA 3QOEA 2XAJA 4F2JC 1RUOA 2K86A 2PX9A 3ZQGA 5A2QZ 1ZAOA 4M9ZA 4ZDOA 3L00A 4G7HF 2EA4A 3BC8A 3S16J 1K79A 1OLTA 3OR2C 4CZZA 1L3LA 2PMHA 1KQ8A 1ZARA 2QSFX 4YIRX 2PRTA 2HVQA 2EZIA 2EV0A 2H1KA 3K2AA 1YITI 1N78A 3C4TA 1X1BA 1YSAC 4AIDA 4F7ZA 1OKRA 1OPCA 3PNVA 5E1WA 2HXIA 1G6NA 1IDYA 2LJUA 1W7PD 3HGYA 4N9IA 1DDNA 1FBUA 3W6JB 3BCAA 4X64E 2LO3A 2HOTA 3CCQI 5A6JA 3CMYA 2J5OA 5K7ZA 1MEYC 2HJJA 2L3CA 2V9PA 4XRMA 2X48A 2V87A 1JT0A 4G9YA 1STUA 3LFUA 2M8EA 4JI8E 2DA5A 1YZ9A 4XRSG 1Z05A 2V89A 1ERDA 2BY0A 5HVQC 5DUKA 1UMQA 2GOMA 2XRNA 3V42A 2H09A 4E7IA 3BR2A 1XC5A 3FHNA 5AIQA 1HKSA 1XDUA 5TJJA 3K70C 2EMAA 4FE7A 1R5GA 4WSPA 2EZ6A 3HUGB 2MDRA 4OAZA 4U0YA 1HOMA 2CQ7A 3QPLA 1LFBA 4DMIA 2FJ1A 1GVDA 2O03A 2MA3A 2HI3A 1BBOA 2G0EA 2V6CA 2FOWA 4F93B 1KYWA 4L0ZB 3QWLA 3F8MA 4CGZA 3VSLA 1USSA 4HX4A 2PJPA 5L3BA 2EQRA 2L01A 3WTTC 1NCSA 2X6XA 2YUSA 2IVMA 3K6QA 2EMWA 2EL5A 1VQ8I 2M30A 4I0AA 4XN3A 1I27A 4Y33A 3CCVI 2JSCA 2PQ8A 4RGXA 5K5OA 3F9KA 4II2A 2E1MB 2KHXA 4A3BJ 3TW6A 2E5LE 2FMLA 4ZJZA 1Y6IA 2DLLA 3BJAA 3L7WA 3NEUA 1MSFC 4FISA 4C3IJ 1MMNA 1QNTA 4II3A 1Y1VJ 2IGOA 2GLOA 2E19A 1T8IA 3EPLA 2OZUA 1BI3A 2L2OA 3C2HA 2LR8A 3BR3A 3HZJA 4G8XA 5GP9A 1HW5A 2EOJA 1HNZE 2QSHX 2NXNB 4L18B 2YWQA 2EPMX 1D8JA 4A3FJ 1JUMA 3S3NA 3JAMC 3I0TA 4JI2E 3RIRA 2RN7A 1QPIA 4HEIA 4CCLA 2HVRA 2VQLA 2HEOA 5IP9J 4YELA 2YRHA 2QA4I 4DR7E 2DODA 3FXOA 3KP3A 4WWCA 2DRPA 2ZXJA 1J5EE 2DB2A 1MBFA 5AC5A 4PFPA 3F8BA 2EPRA 5E18F 4EJTA 2E1NA 3G6EI 1HW2A 3BF2A 3H3ZA 3VK6A 1JK1A 2P5LC 2F5VA 1DGRM 1FOYA 2DI3A 1BW6A 3S32A 2B0LA 3VEPA 2PG4A 5T6JA 5DM7F 4UUVA 3B02A 3GF2A 4LB6B 2R7ZJ 4ESFA 3T1YE 2RS7A 3RPQA 4OU0A 1XNRE 1GXQA 2LD5A 4DV4E 2EN8A 3SJMA 2D9HA 4DJAA 4HX7A 3TO7A 3HSFA 3QRFF 4ZTJA 4B3TE 3L9FA 3NQOA 2EOOA 4RH8A 1IZ1A 1CQTA 3S1NJ 5ICEA 4CXFA 5J1YA 2F5FA 3S2WA 4HNVA 1TWHJ 2NABA 1OYYA 2BGCA 5CQEA 2LBSB 5HLIA 2Y0SN 1E3OC 2NUGA 4QPQA 2NS7A 2YZTA 2ICWG 5GAGJ 2IP2A 4O43A 2YU8A 2L7FP 1X4PA 4MFEA 2VJ5A 4ESJA 3ROUA 3MZYA 2ECCA 2RS6A 5B1AH 2YR2A 5DUIA 2K5CA 1T98A 3HOSA 3PL8A 3FDYA 2PJRA 4A2UA 4KICA 3T1HE 2R7SA 3PSIA 4XR6A 2FU4A 4O4KA 3BP8A 1EH6A 1A1JA 1AKHA 2EOFA 4IQ4A 3CJRB 1IRZA 2M3AA 1MNEA 1D1AA 2IT0A 5KAIC 2WBUA 2YTEA 5L3EA 3FWEA 2XKOA 3CTAA 4IO9F 5JR3A 2OBPA 4HTGA 4R2SA 4RB0A 4BGDA 3ZMTA 3ABUA 4DBQA 1N75A 3H3VK 1O3TA 1KONA 3OIQA 4LTYA 2LTSA 1TF3A 3LSPA 4BAYA 4JYAE 4LG0B 3TL4X 3L2UA 4LF8E 3JCUC 2V86A 4M3DA 2EM6A 3OTOE 1YUIA 3HHGA 1T56A 2IA1A 4E7SA 3DLLF 3O6BB 1LKXA 2RNJA 5J4YA 3H5NA 1CF7B 5ED4A 1JKQC 3OL4A 4DBRA 3K1PA 1P6RA 3JU0A 2BZTA 3DBHB 4L9TA 1VQ4I 5HDGA 2R1FA 2R76A 4KT5C 5LRSA 1IQSA 3I9V2 1XMKA 3D5RC 1U0JA 2WAEA 3PO3J 1IXCA 2CG4A 1BI1A 2AQFA 1TP4A 2BOLA 4X62E 4DUYE 4FASD 2GZWA 2Z5UA 1O3RA 1LB2A 3EQ1A 3TMOA 4C3HJ 4D5FA 1W1WE 3OYEA 2GLIA 2XRLA 3EUHA 2LF8A 2JA7J 5FKKA 4I98B 4XM3A 2X9DA 5LHGA 1X47A 2NS0A 4IHSA 1FSEA 4MGRA 1ZLJA 4KYWA 3BDDA 1UILA 2EOXA 2LSOA 4JQFA 4LFAE 1SMTA 4QIWN 3I58A 3EYIA 1FSHA 2RQQA 3E5QA 1IJWC 2LT7A 4RAGA 3GBGA 2VKHA 4CO8A 3L1PA 2WC2A 3WHBA 4CYCA 1JKRC 3SEQA 4RGRA 1FJLA 2L54A 4XLHA 3RYRA 2P81A 2HYJA 1FWZA 2OAZA 4GO1A 4HYEA 3O3KA 3Q9VA 3F6HA 1R58A 4M30A 1BOAA 3V4GA 2OUMA 4Y15A 2WBMA 4NHJA 2NVTJ 4LFUA 2JYAA 4M2ZA 1O7LA 1IV6A 4F6MA 1FKAE 1YLFA 5DTDA 2V85A 1RMDA 1FTTA 5E1XA 3A02A 2NRAC 4OX9E 3ADIA 3ZQFA 3DU5A 2H8WA 2R7DA 2V7FA 1VQKI 4IHVA 2LVSA 1L0OC 5CVJA 2DOAA 2FOKA 2O9LA 3MKYB 1J75A 2CUEA 3MKLA 4D0PA 4YFXF 3MZHA 1SFKA 1Z9CA 2EZLA 3LMLA 1D0ZA 2DMPA 3GZ5A 1ETYA 2KP6A 3CLQA 4IHTA 1NG7A 2CV2A 5A69A 4JK1X 5FD5A 3ZQHA 4XLCA 1YYWA 5FLXZ 3S1QJ 1G2DC 2A61A 2MH9A 2HVSA 1W36C 3KP5A 2V88A 2YRKA 4GZNC 4P9FA 1FY7A 1KYZA 4YIIA 3TBIA 1BBGA 4ZYDA 1XD7A 6PAXA 1I5ZA 4KMUX 1RESA 4LGWA 2ZC2A 1S6LA 5ICCA 3H5RA 4LB5A 1B69A 4RMNA 1HNWE 3ABTA 3DTKA 3K4NA 4E7LA 4NXNE 2HKOA 3TGNA 3WU0A 4BEHA 2VN2A 3DJWA 2XGCA 2K27A 3FXLA 3PQKA 4PSWA 4AUXA 3OYBA 5IP7J 1QA6A 4BQOA 3JRGA 3M1EA 5F1RA 1YYKA 1ZBTA 5D5VB 2EM5A 1TWFJ 1ZN2A 2W82A 4XLEA 1USTA 3WGIA 4A6DA 3CCLI 1IF1A 2O3FA 3LSTA 5DCMB 3ZN1A 2M7QA 2PMZA 2LDUA 3HXLA 1FOWA 1R1TA 1IUYA 1FBQA 5DM6F 3AG1H 4C9YA 2LE2A 4JI7E 3HSRA 3OS0A 1PJQA 2NNYA 2EMBA 3C6MA 2MYSA 5IXMB 1TBXA 1TW3A 1V54H 3E97A 1VFCA 1I94E 1QO0D 2DYSH 2BYVE 3BWGA 1YI2I 5KL6A 2KDOA 5F0CA 1R5ID 2DJIA 2XDVA 3J81C 4R2DA 1SVLA 1SD4A 2DO7A 1ZLKA 2M0CA 3OYMA 3I54A 1S7AA 2A07F 3ERED 4DV0E 4BXUA 2V1NA 2ZO4A 4XK4A 4R79A 2O8KA 1BR4A 4LFBE 4F9BB 2E1OA 1HNXE 3W2AA 2L9NA 3FKIJ 3CMMA 4WF2A 4C2UA 3FK7A 4E7HA 2WTEA 3GTGJ 4UXNA 3HB9A 2VASA 1ZGAA 3BZ6A 3GX4X 4IOCF 4RB1A 2PFBA 4H0EA 2FX0A 5TGTA 2BHZA 1UB9A 4QLCU 1DI2A 2JVHA 3DFGA 4MQ9F 3C4BA 3BGHA 1X2NA 5F1JA 5J4VA 4BC7A 4WXDA 1UCRA 3WTWC 5GAHJ 1OR7A 3MWMA 1F43A 2E72A 4PCQA 5C4XJ 4S0HB 1R49A 1SFEA 2ZM6E 1ZG5A 1HCRA 2OQRA 3FIGA 4GEQB 2DFIA 4ITVA 2EN4A 2A6TA 4OWRB 5FKLA 2HQAA 4HX8A 2H1LA 4EJOA 1O3SA 1OYWA 2X51A 2MC5A 3GTKJ 5LMNE 5A6BD 3ESWB 3JREA 2YTPA 5C44J 4YFNF 5A6BA 3JRHA 1I39A 3HG9A 3FM5A 4E4HA 4E7ZA 1YYOA 5DD4A 3ZRGA 3BR1A 2NVUB 4ZYEA 1IRGA 2EOSA 2RSMA 2DA2A 3HKZN 2LUQA 4P55A 2M87A 3EYYA 1K6YA 2V4JC 4HAMA 2HDWA 2LKXA 2IEKA 4AD9A 1YJNI 4LD5A 2LP0A 4HPQA 1W5TA 4P1WA 4XBFA 3WG7H 3S3OA 3T1BA 5LFAA 1RIOH 2DQLA 5EGOA 3A2KA 2ESHA 2W7NA 4OIOF 1YW8A 4RLQA 4WSGA 4UVAA 4XORA 2IS6A 2M4IA 2HR3A 2JWOA 3BY6A 4I09A 3JR9A 3GTMJ 4A3EJ 4KHPE 3ZQCA 3DKYA 3REOA 3OMLA 3ZGKA 1FLIA 1D8KA 2E2IJ 3TP3A 3PQJA 2ZMEB 5L3FA 3DP7A 1KQ0A 3RKYA 5LHHA 5E17F 2XAQA 2UXNA 4RB2C 2CUZA 3KP2A 2F4OB 3QYBA 2EOHA 5EZHA 2F5CA 3HOUJ 2EFPA 1YOVB 3RTRA 1FYKA 4GRIA 1UZCA 3NAUA 4JBAA 4PUSA 4X8WA 3KLOA 2VJJA 1O4XA 5M5XJ 4XRSA 4DGWB 3DPLC 3RZDJ 3TOBA 2R5YB 1U5TB 1IQOA 1Y8RB 3LQRA 1WZ2A 3ZQLA 2D5VA 3MN2A 4HZFA 5HS7A 3I55I 2DN0A 2KQRA 4N4OB 3GYHX 2ELZA 2DXIA 4OMZA 1T2KA 4AVZA 4YIFA 4B1RA 2BY1A 4IVNA 2XHKA 2P7VB 1WRJA 1RRJA 1QZYA 3HOTA 4LITA 1WFXA 2NOGA 4LK0F 2YTGA 1WPKA 2DA3A 1NK2P 3M4OJ 3E6CC 1ZGWA 2EOIA 1GV5A 2EOMA 4R1HA 4BQQA 3LQQA 1ZKGA 2JZYA 1X1AA 3CUOA 5F04A 5CVUA 4CUGA 2QVOA 5FROA 1BI2A 2VODA 1IN8A 1JUPA 1KYQA 1NHAA 2L9RA 1H88C 5EDNA 1GHCA 4BYYA 2W85A 2ELHA 2Y9YA 1JHHA 3MAJA 3VWBA 2E35A 3K1NA 2DMQA 5JFRA 1XGMA 3GCMA 5H2FC 1UN6B 2YX7A 1TNSA 4NC8A 4ENKA 3TO9A 1WJBA 4XN0A 5GTHC 1ZR9A 2A5WA 1P2FA 4QWQA 3Q3SA 2DTZA 3PIPF 2FMYA 3BPVA 3ASNH 2DT7B 3GEZA 4L5NC 4Y17A 5M3FJ 3Q5FA 2FBKA 3J80K 3FISA 4LU9A 2TDXA 3QP6A 5FKMA 4U7BA 3O8HA 4B8XA 1T33A 4IQJA 2WBTA 2EORA 4HLXA 4EGYA 3GO5A 3HC7A 2JP9A 1RNLA 2EPUA 1JXSA 3LSMA 4BDYA 1B9NA 1R22A 2QQAA 3LAJA 4BACA 3I5UA 4KIBA 2EJ4A 4J8ZA 2RDPA 4M3EA 4F54A 4G94A 2VL8A 2G9WA 4ZYHA 3BG9A 1IBME 2B9SA 2W1OA 3SYTA 4R8OA 2IHR1 1SMYF 2STWA 5IV8B 5E3NA 1SD6A 1WHUA 3FXMA 2EFWA 2H27A 2FRHA 2VJ4A 3VYUB 1BB8A 4XKCA 3KEYA 4RLFA 1ZH5A 3B73A 1BJAA 3DTIA 2HXOA 4XL9A 2L2MA 2ZB9A 3BTLA 3I4NJ 2QQBA 3H92A 3V7CA 2EQ0A 2YTJA 1HW1A 1WJFA 3QOPA 4RBOA 4UB8C 2KOUA 1UFMA 2I9IA 5HS9A 4DR3E 4PGGA 5LLQA 4IRGA 2VOPA 2PLYA 1PUFA 3FMRA 2EM4A 2BXYA 1MH3A 1RUNA 1XMQE 3ERMA 1RKWA 4S04A 2MKNA 3CZ6A 1E2XA 2F48A 1DPRA 3HOXJ 2M0MA 1KU9A 4CCKA 3D5SC 1HDPA 3CDIA 3LLHA 1VQNI 2KZVA 2ELKA 3M8EA 4OAYA 1LE8A 3LSKA 2GQQA 2VQHA 1BC7C 1KQ9A 5C3EJ 2RAEA 3CUQB 4JI5E 2AHQA 4UUTA 2ZFUA 4LLNA 3IRQA 3RMPA 3F6VA 1FIAA 2M7BA 5CQGA 2V8QB 4BE0A 1EKZA 1XG1A 3BG7A 4MIMA 3HOZJ 2R5ZB 3PM1A 2YPNA 1MBGA 4HG2A 3C2BA 2ODRC 2AQEA 1HSJA 1F4KA 4Y4RA 3WTXC 4X6AJ 1D0YA 5KL2A 2BY3A 3EUHC 1WKMA 3OSFA 3LMMA 2FUG2 2H6CA 4KA4A 2V79A 1YE9A 4BKXA 1W7PB 1XMAA 1PJRA 1ORKA 4IXAA 1BL0A 4N4RB 2HQRA 2UV1A 1POGA 2YSOA 1BR2A 3FKJA 3HBLA 1WWXA 3RQ4A 3HOVJ 2FQ3A 2W57A 4LG3A 5GAEJ 2MKDA 5KAFC 4E7JA 5EYRA 2M4GA 2JJ7A 4HF2A 3S14J 2N8XA 1V5FA 2K85A 5M5WJ 2DA1A 2LFBA 2YTNA 1EH7A 4BEHB 2XF7A 4M73A 3G1MA 4L8NA 5D4RA 3CMEI 4A3GJ 4V2FA 1JHFA 3WE3A 2EMGA 4Z2YA 2MH2A 3WU2C 2RKHA 2HFHA 1SAXA 3DF6A 3C18A 5EF6A 1WI9A 4EMSA 1MDMB 2GIVA 2K4BA 1HA8A 4D1QA 4IRHA 4M71A 2FBHA 2K4JA 2YSRA 2ZXWH 5FKNA 1E0EA 3M99B 2H8RA 1P4WA 3TEDA 1WJEA 3CJTB 1Z0XA 4MTDA 1IDZA 1F2IG 1DQ3A 2E5NA 1YQAA 3LSHA 2B7TA 2YRMA 4LJZF 4JV5E 1VZ0A 2L7ZA 1J9IA 1N77A 1QZEA 5K1YA 2JA6J 2P4WA 2QWWA 2OCCH 4QPOA 4G6TB 4AYBA 2YTDA 4DV6E 1UHZA 1I50J 4DR5E 2VQFE 1W0TA 2UXXA 4RM3A 3CO7C 3I59A 5FFXA 3A03A 4R2EA 1U5TC 1A1LA 1Z91A 3OS1A 5H20A 4R8HA 1LVAA 2K9MA 4ZYGA 3VYSB 3QODA 1IN6A 4BXXJ 4IHWA 3HGGA 2QF7A 2DMYA 1WJ5A 2DMNA 2UWMA 2JPCA 2JK3A 2K9QA 1PYVA 3QP5A 5J40A 1SAUA 3S15J 2LTPA 3E6DA 3HRTA 2XASA 3GTOJ 4EJVA 1N36E 5HODA 1BW5A 1K83J 2EPPA 3R61A 5FO5A 4LIUA 4HF1A 4YY3E 2MBFA 4KN4X 3E1SA 2LY9A 3GTPJ 2R7VA 1YX3A 4G7OF 4MFDA 1IAWA 1SD5A 5B3SH 1RR8C 1B8IB 1ODDA 5LD2C 4DR1E 3GZ6A 3TP0A 2UXBE 3DBRB 1XGSA 3E6MA 2LRSA 2HS5A 4R2PA 1R9TJ 2WADA 5D6FA 2EM9A 1QZZA 4Q47A 3ZXSA 4WK8F 3J80C 1L4SA 4A3IJ 4A93J 2GA2A 2Y9ZA 5FRMA 2K3PA 1LLMC 2JPAA 2R7OA 2GWRA 3H0GJ 3OMYA 2KIFA 3MKWB 3A01A 2R7TA 1HKTA 1ETKA 1MNMC 2BY2A 2M7AA 3W2VA 1HKQA 3HTSB 3T8TA 1RETA 4CYCB 3BG3A 3WHCA 2LREA 2EBIA 3DF8A 2XPUA 1FP1D 3GFMA 3KZZA 2PN6A 4EEFG 2A6HF 2Q0OA 3JRBA 3AAFA 4A3CJ 2ME0A 3CC7I 5FD6A 4GKKE 2BVLA 3EUAA 1REPC 2WY8Q 2EV6A 4JX6A 3IC7A 4A3DJ 4IPAA 2STTA 4XKBA 2DFEA 4J01A 2Y2ZA 4DOZA 5F64A 3JAMK 3I53A 4BY7J 4R03A 4HDVA 3ZN0A 5EGOB 2VONA 1YW7A 1XDSA 1Z77A 3U2RA 4XLNF 3NARA 3OIPA 4UNOA 2EMYA 4BE1A 5ICFA 3X2QH 1XGOA 4RB3C 4HBLA 3FX3A 3V8KA 3OWTA 3FK6A 2X1DA 4N9HA 2HDCA 2XAFA 1QRYA 2HWVA 1SANA 2EN7A 1QVUA 2EP3A 1IBKE 2F4VE 2CTDA 1P9QC 4PJ0C 2HTSA 2CMPA 5LGUA 4FX4A 3OY9A 4DQ2A 2ID3A 2P6TA 4EM2A 4N0BA 3ZQQA 4YRVA 2Z9OA 5DS9A 1MBHA 4F52A 2LOOA 4AU7A 2CW8A 2DDBA 3FZVA 1PVEA 3HTUA 2DT6A 3JAMZ 3RZOJ 2O61A 1KJKA 4EGZA 2DQRA 5E3OA 2EPLX 2F6CA 2LK2A 5FKOA 3OL3A 2JUCA 4C2MJ 2VUMJ 1DP3A 3BCBA 3I4MJ 1X6FA 4M9VC 2MD5A 3Q0VA 4B3AA 1BA5A 4KJZA 4IOAF 2LG4A 1Z1DA 2JT1A 1YX5A 2QUFA 4O24A 3KP4A 5HLGA 2XSDC 1JTYA 3HRSA 4XIDA 4IZZA 3KZIC 4S05A 2ZKZA 1APLC 3KCCA 2HYFA 3OYLA 3HOWJ 4RAZA 2V26A 2E1MA 3UR3C 4XICA 1YJ9I 2O7OA 3O2PE 4TUGA 3ML6A 3JTGA 4OOGC 1T4OA 3KWRA 2LUPB 4RGUA 3Q0WA 2X1EA 3MFKA 2VOOA 4ASNA 4JI3E 2YTOA 3KX2A 2F2EA 3A0BC 1Z6TA 4XSXF 3JRIA 1ZBQA 4HA8A 5H6RA 2YSPA 3ELKA 1ONVA 3P7NA 2YU3A 4EQQA 1QU3A 2EINH 1G3WA 1AAYA 2JN6A 1RR7A 1TT0A 1TWGJ 3LL7A 4JYKA 4RDUA 5AONA 1WXRA 4A5NA 2HZDA 2P8TA 4EJUA 3OYHA 1VTNC 3ZQ7A 3GTQJ 2V9VA 4ZTFA 3ADGA 1ZREA 2ENHA 5ERIA 3LAPA 2EM2A 5F3WA 3LSIA 5F0FA 2EOQA 3CUQA 1RZ4A 1JGSA 3F0CA 1ON2A 4ON0A 2J7JA 3ECHA 4UV8A 4IKFA 3GW2A 4KISA 3W6KB 1TC3C 4L9JA 1MMAA 2CW0F 3K7AJ 4MLVA 1UHWA 2L6MA 3FXKA 3ZR8X 1RQ0A 4C30A 4D9JA 1OMIA 1U9OA 2DOFA 5HNFA 3PFIA 4XKWA 2RGVA 4XLFA 4ZC3A 3HKZA 1PP7U 4XOTA 1Z3YA 2VBYA 2DK8A 2N8GA 4HNUA 3NWSA 4DNCA 1YUJA 2HC5A 4EV0A 2L9VA 4IS1C 4WCGA 1GDTA 1KZHA 2V83A 2IXSA 3RPUD 5GPCA 4CHUA 3J81Z 1UELB 3WGHA 2GXBA 4OIRF 1X1PA 4PSXA 4A12A 2VKVA 4X65E 3HYIA 1YO5C 2MGQA 3O8GA 3P9KA 3QAHA 4X9JA 4RAFA 4C2TA 1QHHD 2M1BA 3BR0A 5CVVA 4AVPA 4PDKA 4BNCA 2EM8A 4HLYA 2L7KA 3RPUA 4I02A 3RI4A 5J1UA 2LF7A 4B3XA 3HTXA 2DA4A 1EF4A 3HRMA 2ESNA 2KDZA 4D7MA 2M9AA 2E7XA 2EB7A 3EUKL 2EPKX 5B5EC 2BXZA 2NVXJ 5HLTA 2DIXA 1BR1A 1TWAJ 3R4KA 3ISPA 1QGPA 3FIWA 2L92A 1JKOC 4UUSA 2YTIA 2MLKA 1U78A 1H9TA 2MABA 1OCOH 2VQGA 2MFZA 2ZBKA 5KL5A 4PK4A 2VB6A 1X3UA 3GVAA 1ON1A 2LH9A 2HNHA 2L2NA 1RKTA 4IHXA 2BVMA 1LE8B 3MMYB 4MLQA 4Y7NJ 4XONA 5LGNA 5C4JJ 3TO6A 2QEXI 2WA0A 3WGGA
chains in the Genus database with same CATH topology
2OU2A 3KP6A 4IF4A 4A0ZA 5J8CA 2O0YA 3TKYA 1DP7P 2CWEA 2HYGD 4OIPF 3L2CA 3MQ0A 4I7HA 2L4MA 2BBYA 3GFIA 4L9NA 3ZMDA 3IL2A 4P96A 3E5UA 4BHBA 3I59B 2AS5F 1YFHA 4UV9A 1Y0UA 5CYVA 1KGSA 2COMA 4WXCA 1O3QA 1P4AA 2BE5F 1TNTA 4OOIA 4IRIA 3OOPA 2K02A 5DYMA 4KNYA 1EH8A 2VC1A 2M45A 2KRFA 3JSOA 3DKWA 1U5TA 2HGCA 2DBBA 4I2OA 1OYIA 1BM9A 5IT9Z 2L3DA 3Q9SA 4U0VA 1LEAA 4P9UA 2P5KA 4L5IA 3DXJF 5CVIA 1R36A 1I1GA 1T0FA 1C0WA 2IA0A 2HKXA 1BC8C 3TOAA 4HW0A 3V8LA 2OA4A 3ZMUA 4MEXF 1UHMA 2GA1A 3HSEA 5FFZA 1B4AA 3WU1B 4Q48A 2FA5A 5ILVA 5HOOA 2CSOA 2ZJ2A 1BN5A 4MEYF 4PGHA 4ENJA 4GCVA 4RS8A 1T6SA 5CVRA 3BPXA 2VT2A 5LEKA 4MQVA 3N4MA 2FF4A 3FXQA 2F5EA 4M9XA 4A0YA 2XAGA 4UVBA 1IRFA 2IJLA 3DV8A 1QPMA 1TQPA 1R7JA 1FT9A 1HSTA 1R23A 3CLOA 2HOEA 4G6QA 5LRRA 1LDKB 4GGGA 5E1ZB 2G7UA 5D8LB 4WXHA 5BMZA 3R6SA 5TRDA 1MGTA 1MD0A 4LK1F 4FHTA 2L02A 2ISZA 2R7FA 4GXOA 2HQNA 1WSUA 2EK5A 2NAZA 4FT8A 3HIFA 3EETA 5BS6A 2Y75A 3F23A 4O6JA 4U0WA 4KIGA 3RKWA 3ZPLA 4ESBA 4Y13A 4ZZLA 5J8FA 3WODF 3IKVA 2ETHA 2P5VA 3ZMVA 2P6SA 4BQAA 2Y48A 4UVCA 2QQ9A 1K7AA 2W84A 1KU2A 2J5PA 1CF7A 4P5OA 5HDKA 3QPTA 1YIOA 4NQWA 2CGPA 3KEOA 3M9AA 2QLZA 3LA7A 5BOXA 3FHZA 3U1DA 3VFZA 2QBYA 1T38A 5E8IA 4TV7A 3RKXA 2ZCWA 1U2WA 4BH9A 2E7WA 1TTYA 3WG9A 1Q1HA 1XB4A 2PI0A 3QPHA 1FPQA 5BQTA 3KLNA 3SXYA 4A0XA 1J59A 2V1DA 5H6QA 1V3FA 3F3XA 3GLXA 1IN5A 3KEQA 1QBJA 5E8GA 1G3TA 1IN4A 2L4AA 5FLXK 4HOBA 3IHUA 1B6AA 2KIUA 1B9MA 4EVIA 3KFWX 3GFJA 3T5XA 2RV8A 1HBXG 5D5XB 1A04A 4Q5SF 1YS7A 2FSWA 3J80Z 2DTRA 2MLGA 4XRFA 3QU6A 3BOQA 2NNNA 4M72A 2VE9A 4GYGA 1P4XA 2FEZA 1F1ZA 1K78B 1YW9A 3F8NA 1J7KA 3H3UA 1W4MA 2VC0A 3GUDA 5D5WB 4G6DA 4AIHA 2FXAA 2H6BA 1E17A 2F5DA 5BPDA 1F5TA 2VT3A 4Q4ZF 3WTVC 1SFUA 5ICGA 2NYXA 3KP7A 4LMYA 4HV5A 1ZYRF 1U6GA 3FMQA 1LQ1A 2DAOA 5EEHA 2LKPA 5IT9K 3GFLA 3F8CA 1O7FA 2EA2A 2JTVA 5JI6A 4RAYA 4UHTA 2A68F 2OQGA 1LNWA 2H94A 2YPRA 1WQ2A 3RYPA 4FX0A 1ZGJA 3FMSA 3V7RA 3F21A 2MC3A 3SZTA 5LGTA 2EWNA 4HDUA 3RDIA 2KJCA 3L09A 5HS8A 4KDPA 1IXSB 2A3SA 2QENA 2FNAA 1FYMA 2O8XA 1H0MA 3FM3A 1MDMA 1SD7A 2PBIA 1J0RA 3I71A 2VE8A 4HV6A 3M7GA 4O3MA 2D45A 4HF0A 2ZNZA 3F72A 2A6EF 1BIBA 1YS6A 3V8JA 2XGXA 1D3YA 5L3DA 1IW7F 2RC4A 1MZBA 1XSXA 2W24A 5DCMA 4XLPF 3KETA 2CYYA 2EV5A 1YYVA 3EDPA 1CGPA 4RGSA 2QM3A 5D6EA 5D4SA 2ACJA 2EFNA 3R0JA 3EQLF 5D8KB 4EM0B 1ZG3A 3TQNA 3CUQC 3C7JA 4E70A 1YTYA 1FNNA 4ZH4F 2XROA 1FC3A 5EEGA 5K5QA 1SFXA 2IRFG 2DU9A 2XUBA 4MNUA 1PP8F 1T39A 2EFOA 4L5JA 2YX4A 5ILSA 1D5VA 3HRUA 4KUMA 3MEXA 1K78A 5BPIA 3T8RA 3K9TA 1FX7A 1XGNA 1J5YA 2OD5A 3LA3A 1AWCA 1LDDA 1S8NA 1I1SA 1AOYA 3JSPA 2DT5A 4HQMA 3IRRA 3CJNA 1LEBA 3D0SA 4YG2F 1Z7UA 3FF5A 4YFKF 2CQKA 2PEXA 2C6YA 3C1DA 2Q2EA 4EM1A 2FE3A 1I6XA 1K6OA 4MTEA 1U8RA 5ILUA 5L3GA 5A2QK 1H9GA 4ETSA 1G3YA 5J6XA 4G7ZF 3WTZA 1GVJA 4ZZDA 1ZHFA 1J2XA 5KK1A 4WX9A 2ZMEA 1RI7A 5AIPA 3SHFA 5DDGA 3V7SA 1BIAA 4M6XA 1JE8A 3C3WA 2Z99A 2Z33A 2X0LA 5DD8A 1QQIA 2CO5A 3T0YA 3OV8A 3WE2A 3HHHA 4MHGA 1HXDA 1TLHB 2ADUA 4M6YA 2GXGA 2IA2A 3K0LA 2DK5A 1FOKA 3COAC 1KU3A 2ZFWA 2BEOA 2XIGA 5LEJA 2BV6A 3QU3A 3TDZC 2IW5A 4PZJA 1DUXC 4I01A 3F6OA 3KZYA 2AXLA 3F22A 1KU7A 2ISYA 1PUEE 4CYDA 1BBYA 2X4HA 4M74A 2Z3YA 4KFCA 3DQVC 5LHIA 1PDNC 1S3JA 3LA2A 4HQEA 3J81K 1P92A 2XVCA 2ZNYA 4BHCA 1R5HA 1YG2A 5D5UB 1LJ9A 4L0YB 2O6GE 3M8FA 3E3VA 2VXZA 4OMYA 5JVTA 2WV0A 2V1UA 4AWXB 3KE2A 2XV4S 2R3SA 1B59A 3E6BA 3NRVA 2G7HA 5DEQA 3G73A 2WWYA 4LLGF 3FXUA 1Z6RA 2D1HA 3E5XA 3BJOA 4U88A 2DW4A 3CDHA 1ZRFA 3LFKA 1XCBA 3DEUA 3WTSC 5CJ9A 3LWFA 3FXRA 2QZ8A 2DPUA 3J7AO 1U3EM 3ULQB 4A6EA 5L3CA 4CDGA 3SFZA 1G3SA 2IPQX 5HLHA 4K2EA 3P9IA 1B1BA 1TW2A 3BROA 4AIKA 4ENNA 3JW4A 2GAUA 3IWFA 2PMUA 1XN7A 1KA8A 2V1XA 1GXPA 5E20A 1STZA 3RJPA 3TDUC 3VOEA 3R60A 1MJAA 1ZG1A 2P7CB 3SZPA 1LDJA 3GXOA 4KMFA 2A69F 2VBXA 2KJBA 2Y0MA 3BJ6A 4KN7X 4IJAA 3ZP5A 4CICA 2W25A 2D2WA 3K1MA 3F8FA 1MKMA 3DPTA 1ZRCA 4LLLA 1R1VA 1TQMA 1HQCA 5LBQA 4I0BA 5JHUA 3U9GA 1MJ9A 3VODA 4XSZF 4NB5A 4LG0A 2M5WA 2RVCA 4OINF 5CLSA 4GYIA 2CFXA 4OIQF 1G4DA 2FNPA 3ECOA 5KVRA 4B09A 4ENMA 1BI0A 3ZMZA 1ULYA 2VBWA 3CO6C 4U7DA 2OZ6A 3R0AA 3ZMSA 2EFQA 2Q8KA 3JTHA 2XKPA 2QYOA 2QBYB 2E1CA 2LNBA 1V4RA 3HUGA 1IXRC 3IWZA 3IKTA 4AIJA 1XCVA 2D1VA 5FB2A 3WTUC 2JPBA 4L9VA 3I4PA 2HTJA 1FZPB 3G3ZA 3N97A 1EV7A 2EJRA 1FBSA 1TQIA 1ZRDA 1FP2A 5HDNA 1XSDA 1O57A 1DPUA 2KIMA 3I64A 5DV5A 2UZKA 2KKOA 4M9SA 5FGMA 3P9CA 2FBIA 1F9NA 4BHPA 3MCZA 1MJBA 2A5YB 1S7OA 3K69A 2HZTA 1IN7A 2DPDA 3GWZA 3SQNA 1W5SA 4EJWA 5DCFA 2XAHA 3K2ZA 1XSVA 2RQPA 4O5VA 3VB2A 2JRTA 1R1UA 3D5LA 1S29A 1W7PA 5IT3A 5K5RA 4A5MA 1FYLA 1R00A 2VBZA 5F6FA 4KIFA 2K7LA 3WTYC 2XAJA 1RUOA 2K86A 5A2QZ 1ZAOA 4M9ZA 3L00A 4G7HF 2EA4A 1K79A 4CZZA 1L3LA 2PMHA 1KQ8A 1ZARA 2EV0A 4F7ZA 1OKRA 1OPCA 5E1WA 1G6NA 1W7PD 4N9IA 1DDNA 1FBUA 3W6JB 2J5OA 4G9YA 2M8EA 1Z05A 5HVQC 5DUKA 2XRNA 2H09A 5AIQA 1HKSA 1XDUA 5TJJA 1R5GA 4U0YA 2O03A 2MA3A 2V6CA 1KYWA 4L0ZB 3F8MA 4CGZA 1USSA 4HX4A 2PJPA 5L3BA 3WTTC 2L01A 2IVMA 2M30A 4I0AA 1I27A 2JSCA 2PQ8A 4RGXA 5K5OA 2FMLA 2DLLA 3BJAA 3L7WA 3NEUA 1QNTA 2OZUA 1BI3A 4G8XA 1HW5A 4L18B 1D8JA 3I0TA 3RIRA 2RN7A 2HEOA 3KP3A 4WWCA 2ZXJA 3F8BA 5E18F 4EJTA 2E1NA 1HW2A 3H3ZA 2P5LC 2DI3A 2B0LA 3VEPA 2PG4A 4UUVA 3B02A 3GF2A 4LB6B 4ESFA 3RPQA 4OU0A 1GXQA 4HX7A 3TO7A 3HSFA 3QRFF 3L9FA 3NQOA 1IZ1A 5ICEA 4CXFA 2F5FA 3S2WA 1OYYA 2BGCA 5HLIA 2IP2A 4ESJA 3ROUA 3MZYA 2YR2A 5DUIA 3HOSA 1T98A 4A2UA 4KICA 2FU4A 3BP8A 1EH6A 2IT0A 5L3EA 3FWEA 2XKOA 3CTAA 5JR3A 2OBPA 4RB0A 3ZMTA 3ABUA 1O3TA 4BAYA 4LG0B 3HHGA 2IA1A 3O6BB 2RNJA 1CF7B 5ED4A 3K1PA 1P6RA 4L9TA 5HDGA 4KT5C 5LRSA 1XMKA 1IXCA 2CG4A 1BI1A 2GZWA 2Z5UA 1O3RA 1LB2A 3EUHA 2LF8A 4I98B 5LHGA 2NS0A 4IHSA 1FSEA 4MGRA 1ZLJA 4KYWA 3BDDA 2LSOA 4JQFA 1SMTA 3I58A 3EYIA 1FSHA 3E5QA 4CO8A 2WC2A 4RGRA 2L54A 3RYRA 1FWZA 2OAZA 4GO1A 4HYEA 3O3KA 3Q9VA 1R58A 1BOAA 3V4GA 4NHJA 4Y15A 4LFUA 1O7LA 1YLFA 5E1XA 2NRAC 2R7DA 1L0OC 5CVJA 2FOKA 1J75A 4D0PA 4YFXF 3MZHA 1Z9CA 3GZ5A 4IHTA 4JK1X 5FD5A 5FLXZ 2A61A 2MH9A 3KP5A 4P9FA 1FY7A 1KYZA 4YIIA 4ZYDA 1XD7A 6PAXA 1I5ZA 4KMUX 4LGWA 1S6LA 5ICCA 4LB5A 3ABTA 2HKOA 3TGNA 3WU0A 2VN2A 2K27A 3PQKA 3M1EA 5F1RA 5D5VB 1ZN2A 1USTA 3WGIA 4A6DA 1IF1A 2O3FA 3LSTA 5DCMB 3ZN1A 2LDUA 1R1TA 1IUYA 1FBQA 3HSRA 2NNYA 1TBXA 1TW3A 3E97A 1QO0D 2BYVE 3BWGA 1SD4A 2DO7A 1ZLKA 3I54A 1S7AA 2A07F 3ERED 4BXUA 4R79A 2ZO4A 4WF2A 2WTEA 4UXNA 1ZGAA 3BZ6A 3GX4X 4RB1A 2PFBA 4H0EA 1UB9A 4QLCU 3DFGA 4MQ9F 4WXDA 1UCRA 3WTWC 1OR7A 3MWMA 4PCQA 1SFEA 1ZG5A 2OQRA 2DFIA 4HX8A 4EJOA 1O3SA 1OYWA 4YFNF 3FM5A 5DD4A 4ZYEA 1IRGA 4P55A 2M87A 3EYYA 4HAMA 4AD9A 4LD5A 4XBFA 1W5TA 3T1BA 1RIOH 2DQLA 2ESHA 4OIOF 1YW8A 4UVAA 2HR3A 3BY6A 4I09A 3REOA 1FLIA 1D8KA 3PQJA 2ZMEB 5L3FA 3DP7A 5LHHA 1KQ0A 3RKYA 5E17F 2XAQA 2UXNA 4RB2C 3KP2A 2F5CA 2EFPA 3RTRA 1FYKA 4JBAA 3KLOA 3DPLC 3TOBA 1U5TB 3LQRA 4HZFA 5HS7A 3GYHX 4OMZA 1T2KA 4YIFA 4IVNA 2XHKA 2P7VB 1WRJA 1QZYA 3HOTA 4LK0F 3E6CC 4R1HA 3LQQA 2JZYA 3CUOA 5CVUA 2QVOA 1BI2A 2VODA 1IN8A 1NHAA 1GHCA 4BYYA 2W85A 2ELHA 1JHHA 3MAJA 3K1NA 5JFRA 1XGMA 2YX7A 1TNSA 4ENKA 3TO9A 1P2FA 4QWQA 2FMYA 3BPVA 3GEZA 4Y17A 3Q5FA 2FBKA 3J80K 2TDXA 3QP6A 4U7BA 4B8XA 4HLXA 4EGYA 3GO5A 1RNLA 1JXSA 1B9NA 1R22A 2QQAA 3LAJA 3I5UA 4KIBA 2RDPA 4G94A 4ZYHA 2G9WA 1SMYF 2STWA 1SD6A 2EFWA 2H27A 2FRHA 1ZH5A 3B73A 1BJAA 2QQBA 3H92A 3V7CA 1HW1A 3QOPA 1UFMA 5HS9A 4PGGA 5LLQA 4IRGA 2VOPA 2PLYA 3FMRA 1RUNA 4S04A 1E2XA 1DPRA 1KU9A 3M8EA 2GQQA 1BC7C 1KQ9A 3CUQB 4LLNA 3IRQA 3F6VA 1HSJA 1F4KA 3WTXC 1WKMA 2H6CA 4KA4A 2V79A 1W7PB 1XMAA 4IXAA 2HQRA 1WWXA 2FQ3A 2W57A 4HF2A 1EH7A 4M73A 5D4RA 1JHFA 3WE3A 4Z2YA 2MH2A 2RKHA 2HFHA 1SAXA 3C18A 1WI9A 4EMSA 1MDMB 2GIVA 2K4BA 4IRHA 4M71A 2FBHA 2K4JA 2YSRA 1P4WA 4MTDA 1YQAA 4LJZF 1J9IA 5K1YA 2P4WA 2QWWA 2UXXA 3CO7C 3I59A 5FFXA 1U5TC 1Z91A 5H20A 4R8HA 1LVAA 4ZYGA 1IN6A 2UWMA 2JPCA 3QP5A 3E6DA 3HRTA 2XASA 4EJVA 3R61A 5FO5A 4HF1A 2MBFA 4KN4X 4G7OF 1IAWA 1SD5A 1ODDA 3GZ6A 3E6MA 1XGSA 2HS5A 5D6FA 1QZZA 4Q47A 4WK8F 2GA2A 2GWRA 2KIFA 1HKTA 1HKQA 3HTSB 3T8TA 3DF8A 3GFMA 1FP1D 3KZZA 2PN6A 2A6HF 2Q0OA 3AAFA 5FD6A 1REPC 2EV6A 3IC7A 4IPAA 2STTA 5F64A 3JAMK 3I53A 4HDVA 3ZN0A 2VONA 1YW7A 1XDSA 3U2RA 4XLNF 4UNOA 5ICFA 1XGOA 4RB3C 4HBLA 3FX3A 3V8KA 4N9HA 2HDCA 2XAFA 2HWVA 2HTSA 5LGUA 4FX4A 4DQ2A 2P6TA 4EM2A 4N0BA 2Z9OA 3FZVA 3HTUA 3JAMZ 2O61A 4EGZA 2DQRA 2MD5A 1Z1DA 2JT1A 2QUFA 3KP4A 5HLGA 3HRSA 4S05A 2ZKZA 3KCCA 2HYFA 4RAZA 3O2PE 3ML6A 3JTGA 4RGUA 3MFKA 2VOOA 4ASNA 2F2EA 1Z6TA 4XSXF 4HA8A 5H6RA 3ELKA 1ONVA 3P7NA 2YU3A 4EQQA 1G3WA 5AONA 4A5NA 2P8TA 4EJUA 1VTNC 3ZQ7A 2V9VA 1ZREA 5ERIA 3LAPA 3CUQA 1RZ4A 1JGSA 1ON2A 4ON0A 3ECHA 4UV8A 3GW2A 3W6KB 4L9JA 2CW0F