1T39A

Human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
151
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA binding and nucleotide flipping by the human DNA repair protein AGT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3'
total genus 30
structure length 151
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t39A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1t39A01
2VOPA 1O7LA 3WU0A 1HQCA 3AAFA 6PAXA 3LAPA 4FX0A 4M9XA 3KP6A 2MH9A 3RDIA 5ILUA 2MD5A 5HS7A 2VC0A 5K5OA 2HFHA 2IP2A 1ZAOA 2FBHA 1XSVA 2R7FA 5JFRA 1LNWA 1R7JA 3I4PA 5KVRA 2QUFA 2V1UA 4IVNA 3LA7A 4S04A 1OPCA 1IXRC 1SD7A 4BQAA 3HRMA 3ERED 2B0LA 3K9TA 1IRFA 1Z1DA 5F64A 4Q47A 3I54A 2BE5F 2PFBA 3C1DA 4P96A 2NRAC 5E1WA 4EVIA 4M72A 3RYRA 4RAZA 3PFIA 3V4GA 2FSWA 3H92A 5E1ZB 2J5PA 1P6RA 2DW4A 1QZYA 1YS6A 3M7GA 2D45A 1W7PD 4BXUA 1RZ4A 2F5FA 1B4AA 1X3UA 2E7WA 2ZXJA 4MHGA 4KMUX 2ISYA 5L3FA 3BY6A 1J5YA 1AWCA 2FNAA 5DV5A 4ON0A 5HLHA 1K7AA 1W4MA 1MDMB 1XD7A 3TGNA 2EFOA 3W6JB 4UVCA 1D8JA 3PQJA 5BQTA 1C0WA 3ZN0A 3KZZA 5D4SA 1K78A 5A2QZ 2ZKZA 1F1ZA 2K02A 4EGYA 1UHWA 3PQKA 4G94A 1A04A 4B8XA 4EJWA 2LDUA 4KIFA 3QAHA 3ZMUA 3T8RA 5EEHA 2HQRA 2MH2A 3LWFA 3FXQA 4Y17A 4MTEA 4OIRF 4RGRA 1REPC 2P5LC 1WWXA 4Y15A 2K27A 2LF7A 2A3SA 1FNNA 2QZ8A 3QP5A 1KQ0A 1I6XA 2L3DA 3ABTA 1J0RA 4L9JA 4L5IA 1BC8C 1QGPA 1Y0UA 2W85A 3T0YA 3E6CC 5DEQA 3LSTA 4BAYA 4G7HF 1OKRA 1O7FA 2FEZA 4OMZA 2ESNA 1ZG5A 1T0FA 1QBJA 4XBFA 1YIOA 2FRHA 2P8TA 3IKVA 1G3YA 4GO1A 1V4RA 1ZYRF 2HTSA 3H3ZA 3I59B 1I5ZA 1W5TA 4I98B 2DQLA 5DD8A 2DPUA 1S7OA 1F4KA 2AXLA 1ZN2A 5BMZA 1RUNA 3RKWA 3MEXA 2WWYA 1B6AA 1LDJA 2VE9A 2BGCA 3KP5A 4N9HA 1TW3A 3HOTA 1W7PA 2VXZA 2H6CA 3E6BA 1B59A 1HKQA 1LEBA 2VN2A 3IL2A 2TDXA 1T98A 5H20A 3T5XA 1HXDA 4IHTA 3U2RA 2LKPA 2BV6A 3TO6A 3EETA 4M71A 2MLKA 3P9IA 5ICCA 4LB6B 3FXRA 3HHGA 2ZFWA 1RIOH 2DLLA 5CLSA 2DK8A 2ADUA 1S3JA 1WKMA 4YIIA 4UVBA 1K79A 4IRIA 5HOOA 2O03A 1FYMA 4GCVA 3FX3A 2P7CB 3MAJA 5LGNA 3NQOA 2HOEA 1USTA 2Z9OA 4HX7A 1VTNC 2W24A 2A6HF 1TBXA 1U6GA 4LLGF 1XMKA 2YX7A 2PBIA 1LQ1A 2QLZA 3O2PE 4DNCA 3RIRA 3IC7A 1MD0A 2QQBA 3V7RA 3GFJA 4RB3C 5FD5A 1GVJA 5CJ9A 4YFKF 3ZQ7A 3WG9A 3RJPA 1YQAA 4R8HA 2XKOA 1T39A 4EM1A 3V8LA 4OU0A 4ZYHA 4A6DA 4OIPF 2W25A 1NHAA 2DT5A 1XSDA 3LQRA 3ABUA 3WTTC 1SD5A 2L01A 5FB2A 4OINF 4ENNA 1PDNC 2JRTA 1USSA 4HOBA 3D5LA 5DUIA 3GFLA 1XMAA 2CWEA 1I27A 1MGTA 1T38A 2EFNA 1O3RA 2QWWA 2G7HA 3MFKA 3TDZC 1J59A 1EH7A 2QVOA 2COMA 3GVAA 2ZNZA 1F9NA 3DPLC 1QQIA 1DPRA 1T6SA 3HRTA 2A69F 3NRVA 2DU9A 2IJLA 3FMRA 3P7NA 4K2EA 1TQIA 2E1CA 3TQNA 2ACJA 3GO5A 3EYIA 3I0TA 5FLXZ 1LB2A 4EV0A 4RGUA 1YO5C 2F5CA 2ZMEA 2KKOA 1UHMA 2ETHA 2C6YA 4OIOF 1SFXA 1MKMA 1P4WA 5D8KB 5IT9K 2VBXA 2DTRA 1PP8F 2IT0A 3ML6A 3SHFA 2PQ8A 2CFXA 4KUMA 2Q8KA 1DUXC 4KIBA 2STWA 3BJ6A 2Y0MA 1KQ8A 1H9TA 3RKXA 4HQEA 2XGXA 2K7LA 5HLIA 1TW2A 4ZH4F 2L4MA 1EV7A 1ZHFA 4U7DA 1ZLJA 2XASA 2P6SA 1GXQA 3WTUC 5FGMA 1HBXG 3DFGA 3EYYA 1CF7B 5HS9A 3ZPLA 5CVUA 5KK1A 2GZWA 2HWVA 4ENJA 2PI0A 2XVCA 2Y75A 3CUQC 4Y13A 2R7DA 2XKPA 3GLXA 4BHCA 4ZYGA 5D5UB 1J9IA 5BPDA 3HUGA 4IHSA 4OOIA 1FPQA 3WTXC 3HOSA 1WQ2A 1FBQA 3O3KA 3EUHA 1J2XA 1QPMA 3DF8A 2PMHA 1F5TA 2FMLA 3GF2A 2PN6A 2X4HA 5CVIA 5F1RA 3BPVA 2W84A 4KIGA 3TOAA 1U5TB 1YTYA 2QBYA 4L0ZB 1G4DA 1JHHA 2PMUA 2MC3A 1IN6A 5JI6A 3GXOA 1FYKA 2M87A 5HDGA 4IJAA 4MNUA 4M6XA 1ZLKA 2D1VA 3ROUA 1P2FA 2XRNA 4WXHA 3HSEA 3OOPA 3F8NA 2XAGA 1D8KA 4HF1A 1SMTA 3Q5FA 3F8CA 1ZRDA 2IRFG 3QPTA 1WI9A 2XUBA 3GYHX 4WXDA 3F21A 5ILSA 4GGGA 2K4BA 4G9YA 2QYOA 5LHGA 5K1YA 4JBAA 2FBIA 1MJBA 4LK0F 3JAMZ 1UB9A 1YFHA 2J5OA 2MBFA 4Z2YA 2EFWA 2RGVA 3RKYA 3QOPA 3GX4X 5DCFA 5FD6A 5BOXA 1ODDA 4EJVA 1MJ9A 3L09A 2KRFA 1FSEA 1IF1A 3GFMA 1SMYF 4IRHA 3TO7A 3DXJF 4M9SA 4DQ2A 4UHTA 3HYIA 2PG4A 2JTVA 5AIPA 2HEOA 1P4XA 2EFQA 1PUEE 4ENMA 3QU3A 2EV6A 3O6BB 2Q2EA 3L2CA 4HW0A 3H3UA 1ZREA 2GWRA 1YW7A 2E1NA 3DPTA 4NB5A 1ZG1A 4KDPA 3K1PA 2M8EA 2F5EA 4UUVA 1R00A 1B1BA 5LRSA 2BEOA 3GZ5A 5DYMA 2O61A 4ZYDA 1U8RA 2ZCWA 4M73A 1T2KA 3GEZA 1FSHA 3C18A 2DPDA 3F8MA 1RNLA 4RB1A 1OR7A 4KICA 1BOAA 3VEPA 1IN4A 1FWZA 5J6XA 4LB5A 4AVPA 3V8KA 5E1XA 2RN7A 2Z3YA 4TV7A 2PJPA 1HKSA 4UNOA 2ELHA 3QPHA 3MZYA 3W6KB 1XN7A 4HDVA 5BS6A 5CVRA 3GFIA 1G3WA 2Z99A 2GXGA 4R79A 1EH6A 1OMIA 1L3LA 1HKTA 2V79A 2IA0A 2VT2A 2DFIA 3WTZA 5L3DA 2NYXA 2HZTA 2STTA 4GXOA 2EA2A 2UZKA 1XB4A 5LRRA 3HSFA 4G7OF 1S29A 2L54A 4A5MA 3QU6A 3E97A 4M74A 1BM9A 3ECOA 3KEOA 3S2WA 5FLXK 2YSRA 2XAQA 3I58A 4RB0A 3T1BA 4P5OA 2F5DA 4RAYA 4F7ZA 4CZZA 4U7BA 3IWZA 1R5GA 4KMFA 3V7CA 5IT9Z 2BYVE 1DPUA 2O0YA 3MZHA 5LGUA 1QZZA 2EJRA 3I64A 3VB2A 5D4RA 2H27A 4KT5C 1U5TC 1FYLA 1KU3A 3GUDA 3L7WA 4BH9A 4Q4ZF 3ZMSA 3BROA 2OU2A 2VE8A 4UXNA 4YFXF 2ZNYA 3U1DA 1GHCA 4BHPA 3JTGA 2YU3A 2R3SA 2OZ6A 2D2WA 2FXAA 2H6BA 5FFXA 4ETSA 2NNYA 4IXAA 4R1HA 2DK5A 3N97A 1AOYA 4L18B 2EV0A 1SFEA 5E20A 1IW7F 1TQPA 4GYGA 1SD6A 3F23A 2QENA 4FHTA 1IXCA 2EB7A 2FOKA 1SAXA 4A5NA 4N0BA 1ON1A 5JHUA 3COAC 3ISPA 2IW5A 3DP7A 4I02A 2ESHA 3KZYA 3I53A 4L0YB 4A0ZA 1XGSA 3ZMVA 3F6OA 2CGPA 4PZJA 2OD5A 1CGPA 4MQVA 1JGSA 2O3FA 5D8LB 5HLGA 2RVCA 3SQNA 1XDUA 5H6QA 3V8JA 2P5VA 1W7PB 2FBKA 3B02A 3M9AA 3BJOA 2NAZA 1U2WA 1Z9CA 3CO6C 3KP3A 2YR2A 3CUOA 4NHJA 3M8EA 4I2OA 1V3FA 4A12A 2G9WA 1TTYA 4PGGA 2FF4A 5ICGA 4A0YA 1LEAA 4ESJA 2P6TA 2LNBA 2AS5F 1S7AA 1TLHB 1R1VA 1BN5A 2XAFA 5JR3A 2VODA 1G3SA 1QNTA 2QBYB 4HQMA 2GAUA 4O5VA 1ZRFA 2DI3A 3F8BA 3MCZA 3KE2A 2VBZA 1O3QA 4I0AA 1BI0A 3J80Z 4LJZF 1DP7P 3BZ6A 1GXPA 3FM5A 4EJUA 4U0WA 2VONA 2BBYA 4KYWA 4LD5A 3I71A 3K0LA 3BP8A 2GA1A 4PDKA 2L02A 4S05A 5LEKA 5HVQC 1KU2A 1TNSA 2YX4A 3BPXA 5LLQA 3RYPA 4LG0B 3RTRA 3QRFF 2Q0OA 4WWCA 5CVJA 2ZO4A 3DV8A 4LLNA 3ECHA 5D5VB 2JPBA 2HTJA 1ZGJA 4I0BA 5D5XB 1OYIA 1UCRA 2GXBA 2Y48A 2UWMA 3HIFA 2W57A 3WGHA 4KA4A 1YYVA 3E3VA 4JK1X 5DCMB 3R0JA 3JSOA 1ON2A 3EDPA 5L3CA 2HYGD 1KGSA 1IRGA 3DQVC 3REOA 1G3TA 4I7HA 4IPAA 4LK1F 4XSZF 2ISZA 2HKOA 4KN4X 3CUQB 4L9TA 4M9ZA 1XCBA 1HSTA 4MEYF 5HDKA 1R36A 3M8FA 3HRSA 3Q9VA 2Z33A 3J81Z 2QM3A 1ZARA 3CJNA 4HX8A 5CVVA 4U0YA 5LHHA 1DDNA 4G8XA 4UVAA 1BJAA 5L3GA 3HTUA 5LEJA 2OAZA 3WTWC 4HYEA 1EH8A 3WGIA 3JTHA 1ZGAA 4ENKA 1J75A 3KP7A 2FQ3A 2A6EF 1FBUA 3M1EA 1PP7U 4IF4A 2O8XA 1D5VA 3SXYA 5L3EA 3CDHA 4N9IA 4LFUA 1HW2A 2O6GE 1K6OA 1RUOA 3EQLF 4G6DA 4MQ9F 1FC3A 1OYWA 1FT9A 2RQPA 5J8CA 2P5KA 1HSJA 2FA5A 3ELKA 2XAHA 3WE2A 1QO0D 5LBQA 4XLNF 1K78B 1FZPB 5A2QK 3SZTA 5ED4A 4HAMA 4G6QA 2DBBA 1Z7UA 5AONA 1XGOA 4EM2A 3VODA 4WF2A 2OZUA 1E2XA 4RB2C 3N4MA 3NEUA 3TOBA 4LG0A 3TKYA 4EM0B 2CQKA 2XHKA 1D3YA 3HRUA 1HW5A 2V6CA 4CO8A 4HZFA 4EMSA 3KP2A 1IXSB 1H0MA 1IN8A 2KJCA 1YW8A 4ESBA 2VT3A 3J81K 4ZZLA 2HR3A 3HSRA 3WGGA 4BYYA 3MWMA 5DCMA 1TNTA 3QP6A 4Q5SF 3U9GA 1IN5A 3E5UA 1W5SA 5TRDA 3K1NA 5TJJA 1MZBA 5HDNA 3GW2A 1R5HA 3SZPA 4CGZA 2MA3A 2OQRA 2RKHA 4P9FA 4OMYA 2RNJA 5AIQA 2ZBKA 1B9MA 4CXFA 1BIAA 4H0EA 2OA4A 3TO9A 3G3ZA 4U0VA 3L00A 5E8GA 3LAJA 1UFMA 1S6LA 1XDSA 3JW4A 2CSOA 3GWZA 2HDCA 4PGHA 2JT1A 3E6MA 1TQMA 1SFUA 4XSXF 1J7KA 2HGCA 5LGTA 4WCGA 3KEQA 3CO7C 3K69A 1FY7A 3RPQA 3SFZA 5K5QA 3JSPA 2KIUA 5L3BA 4XLPF 3DKWA 2EFPA 5BPIA 2VOOA 2IVMA 1O3TA 1BI1A 2DAOA 3IHUA 2OQGA 1STZA 1U78A 3FXUA 1LVAA 2IA2A 4I09A 4P55A 2A5YB 4ZYEA 5E18F 2D1HA 1LJ9A 4HA8A 3WODF 3I5UA 5HS8A 2LF8A 4P9UA 2NNNA 4HV6A 3V7SA 1I1GA 3CLOA 4AWXB 4AD9A 5DUKA 1S8NA 1BI2A 1Z05A 2VBWA 1KU9A 2HYFA 3R60A 4A6EA 2ZMEB 4RS8A 2KIFA 2M5WA 5D6FA 3KETA 1ZH5A 5E8IA 1Z91A 1KYWA 4Q48A 4G7ZF 4RGSA 2L4AA 3IRRA 1ZRCA 3Q9SA 2X0LA 1ULYA 3BOQA 1FX7A 4HLXA 3F8FA 5LHIA 3BDDA 4AIHA 1Z6RA 5H6RA 1Q1HA 4CDGA 1U5TA 4HF2A 4RGXA 3FZVA 2YPRA 3JAMK 3L9FA 4PCQA 3MQ0A 2FMYA 3LQQA 2FU4A 3KP4A 2A61A 1HW1A 3FF5A 1I1SA 1R1UA 3CUQA 2UXNA 3ZP5A 2XROA 2M1BA 2XIGA 5K5RA 4AIKA 2A07F 4E70A 4FX4A 2KIMA 5FO5A 5IT3A 2WV0A 2EK5A 4KNYA 1O57A 5D6EA 4XRFA 4MTDA 2WTEA 3IRQA 2H09A 3E6DA 3KLNA 3T8TA 4YFNF 2PEXA 4LGWA 3K2ZA 3WE3A 4CICA 5DDGA 3F3XA 1XGNA 2EV5A 2P4WA 4O3MA 2E7XA 1RI7A 3DEUA 4WX9A 2HQNA 3LFKA 2P7VB 4BHBA 3J80K 2LSOA 4B09A 1B9NA 1R1TA 3FMSA 4EJOA 4HLYA 4NQWA 3GZ6A 3R61A 4HV5A 4QWQA 1LDDA 2GIVA 5EEGA 2QQ9A 4OIQF 4HX4A 3BWGA 1YW9A 2FNPA 4IRGA 3VFZA 1KA8A 1Z6TA 3K1MA 1YLFA 1BIBA 3IWFA 2QQAA 1E17A 4CYDA 3WTVC 1FLIA 4BNCA 2XAJA 2V9VA 4ASNA 2NS0A 2CO5A 3FMQA 4CHUA 3OV8A 1WRJA 3KFWX 1MDMA 2PLYA 3FM3A 2KJBA 1O3SA 2VC1A 4LLLA 1H9GA 1R22A 3LA3A 1KQ9A 3J7AO 1R23A 2IA1A 3ZMZA 3HTSB 3ULQB 4GYIA 4FT8A 4HBLA 1MJAA 2M30A 5J8FA 3F72A 2MLGA 4O6JA 1G6NA 2ZJ2A 5D5WB 4UV9A 3R6SA 1OYYA 1CF7A 1JXSA 3FHZA 4HDUA 1IUYA 3KLOA 3F6VA 3F22A 1U3EM 1XSXA 3WTSC 2G7UA 1L0OC 4WK8F 2K4JA 3TDUC 5E17F 2FE3A 4JQFA 2IPQX 2Z5UA 3ZMTA 2K86A 4A2UA 4MEXF 1BC7C 3RPUA 4L9NA 5ILVA 5F6FA 1IZ1A 2XV4S 2JZYA 4U88A 2GA2A 3BJAA 2EA4A 2JPCA 3KCCA 1FP2A 2JSCA 5DD4A 4MGRA 3E5QA 1WSUA 1ZG3A 3G73A 1BBYA 2GQQA 2V1XA 2UXXA 1FOKA 3RI4A 2OBPA 1KU7A 2RV8A 4QLCU 5JVTA 3VOEA 3I59A 2CYYA 2VBYA 3B73A 1BI3A 4LMYA 2DQRA 4L5JA 1R58A 3C3WA 4L9VA 4EJTA 1ONVA 2HKXA 4M6YA 1XGMA 1XCVA 2DO7A 2M45A 2F2EA 5CYVA 3E5XA 3WU1B 1FBSA 2CW0F 1KYZA 4AIJA 5FFZA 3WTYC 3IKTA 3ZMDA 3R0AA 2A68F 2V1DA 4D0PA 5ICEA 3R4KA 2EWNA 1YG2A 3P9CA 4ESFA 2H94A 1P92A 1LDKB 4YIFA 2RDPA 4EQQA 4KN7X 5ERIA 3D0SA 3P9KA 1SD4A 4WXCA 5ICFA 4YG2F 4KFCA 3CTAA 4UV8A 4ZZDA 3FWEA 2RC4A 1FP1D 4A0XA 1P4AA 1IN7A 1YS7A 1JE8A 3ZN1A 3LA2A 1JHFA 4I01A 3HHHA 4EGZA 2HS5A 3C7JA 2WC2A 1IAWA 2CG4A 4HF0A
chains in the Genus database with same CATH superfamily
2VOPA 1O7LA 5KAIC 2DTZA 1RMDA 3WU0A 4DYQA 3SFIA 1HQCA 3AAFA 6PAXA 3LAPA 4FX0A 5HNHA 4M9XA 3VYRB 5HLTA 5DM6F 3MSWA 4DV2E 3KP6A 4UUTA 2MH9A 2WA0A 1TWFJ 3RDIA 2LUPB 4CCMA 5ILUA 2MD5A 5HS7A 2VC0A 4DOZA 5K5OA 2HFHA 2IP2A 2X9DA 2B63J 2KISA 3ABLH 1ZAOA 2E5ZA 2PX9A 2FBHA 1XSVA 2R7FA 2NABA 2IGKA 5JFRA 5K7FA 1LNWA 1R7JA 4NQWB 3I4PA 4C3JJ 5KVRA 2FQ4A 4B47A 2CRGA 2LBSB 2WBSA 2QUFA 2V1UA 3K4KA 2Y9YA 4IVNA 3LA7A 4S04A 1OPCA 1IXRC 1SD7A 1K61A 4BQAA 3HRMA 2R7SA 3MKWB 5EGOA 4Z6YA 3ERED 4BY1J 2B0LA 4OOGC 3KZIC 3K9TA 1IRFA 1Z1DA 5F64A 3L2WA 4ZC3A 1WHNA 2BVLA 3VSLA 4A69C 4Q47A 3I54A 1ZR2A 1A5JA 2BE5F 2PFBA 3C1DA 4P96A 1V5FA 2NRAC 1N3GA 4JI5E 3OSFA 5E1WA 2WAFA 3MVPA 2ZFUA 4EVIA 1YYKA 2M7BA 4M72A 3RYRA 2F8BA 4RAZA 2R93J 3PFIA 3V4GA 2FSWA 3H92A 5E1ZB 2I13A 2WY8Q 3S2DJ 2J5PA 4UB6C 2ME6A 1X1PA 1O4XA 1P6RA 5AC5A 2DW4A 1SC7A 1QZYA 1YS6A 2QSFX 3M7GA 2D45A 1W7PD 3G2BA 1AH5A 5BNGA 4BXUA 1RZ4A 1IQOA 2F5FA 3K4JA 1B4AA 2DMYA 4AQYE 2EOSA 1X3UA 2E7WA 5EDNA 1LPQA 1Y0NA 2R7VA 1IUFA 1OLTA 2ZXJA 4MHGA 4KMUX 1QHGA 2ISYA 5L3FA 3BY6A 1NG6A 1J5YA 3DKYA 2BHZA 1HDDC 1WCMJ 2QSGX 1AWCA 3SEZA 1HNWE 2Y30A 4DMIA 1RKTA 4CCNA 2EMXA 5K7HA 3MHHC 2CW8A 3BR5A 2E2JJ 4B48A 3H09A 2FNAA 5DV5A 4ON0A 3E0JB 5HLHA 1K7AA 2FUG2 1MMNA 1W4MA 3J80C 1TL8A 1XD7A 1MDMB 3TGNA 4XM3A 4TUGA 1FIPA 4BS9A 2EFOA 4DV6E 3W6JB 3KWRA 3DU5A 4DR6E 2RSMA 1QU3A 1RESA 4UVCA 2M4GA 1VQOI 3D5SC 3IH2A 3ABMH 4HPQA 1D8JA 2EM2A 4LOCA 3PQJA 2R7QA 4E7ZA 1TWAJ 2L9SA 3A01A 2N8XA 5CPRB 5BQTA 1C0WA 5J1RA 2EOJA 2V6EA 3ZN0A 1ZAAC 3KZZA 3LSJA 3TP3A 5D4SA 5A2QZ 1K78A 1X6HA 2ZKZA 1F1ZA 3G6EI 5AE1A 2K02A 1V55H 1TP4A 4EGYA 1UHWA 4F54A 3H0GJ 1UAAA 3PQKA 4G94A 1A04A 4B8XA 3JRAA 4DUYE 3CESA 4EJWA 4LF8E 2LDUA 3VYUB 3I56I 4KIFA 2EQ3A 1FIAA 3BR6A 3QAHA 2EPFA 3ZMUA 4PSWA 3T8RA 5EEHA 2HQRA 2MH2A 1XTAA 5CQEA 3LWFA 3RKQA 4L8NA 3FXQA 3DEEA 4Y17A 2WCC3 4MTEA 4OIRF 3BZCA 5GTIC 4RGRA 2CQXA 1YJWI 1OCTC 1REPC 2YTNA 3OYKA 2P5LC 4Q35B 4XLFA 3L1PA 1XPXA 3LSPA 4Y3OA 3M99B 2UU9E 1Z7LA 2B3TB 1MBFA 1WWXA 4Y15A 4CSWA 2L5QA 2R76A 3ZQQA 2EOHA 4J00A 5BR8E 3CP8A 3DCFA 4HEIA 2K27A 4XORA 2LF7A 3S1NJ 2A3SA 1WXRA 1FNNA 1MIJA 3A0BC 2NS8A 2QZ8A 3QP5A 1KQ0A 2OTJI 1I6XA 3EUHC 3OR2C 3DWLE 2L3DA 3ABTA 3QPLA 2CTDA 4DV1E 1J0RA 4NC8A 4L9JA 4L5IA 4N4NB 2LD5A 1QGPA 1BC8C 1Y0UA 2PJRA 3BC8A 1X1CA 1OCZH 2W85A 2BOLA 3IUOA 5FKNA 1QZEA 3QYEA 1VQPI 1Z1BA 3T0YA 3E6CC 3HG9A 3LSGA 5DEQA 1IGNA 2WZOA 5JLWA 1Y1VJ 3LSTA 1FJLA 2EM8A 2LJHA 2L9VA 1W0TA 3PNTA 3K10A 1I94E 2LY2A 4FE4A 2BXYA 2W7NA 4BAYA 3BF2A 4XKWA 4G7HF 2MGQA 1VQLI 1OKRA 1T08B 1O7FA 4BDYA 2EOMA 2R5YA 1YX5A 4DKKA 2FEZA 4OMZA 1WI3A 2ESNA 5LFAA 1ZG5A 1SVMA 1T0FA 1QBJA 3PJRA 4XBFA 5IT9C 4LF6E 3PFYA 4Q28A 1YIOA 5F27A 2CFOA 5JHFA 2FRHA 2P8TA 3IKVA 4C2TA 1G3YA 4GO1A 2L2NA 1V4RA 1ZYRF 2HTSA 2KL4A 2ECCA 3H3ZA 1I5ZA 3I59B 1W5TA 4XRMA 2XAUA 3PL8A 4ANJA 1CQTA 2MDRA 4I98B 2DQLA 1WJAA 2XGEA 5DD8A 2DPUA 1S7OA 1F4KA 2AXLA 1ZN2A 4BU2A 2CW7A 3BBGA 5BMZA 1RUNA 2K5CA 2EQ0A 2LTSA 3RKWA 3MEXA 4XLEA 5EGOB 2BY3A 1UZCA 3V42A 4XLCA 2WWYA 2NVQJ 1B6AA 3OR1C 3JRGA 3K4LA 1LDJA 3OYLA 2VE9A 2BGCA 3KP5A 4N9HA 1TW3A 3HOTA 2B7VA 2EMCA 2F5VA 2EPOA 2Y9ZA 2ENAA 3OYHA 4IOCF 1W7PA 2VXZA 2H6CA 3E6BA 2M9HA 2V1NA 3B6CA 4E7HA 3OYFA 1MSFC 4I99C 2QQ8A 1LFPA 1HF0A 1B59A 2ZC2A 3QPSA 1HKQA 1SFKA 3ZXSA 1LEBA 2LKXA 1UHSA 2VN2A 2I10A 3IL2A 2TDXA 3CMEI 1T98A 2V7FA 5H20A 3HXLA 1QU6A 2YSOA 4AVZA 4U87A 1RRJA 3N05A 1HXDA 3T5XA 3UR3C 1Y1WJ 3JRBA 4IHTA 3U2RA 1X5WA 1I50J 3RZOJ 2LKPA 2BV6A 1YYWA 3HPHA 1JK2A 3A02A 2Y0SN 3TO6A 4IS1C 3EETA 4M71A 2MLKA 3P9IA 4YY3E 5ICCA 1YJ9I 3LSHA 4LB6B 3FXRA 3HHGA 2ZFWA 4F9AB 1RIOH 1U9NA 2DLLA 5CLSA 2DK8A 2YTIA 3A01B 1T95A 2ADUA 1S3JA 3FXJA 1WKMA 3DBRB 4YIIA 4JI6E 4UVBA 1K79A 4IRIA 3EPLA 1U9OA 5HOOA 3GTLJ 2WY7Q 2O03A 3G1MA 3EPZA 2BW3B 2M4IA 5J1UA 2KMUA 1FYMA 4GCVA 3FX3A 1RKWA 1XMOE 2P7CB 3MAJA 5LGNA 3NQOA 2YWQA 3THOB 2WBUA 4NZVA 5GTHC 2HOEA 4F91B 2XPWA 4PUSA 1USTA 3F6GA 2EZHA 4IL6C 1D1CA 2DA5A 2W24A 4HX7A 1VTNC 2Z9OA 2DLKA 2EOXA 2A6HF 2H8WA 1IRXA 5IYBJ 3BT9A 1TBXA 1U6GA 4LLGF 2HDDA 1XMKA 1POGA 2DA6A 2YX7A 2PBIA 4O24A 1LQ1A 2QLZA 3O2PE 4DNCA 1N32E 3RIRA 4UUSB 1AA7A 5CFFE 2OCCH 3HEFA 1MD0A 3IC7A 3G4SI 2E1MB 2QQBA 3V7RA 3GFJA 4RB3C 5FD5A 3ZQLA 1GVJA 3ABKH 5CJ9A 2DYSH 2VJ5A 4YFKF 3JREA 1Z0XA 4DW6A 3ZQ7A 3WG9A 2IS6A 1JTXA 4I76A 3CJQB 2CJJA 4FETA 3RJPA 2FV4B 2UUCE 5KCMA 1YQAA 4R8HA 3ZQCA 4F52A 2XKOA 1T39A 3GTOJ 4EM1A 3V8LA 4OU0A 4ZYHA 2HOSA 4A6DA 4H4KC 4R2CA 2VLAA 2JA2A 4OIPF 2W25A 4PSXA 1NHAA 4R2DA 1IV8A 3OYMA 2DT5A 4GFBA 3FDYA 3LQRA 2Y31A 1XSDA 2EOOA 3J7AG 3ABUA 1AAYA 4J01A 3WTTC 1SD5A 2L01A 3BCAA 1LUJB 5FB2A 4OINF 3VHTB 2ELYA 4ENNA 3ERMA 1PDNC 2JRTA 1USSA 4HOBA 1X6EA 4A3FJ 3D5LA 2EPZA 5DUIA 4HNVA 3LNQA 3TL4X 3GFLA 2R7XA 2DSYA 1XMAA 4B44A 1IDZA 2EPLX 2HNHA 2WAQN 2KZGA 1MBHA 2CWEA 2VI6A 3C4BA 1X3CA 4OX9E 1I27A 4XLHA 2CT1A 3OWTA 2EPUA 4X66E 4GKJE 3NAUA 1MGTA 3X2QH 4KZSA 1T38A 2JVHA 4XKBA 4XKCA 2EFNA 3HPZA 1O3RA 5IYDJ 1NTCA 2QWWA 2B9DA 2O5RA 4FISA 2EPPA 3BG7A 2G7HA 5M5YJ 4AM3A 2LKSA 3MFKA 3TDZC 3HQ1A 1J59A 1EH7A 5HNFA 1UBDC 2QVOA 3FK6A 2F6CA 1GDTA 4BEHA 2COMA 3GVAA 2LREA 3OS1A 2ZNZA 1F9NA 3DPLC 1H8AC 1QQIA 3ZOBA 1DPRA 2O8KA 1T6SA 3HRTA 2IEKA 2EZ6A 2A69F 2CUFA 1ETVA 3NRVA 4KWYA 2RREA 2DU9A 2X6YA 2IJLA 3CCMI 1YJNI 5A6BA 3DTKA 4RH8A 3FMRA 2M7QA 3P7NA 4K2EA 1TQIA 4JX4A 3MKYB 1IQSA 1EKEA 2LY9A 4BJTA 2E1CA 3TQNA 2ACJA 3GO5A 3EYIA 4F9CB 1JK1A 3I0TA 5FLXZ 3IAM2 2XSDC 4Y52J 1LB2A 4EV0A 3AFHA 2WAEA 4RGUA 4HTGA 1YO5C 3CCYA 2F5CA 2ZMEA 4LFCE 1JI8A 2KKOA 4JYAE 1UHMA 2ETHA 2C6YA 4OIOF 2Q2EB 3FKIJ 1SFXA 1MKMA 1P4WA 2W4SA 3K6GA 5D8KB 4XQFA 5HODA 3FBNB 3M8JA 1MBKA 3VSKA 5IT9K 2VBXA 2DA2A 4L5EA 4RAFA 2EOQA 2CH0A 2E35A 4E6KG 1EJ9A 1G2HA 2EN7A 2DTRA 1X58A 1PP8F 2IT0A 2NOGA 1O0WA 2EOFA 2ME0A 3ML6A 3SHFA 2PQ8A 2CFXA 4KUMA 2Q8KA 1DUXC 4KIBA 1MNDA 2CS3A 4XN3A 2STWA 3BJ6A 2Y0MA 3QOEA 1BR4A 1KQ8A 4LIVA 5C4XJ 2PRTA 1WJ5A 1H9TA 4XNFA 3RKXA 4RLFA 3D1NI 4HQEA 1SEUA 5DTDA 2XGXA 2KDZA 3DBHB 3H35A 4BE0A 3H5NA 3G1LA 5KNLA 1LE8B 1IO2A 3S32A 1JT0A 3L2QA 4R2QA 3C6KA 1JTYA 2K7LA 2WADA 1MMGA 5GADJ 4IX7A 5HLIA 3OTOE 1X6FA 1TW2A 4O43A 4IJDA 4ZH4F 2L4MA 1EV7A 4E7KA 1ZHFA 2M3AA 4U7DA 2LTRA 1MH4A 1X19A 3BR0A 3CCQI 5AASA 2JY9A 1ZLJA 2XASA 3CP2A 1JKQC 5IP7J 3TQMA 1A1FA 2P6SA 1GXQA 1W1WE 4EEFG 2HYJA 3WTUC 5J1YA 3HOVJ 1UHZA 1QPIA 3HOYJ 5FGMA 4ZDPA 1HBXG 1WH7A 4C9YA 3DFGA 4NC7A 3M3YJ 1VZ0A 4MO7A 3EYYA 1CF7B 1T0FC 4MIMA 5HS9A 3ZPLA 1FTZA 4Y4RA 5CVUA 5FJ8J 4R8OA 5IV8B 4WPYA 2E34A 5KK1A 1MBJA 2P0WA 2GZWA 2JQ7A 1GVDA 2HWVA 4ENJA 2PI0A 2M7AA 2XVCA 2Y75A 2YTGA 5B5EC 3CUQC 2E2IJ 4Y13A 2HXIA 2E1MA 2R7DA 2XKPA 3GLXA 4BHCA 4ZYGA 3CCUI 1DQUA 2L2MA 2L3JA 5D5UB 1YHQI 2JR1A 1J9IA 2ZMEC 1MEYC 2ADRA 5BPDA 2ZXWH 3HUGA 3KYCB 4OOIA 4IHSA 3AV0A 2NUEA 1FPQA 3WTXC 5J4YA 3BQYA 2NVXJ 1XG1A 3HOSA 1WQ2A 1K4TA 2CPNA 1FBQA 3O3KA 2X6WA 2R7ZJ 3EUHA 4NUBA 1J2XA 1QPMA 3DF8A 2VIXA 4HSTA 2NS7A 2PMHA 1F5TA 4II2A 2EBIA 4IZZA 2VJIA 2FMLA 2M34A 3LLHA 3GF2A 3PNVA 1DGCA 3JRIA 4R2SA 2PN6A 2GLOA 2X4HA 5CVIA 5F1RA 2E1OA 4RBOA 1ZELA 3BPVA 2XC7A 2Z1DA 2W84A 2V83A 4KIGA 4KITB 3TOAA 1U5TB 1FTTA 1YTYA 1YITI 3IV5A 2QBYA 3DBLB 4B3XA 4L0ZB 1X1BA 3MZ8A 5F0FA 2L8TA 1B72A 1G4DA 4JI8E 1JHHA 2PMUA 3FXLA 2WAQA 2MC3A 3TBIA 4X6AJ 1IN6A 2MFZA 2JRMA 4F92B 3GXOA 1WFXA 5JI6A 3AUZA 1FYKA 2QGUA 3OIQA 2M87A 5HDGA 4IKFA 2NA2A 3G1OA 2MW8A 4IJAA 4BJ6C 2LCEA 4MNUA 3A4CA 4M6XA 3JRCA 1ZLKA 5EYRA 2D1VA 3ROUA 1P2FA 2QKMB 2XRNA 4WXHA 3JAMC 3HSEA 4BC9A 4N4OB 3PIOF 2B7TA 3OOPA 2UXBE 5IP6A 3F8NA 2VUMJ 2W48A 2OF7A 3GZNB 1D1AA 2XAGA 4LFBE 1D8KA 2EORA 4HF1A 3ADLA 1GUUA 4R2RA 4IHWA 2H1KA 2I8DA 4NXNE 1SMTA 3Q5FA 3F8CA 4JYKA 1ZRDA 2IRFG 1IG7A 3QPTA 4OWRB 1G2FC 5EEAA 3RCOA 4CYCA 1HDPA 1WI9A 3IP4B 2O9LA 2KOUA 4LFAE 2XUBA 3GYHX 4WXDA 3F21A 1X2NA 5ILSA 4GGGA 1A31A 1ZBTA 4M9VC 4JV5E 4PFPA 2K4BA 2CMPA 4G9YA 2QYOA 3QYFA 5LHGA 1E3PA 5K1YA 4DV7E 2LBFA 4JBAA 2FBIA 2VKDA 3CCLI 2ZXIA 1MJBA 4E7IA 2K9LA 4LK0F 3JAMZ 2EPAA 1UB9A 1YFHA 3S1QJ 2X1DA 1ZR9A 4OAZA 1RETA 2J5OA 2MBFA 3BTLA 1I6HJ 4Z2YA 1RPWA 2EFWA 2EP3A 2RGVA 3RKYA 3QOPA 4YRVA 1MNMC 4BC7A 3GX4X 3S17J 5DCFA 1JUSA 2EMGA 5FD6A 5BOXA 4CYCB 1EA3A 1QVUA 1ODDA 4BQQA 3CCEI 2Y69H 1UJ8A 2KRHA 3JCUC 4EJVA 1VFCA 4M0VA 1I39A 1MJ9A 3L09A 2KRFA 1FSEA 1FMWA 1IF1A 3GFMA 1QA6A 3WG7H 1SMYF 2W82A 3BGHA 4IRHA 3GTPJ 3AG4H 3TO7A 3DXJF 4M9SA 4DQ2A 4UHTA 1BBOA 3RQIA 3HYIA 5IP9J 3OIPA 1A1GA 2PG4A 2FGGA 1YI2I 2JTVA 5AIPA 2HEOA 1P4XA 5E79C 2EFQA 1PUEE 1Y56A 2HZDA 4ENMA 3QU3A 1FJGE 1Z3XA 2EV6A 3O6BB 2Q2EA 2F4IA 3DLLF 3L2CA 4HW0A 2K4VA 3H3UA 4GEQB 4M6VA 1ZREA 3M07A 2GWRA 5EZHA 1YW7A 2X1CA 4G6TB 2E1NA 3DPTA 2YRHA 4X9JA 4NB5A 4AYBN 9ANTA 1ZG1A 4KDPA 3K1PA 3Q0WA 1J09A 2M8EA 2JOBA 5A6BD 2F5EA 4UUVA 1R00A 2KFDA 1B1BA 4A3CJ 3C2GA 1A6QA 5LRSA 4DR7E 5M5XJ 2HOAA 3H5AA 4NC6A 4GZNC 2BEOA 3GZ5A 3TEDA 4UUSA 3HOZJ 2VF1A 5DYMA 2O61A 4ZYDA 1U8RA 3VYSB 2DGCA 2DOFA 2ZCWA 3H9QA 3HBLA 3DF6A 4JI1E 1TWCJ 4DJAA 4M73A 1T2KA 2H36X 1TN9A 3SJMA 3AG2H 3BR3A 3ZCOA 3GEZA 1FSHA 3C18A 4XMYA 2DPDA 3F8MA 2JA8J 2XF5A 1RNLA 4CCLA 1OR7A 2LLKA 4RB1A 4KICA 1BOAA 1M1EB 2EMFA 1W36D 3VEPA 3J7YJ 1A1HA 2EPKX 1IN4A 1FWZA 5F04A 2DMIA 2J7JA 5J6XA 5M3MJ 4LB5A 2DJIA 4AVPA 3V8KA 5E1XA 2RN7A 1KJKA 2Z3YA 1P7IA 2DXIA 1TF6A 1UG0A 2HPIA 4TV7A 5FKOA 5C44J 2PJPA 4BCAA 1HKSA 4LF4E 4UNOA 1IBLE 2ELHA 3QPHA 4A93J 3MZYA 3HZJA 4D5CA 3W6KB 1XN7A 4HDVA 3K2AA 5BS6A 4QIWN 1B8IA 2CV1A 3GTMJ 2L3CA 5CVRA 3GFIA 1X47A 1G3WA 2Z99A 2GXGA 4R79A 2EMHA 2BY1A 2EL4A 3ZQGA 1BW6A 1EH6A 1OMIA 4BEHB 1L3LA 1HKTA 2V79A 2IA0A 4AU7A 2XDVA 4L5NC 5EJCA 5LMUE 3LMMA 3S14J 1ETOA 2VT2A 4DZJA 1BR2A 1H89C 2DFIA 3WTZA 5L3DA 1NH3A 2JPAA 1SANA 2HZTA 2NYXA 3BR2A 4GXOA 2RNGA 2STTA 5AE2A 2DFEA 4FCYA 2EA2A 1R4NB 4JI4E 1SR9A 2UZKA 1XMQE 1XB4A 5LRRA 2ENHA 3HSFA 3MKZA 1GLNA 2IGMA 2TCTA 4G7OF 3PO2J 1S29A 2L54A 4HEA2 4A5MA 3QU6A 5IY5H 2V88A 2V9KA 3ZQHA 3E97A 2L2KB 1YPNA 4M74A 1ZGWA 1BM9A 2BB8A 3MHSC 2A5WA 5M5WJ 3ECOA 5TSEA 4RMNA 3KEOA 3S2WA 5FLXK 2YSRA 4F93B 2XAQA 3I58A 2HVQA 3ADJA 3PM1A 4RB0A 3T1BA 4P5OA 2F5DA 2GXAA 3UNGC 1VF9A 1A35A 4RAYA 4IQJA 2EPNA 1HLVA 3PSFA 1JUPA 1NCSA 4F7ZA 4DGWB 2YTOA 4CZZA 4U7BA 2DJNA 3BLYA 3IWZA 3KX2A 1R5GA 5IWAE 3SDGA 4KMFA 2KRCA 3OYAA 3V7CA 5ADZA 4B3SE 1DGRM 5IT9Z 1W36C 2BYVE 2IXSA 2LFBA 1DPUA 2O0YA 2VL8A 3MZHA 3RMPA 5LGUA 4C2UA 1QZZA 1YIJI 3OYBA 3QWLA 2EJRA 1OR7C 4BKXA 3HOXJ 3I64A 2L7ZA 3VB2A 3W2VA 4BGDA 5D4RA 5A6JA 2CU7A 4XONA 2H27A 4KT5C 2BVMA 1U5TC 1YRNB 1FYLA 1KU3A 2OPTA 3HUGB 2BBGA 2YT4A 2BZTA 1RR7A 2DCEA 3GUDA 3L7WA 4BH9A 2HOTA 4Q4ZF 5B1AH 3ZMSA 3BROA 4RM2A 2OU2A 2VE8A 4C3IJ 4UXNA 4YFXF 2ZNYA 3U1DA 3AKZA 2EN6A 1X3ZB 3K4CA 1GHCA 4BHPA 3I4MJ 3HPSA 4JI7E 3JTGA 4D9JA 3J7AY 2YU3A 2OV7A 2E60A 2R3SA 3CMAI 2CUEA 2OZ6A 2D2WA 2L92A 1HR0E 2FXAA 4BY7J 5E3MA 2H6BA 3RSNA 1MH3A 4HRIA 4B3RE 5FFXA 4ETSA 3AL0C 1VQ7I 3BIDA 2NNYA 3FHNA 4IXAA 4WYQB 4R1HA 2DK5A 1PJSA 4RAGA 3N97A 1YRNA 2BHYA 2DOEA 2JUCA 2L7KA 1AOYA 4L18B 1XNQE 2LT7A 2EV0A 1DGWY 2ZJQF 2D9HA 1SFEA 5E20A 1IW7F 1TQPA 1BB8A 1R4MB 4GYGA 1SD6A 3F23A 2YU8A 2QENA 3CLQA 3K4MA 2CV0A 4FHTA 1IXCA 2EB7A 2DMNA 2FOKA 1SAXA 4A5NA 4N0BA 3VYYA 1Y6IA 1OCRH 1HNZE 2DMPA 1ON1A 4BBYA 1TWHJ 5JHUA 2LUQA 3COAC 2UUAE 2BY0A 4M3EA 2HPMA 4C2MJ 3ISPA 1WGXA 2IW5A 1Q1VA 3KPHA 3OL3A 4BQOA 3DP7A 3HKZA 4I02A 2ESHA 4PFOA 3Q0UA 3KZYA 2W1OA 2L9NA 3I53A 2RQQA 3KIOA 3LSKA 4L0YB 4A0ZA 4O4KA 3DU6A 1XGSA 4BACA 2MKDA 3ZMVA 2EZLA 3F6OA 2XRLA 2O7OA 2CGPA 4PZJA 2OD5A 1CGPA 4MQVA 3A03A 1JGSA 2O3FA 3E1SA 5FLMJ 2EL5A 1YUIA 5D8LB 1SVLA 2EH3A 5M3FJ 5HLGA 2RVCA 2WBMA 3BTCA 2ELZA 3SQNA 3RQ4A 3DTIA 3S8PA 1XDUA 5H6QA 4ABZA 4ZTJA 3CC4I 2XGCA 5A69A 3V8JA 2P5VA 1W7PB 2FBKA 1BBGA 3B02A 3M4OJ 2F4VE 2BY2A 3M9AA 3BJOA 3OIOA 2NAZA 3AL0B 1U2WA 3ZR8X 1Z9CA 3CO6C 3KP3A 2YR2A 3NWSA 3CUOA 2LTPA 1Y8RB 5F0HA 4NHJA 3M8EA 3FKJA 3WHBA 4I2OA 3MD2A 4CZCA 1V3FA 3EPHA 4A12A 2G9WA 1TTYA 4LITA 4PGGA 2FF4A 4YELA 3WHCA 1NG7A 5ICGA 5KL3A 4A0YA 2L6MA 1LEAA 1MMDA 4ESJA 2P6TA 1PYVA 4QSHA 2LNBA 1S9HA 2AS5F 2DA4A 2EM5A 1S7AA 1TLHB 5GAHJ 4X62E 1R1VA 4XOPA 1BN5A 4R2PA 1I3AA 2A6TA 2L0KA 2XAFA 1U8BA 1W0UA 5JR3A 2VPRA 2VODA 1UN6B 2EQRA 3S3MA 2EOIA 1OCCH 2EPRA 4C30A 1VQ4I 1V5EA 2QKLB 1G3SA 4R03A 1HNXE 4LF9E 1WJCA 1QNTA 2VKVA 2DOAA 2QBYB 4HQMA 1HA8A 3JRFA 2GAUA 4O5VA 1ZRFA 2DI3A 3F8BA 3MCZA 3TP0A 3KE2A 4F55A 1IBKE 2WV1A 2VBZA 2BW3A 2DYRH 1OFCX 1ETKA 3OYCA 1YSAC 2ZSIB 1O3QA 2Q1ZB 2LY1A 3HPGA 1BI0A 4I0AA 3SEQA 4D7NA 4IEJA 4LJZF 3J80Z 2M1SA 2JN6A 1DP7P 1ETWA 3BZ6A 2B7EA 1GXPA 2YTFA 1WJFA 4LG3A 1MBEA 3FM5A 1X1AA 2D5VA 4EJUA 4U0WA 3OMLA 2VONA 3DKXA 1IMUA 2BBYA 3HM5A 5FLVA 4KYWA 4LD5A 2EIKH 1A1IA 3I71A 3K0LA 3BP8A 2YPNA 2EM4A 2GA1A 4PDKA 2L02A 2DDBA 4S05A 2FOWA 3AG1H 5IOZA 4J19A 2VKHA 5LEKA 2V86A 3UKGA 2K9NA 2LOOA 2AHQA 5HVQC 4FASD 4DIQA 1KU2A 2JOXA 1TNSA 2YX4A 3BPXA 1B69A 1PJRA 5LLQA 1JUMA 3RYPA 4LG0B 3RTRA 1HC8A 2MC5A 1OISA 2GBYA 1PDAA 3CCSI 3EQ1A 1R5ID 3QRFF 2Q0OA 4WWCA 2X6XA 2ZM6E 5CVJA 2ZO4A 3DV8A 4LLNA 3ECHA 5D5VB 2XPVA 2JPBA 2RSIA 2HTJA 4LF5E 1ZGJA 4X64E 4V19K 1KYQA 4I0BA 5KAFC 2LMDA 2HDWA 5D5XB 4DR5E 4BBRJ 4MFDA 3TW6A 2CQQA 1OYIA 2HXOA 3H1CA 2V89A 1UCRA 3TW7A 4NNJA 2GXBA 5E3OA 2EPXA 2Y48A 2DODA 2UWMA 3HIFA 2F4MB 2W57A 3WGHA 2EM9A 3FXOA 2VB6A 4KA4A 1YYVA 2L9RA 3E3VA 1A1KA 2M0MA 4M3DA 4JK1X 2F4OB 3BG3A 4OAYA 1FKAE 1RQ0A 2ELKA 5DCMB 3R0JA 2EJ4A 3E7LA 3JSOA 1ON2A 3EDPA 1Z21A 5CKTA 3OYGA 5L3CA 3TMOA 2VE7C 2R7UA 1X4OA 1TZLA 3H0DA 2IS1A 2EMYA 2P81A 1OQYA 4M30A 2IHR1 2HYGD 1KGSA 2ELJA 1JT6A 3LSIA 1IRGA 2Q8UA 5EZGA 3DQVC 2EL6A 4XK4A 4XL9A 2G0EA 3D5RC 5KHDA 4CH7A 2ZSHB 1G3TA 4I7HA 4IPAA 4LK1F 4XLAA 3REOA 3EPJA 3K4NA 1OCOH 4XSZF 2EM6A 3GMEA 2ISZA 2HKOA 4KN4X 4C3HJ 3CUQB 3GBGA 3HGYA 1BL0A 1OJLA 3BG5A 1GT0C 2R0QC 2LG4A 3C4TA 5DM7F 2KDOA 4L9TA 3CJTB 2ZB9A 5TGTA 4M9ZA 3O8HA 4DBRA 1XCBA 5FLXC 3JU0A 1HSTA 4MEYF 5HDKA 3L2RA 2HVSA 3QODA 1EF4A 2EMBA 4CCJA 1R36A 2EMAA 2GLIA 3M8FA 2R4GA 3HRSA 3Q9VA 4GRIA 2HU9A 3ASOH 1KZHA 4D1QA 3CCRI 2EN1A 1ORKA 2ZXHA 2Z33A 4ZTFA 3J81Z 2QM3A 1ZARA 3CJNA 4HX8A 1EKZA 3GLLA 1V5GA 2HQ5A 1I3QJ 5CVVA 1IV6A 1R6RA 2YU9J 4NXME 1N34E 4I6ZA 4U0YA 5LHHA 2X6OA 3M1CA 1DDNA 2OJED 4M3FA 4G8XA 4UVAA 1BJAA 5L3GA 4YIRX 5LMNE 5J4VA 2KHXA 2KT0A 3HTUA 3G71I 4F6NA 1F36A 4DUZE 5LEJA 3PNYA 5AC4A 5FROA 2KP6A 1YZ9A 2V85A 2OAZA 3WTWC 4HYEA 1EH8A 3NARA 2R5ZA 3WGIA 3LSRA 2MYSA 3JTHA 1ZGAA 2VJ4A 5F08A 5J47A 2K3FA 4P78A 1X2MA 4ENKA 1T33A 4W97A 1J75A 2ICWG 3B6AA 3KP7A 2EZIA 2FQ3A 2JYAA 2EM7A 2A6EF 2HQAA 3VWBA 1K83J 2VQFE 1FBUA 1B72B 3M1EA 3S2HJ 1JKPC 2EWLA 1PP7U 4IF4A 2O8XA 3GTKJ 3GCMA 5EF6A 1T56A 3DTEA 1D5VA 4KJZA 2DFFA 1F43A 3SXYA 2AQFA 5L3EA 4EATA 2ECBA 1WVRA 3CDHA 3JTZA 2EOZA 4N9IA 1SVOA 4LFUA 1HW2A 2O6GE 1K6OA 1RUOA 3EQLF 4G6DA 3A2KA 2MG4A 2DN0A 1FC3A 4MQ9F 3BR1A 1OYWA 2M8GX 3H9GA 1FT9A 2RQPA 2A25A 5J8CA 2Z16A 4A3EJ 2P5KA 1HSJA 1MSEC 3ASNH 2FA5A 3ELKA 5LD2C 2ZJRF 2VRDA 2XAHA 3WE2A 1RR8C 3OYDA 1QO0D 5LBQA 4XLNF 3OYIA 4JX5A 1K78B 2VQHA 1FZPB 2K3PA 1XX5A 5A2QK 1A36A 3HKZN 1ACIA 3SZTA 4M2ZA 5ED4A 3UK3C 2VXDA 4HAMA 3P5JA 4G6QA 4IQ4A 5FRNA 1T4NA 2UXDE 5KL7A 2DBBA 1Z7UA 5JLXA 4GDFA 5AONA 1XGOA 5GPCA 1D1BA 2EPCA 4DR1E 4EM2A 3W3CA 3VODA 3I3LA 4PK4A 4WF2A 2OZUA 3CCVI 4LU9A 3C2BA 1E2XA 4RB2C 3N4MA 3NEUA 2EIJH 4BE1A 1ZBQA 3TOBA 4LG0A 3TKYA 4EM0B 2CQKA 1IC8A 2HVRA 4B3TE 1G59A 2XHKA 1D3YA 3CZ6A 2GM4A 2NVTJ 3HRUA 2MABA 2M0CA 1HW5A 2N8GA 2V6CA 4CO8A 1AKHA 4HZFA 3CC2I 4EMSA 3KP2A 3IH4A 4CCKA 1IXSB 1S5LC 1UMQA 3S1RJ 3H5RA 4XOTA 1IN8A 1H0MA 4DV5E 1TT0A 2KJCA 1YW8A 4ESBA 1XMXA 1HOMA 3CF5F 2EM3A 2VT3A 3J81K 3HOWJ 1WHQA 1LFUP 2HR3A 3HSRA 4ZZLA 3WGGA 4BYYA 3MWMA 5DCMA 5C4JJ 2IBDA 4XR6A 1TNTA 2IS2A 2XF7A 2YRKA 2A05A 3QP6A 3FK7A 4R2EA 4Q5SF 2VQGA 3U9GA 2I9IA 1IN5A 1B8IB 5IYCJ 3E5UA 3A0HC 4J8ZA 1W5SA 5TRDA 3PO3J 3K1NA 3OYEA 5TJJA 3VYTB 3W6VA 1MZBA 3Q0VA 3GW2A 5HDNA 1R5HA 2LC2A 2CV2A 4JX6A 3ADGA 2AQEA 3OYJA 1ERDA 3MN2A 3SZPA 4CGZA 2KLOA 4JI0E 2OC6A 2HGHA 1LKXA 5K7ZA 2MA3A 4Y7NJ 2OQRA 2RKHA 4P9FA 4OMYA 2EMZA 1E0EA 3LSMA 2K40A 1FMVA 2RNJA 5AIQA 2EN2A 2ZBKA 2LK2A 4CUGA 1B9MA 4CXFA 4WSPA 2R7TA 1BIAA 4H0EA 4V2FA 2OA4A 1TT5B 3CQZJ 3TO9A 2GOMA 5E3LA 2EQ1A 3G3ZA 4U0VA 3L00A 3CDLA 1APLC 2LYCA 5E8GA 3U1KA 3LAJA 1JJ8C 3OS0A 1UFMA 2OCEA 2WB1A 2LP0A 3IH3A 1S6LA 1XDSA 3JW4A 3HDDA 2CSOA 1A1JA 2YTDA 1TC3C 3GWZA 2HDCA 2WBTA 4PGHA 4KT6A 3VDXA 2JT1A 3E6MA 2UUBE 1TQMA 5FKMA 1SFUA 2YTEA 4XSXF 1BJZA 4V2GA 2Y2ZA 4MFEA 1J7KA 2HGCA 1ZR4A 5LGTA 2JA6J 1ZU1A 4WCGA 2DFHA 3KEQA 3CCJI 3CO7C 3K69A 1FY7A 4D5FA 3RPQA 4NDLA 3SFZA 2CUZA 2MSYA 5K5QA 2K7IA 4BBSJ 3BG9A 3JSPA 1N33E 3SDBA 2KIUA 5L3BA 4XLPF 1WZ2A 3WU2C 3DKWA 2EFPA 5BPIA 2VOOA 2X85A 2IVMA 1VQ5I 2N3GA 5AE3A 1O3TA 4UY8I 1BI1A 2DAOA 3IHUA 4BJ5C 2OQGA 1K4SA 1STZA 1U78A 2KIQA 3S15J 3FXUA 4DBQA 2EIMH 1LVAA 1XS9A 2IA2A 1N77A 4K0KE 4JI2E 4W1UA 4I09A 4BUPA 4P55A 1IRZA 2LBFB 1K6YA 2A5YB 2EMLA 4II3A 1G8XA 4ZYEA 5E18F 3JR9A 1ZKGA 2D1HA 1LJ9A 2K9QA 2KQRA 2LO3A 2VQCA 4BQNA 4HA8A 2H1LA 5T6JA 3WODF 2R7RA 2M9AA 3OS2A 1Y8QB 3I5UA 5HS8A 3KYLA 2F48A 1PUFA 4B3ME 2LF8A 4JP0A 4P9UA 2NNNA 1JJ6C 4HV6A 3V7SA 2DIXA 5IOYA 1I1GA 3CLOA 5F0CA 4AWXB 4AD9A 5DUKA 4BXXJ 3THNA 1S8NA 1BI2A 1Z05A 1H88C 2QA4I 4DV4E 3LFUA 2VBWA 3F0CA 4X1EA 4XKVA 4XICA 1BOBA 2RS7A 1D5YA 4QTRA 4DV0E 2CSHA 1KU9A 2VQLA 2HYFA 3OYNA 3H3VK 3R60A 3ZRGA 2CQ7A 1SAUA 4A6EA 1LE8A 2ZMEB 4RS8A 1QRYA 1Z67A 2KIFA 2M5WA 1PKPA 2YRMA 5D6FA 5TISC 3KETA 5IXMB 2K9MA 4AIDA 5CQGA 1ZH5A 5E8IA 2WB1N 1Z91A 1KYWA 3ADIA 2HC5A 2V26A 4A3BJ 2GHFA 4Q48A 4M3BA 4G7ZF 3EUKL 2YSPA 4CA0A 1ETYA 4RGSA 2L4AA 4BL0B 3FXMA 3GTJJ 2KONA 3J7Yp 4WFTA 4HNTA 3I55I 3IRRA 1VQ8I 1V54H 1ZRCA 3W2AA 2JUGA 1GV5A 3Q9SA 2DA7A 3KYDB 4IO9F 3FBIB 5EG0A 2X0LA 1ULYA 3EUAA 2QF7A 2COBA 2XB0X 3BOQA 5F1JA 4IHXA 3DPUA 1FX7A 2FD5A 4HLXA 3F8FA 3BTJA 1XC5A 2YS9A 5LHIA 3BDDA 4AIHA 2DB2A 2OTLI 2PMZN 1Z6RA 5H6RA 1Q1HA 4D7MA 4CDGA 2ENCA 5A2QC 1U5TA 4HF2A 2LRDA 2EE8A 1T4LB 4RGXA 1IBME 4ZJZA 3FZVA 3I4NJ 2YPRA 1LFBA 3K4BA 4B1RA 3L9FA 3JAMK 4TUIA 1L4SA 4PCQA 3PUBA 3MQ0A 3H36A 2FMYA 4KISA 4X0GA 2L2OA 3LQQA 2EMIA 2PMZA 2FU4A 3LMLA 3BCBA 2MC6A 3KP4A 2A61A 1HW1A 2CQNA 1QVTA 3FF5A 4F3QA 1T4OA 2L33A 1I1SA 1R1UA 3C6MA 2GOXB 1VQ6I 3HTXA 3L2VA 2E1MC 3CUQA 1E3OC 5E3NA 2UXNA 3ZP5A 2XROA 2HJJA 3S3NA 1ETQA 2M1BA 5GAEJ 1X48A 2XIGA 5K5RA 4XN0A 3IWDA 4AIKA 1DU6A 4IHYA 1WJEA 2EPMX 4KHPE 2A07F 2JVAA 4E70A 4FX4A 2KIMA 2K85A 5FO5A 3OL4A 2WV0A 2L7MP 5IT3A 2EK5A 4KNYA 1O57A 3QYBA 1VNDA 4XRFA 5D6EA 2WTEA 4MTDA 2VJJA 3IRQA 1AU7A 3T1HE 2H09A 2QCOA 1PVEA 3ESWB 2EINH 5A6KA 2NUGA 3ONQA 1Z3YA 1RC9A 2DMQA 3E6DA 3KLNA 3T8TA 4YFNF 2PEXA 3VPRA 3S93A 4LGWA 5F3WA 2E19A 3KEYA 4JOMA 3K7AJ 3K2ZA 5J3LA 2JA7J 3WE3A 4CICA 5DDGA 1MW7A 4E4HA 2R5YB 2PJRB 4CCOA 4RHBB 3F3XA 1XGNA 2EV5A 2P4WA 4S0HB 5FKLA 4O3MA 2E7XA 1RI7A 3QQAA 3CDIA 3DEUA 3MMYB 4WX9A 4RLQA 3F6HA 4YHHE 2JWOA 1FOYA 4BDZA 1LVKA 3LOCA 3F9KA 2HQNA 4A3DJ 5A6AA 2FJ1A 2JVGA 1ZTRA 3LFKA 3S1MJ 2P7VB 3CMMA 2DLQA 4BHBA 3J80K 2LSOA 4B09A 1B9NA 1R1TA 3FMSA 1VQNI 1DP3A 4R2AA 4HG2A 4EJOA 4HLYA 2UUZA 2Z2SB 4NQWA 3GZ6A 3R61A 4ITVA 2JMWA 2IGNA 4ZDOA 3A1YA 5KL6A 3CJRB 4HV5A 1IAWA 4QWQA 2EMWA 1LDDA 2GIVA 5EEGA 2JSPA 3HC7A 2NVYJ 2NOJB 2QQ9A 4Y33A 5FKKA 4AYBA 2EILH 5J40A 3PIPF 1VQMI 2VQEE 4OIQF 3PUFA 4HX4A 4X65E 3BWGA 1YW9A 2FNPA 2LE2A 3BZKA 4DZPA 4IRGA 3VFZA 1KA8A 2ODRD 1XNRE 1Z6TA 1P9QC 2M2EA 1N75A 3K1MA 1YLFA 2AO9A 1BIBA 3JRDA 3VK6A 3IWFA 2YU5A 2YTJA 2QQAA 3FIWA 4LF7E 3L2UA 2EOEA 2X48A 1J5EE 1E17A 2KZVA 4GKKE 1ETXA 4CYDA 3WTVC 1FLIA 4BNCA 2YZTA 3P1XA 4RA2A 2XAJA 2V9VA 2MDGA 3OY9A 4LIUA 1D0XA 4ASNA 1MBGA 5IPAA 4DR4E 2NS0A 1SFOJ 2CO5A 3FMQA 5B3SH 1JGGA 2GPIA 4CHUA 2QSHX 3OV8A 1WRJA 2UV1A 2X51A 2YTQA 1LLMC 3KFWX 1MDMA 2PLYA 2MKNA 4G12A 3FM3A 2KJBA 2EN4A 5DNYA 1S72I 2JP9A 2KHMA 1AHDP 2RS6A 2NXNB 2ZJPF 1O3SA 3IAS2 2VC1A 1DU0A 4LLLA 5EG0B 3HOUJ 1H9GA 1R22A 2DRPA 4O5GA 3LA3A 5FRMA 2LJUA 4NBQA 1KQ9A 3J7AO 1GV2A 3T1YE 2R7OA 1R23A 2IA1A 3ZMZA 3HTSB 3ULQB 2JWTA 4PJ0C 5H2FC 4GYIA 1AKHB 2RQLA 2EZKA 2LVSA 2X1EA 2W00A 4FT8A 5C3EJ 3CD6I 4HBLA 1MJAA 4FQGA 1WJDA 1MMAA 3SYTA 4A3KJ 2E71A 4F9BB 2M30A 4QPOA 5J8FA 3F72A 2L7FP 3HJEA 3CC7I 3C2HA 4E7JA 2MLGA 4O6JA 2E36A 1G6NA 3I9V2 5DS9A 2ZJ2A 2V4JC 3S16J 3ZQIA 5D5WB 3GTGJ 1GZ6A 4UV9A 2TRTA 3R6SA 1OYYA 1CF7A 3J7ZI 1MMSA 1N25A 1JXSA 2R1FA 3FHZA 4HDUA 2LRSA 1IUYA 1P7JA 2EN3A 4BMJA 1JKRC 3KLOA 3FIGA 1A1LA 3F6VA 4B3AA 5GAGJ 4HNUA 2HI3A 2DDAA 5KL2A 3F22A 1G2DC 5B1BH 4DYCA 3K70C 1U3EM 2GIZA 1XSXA 3WTSC 2G7UA 2K9SA 1D0YA 2R5ZB 4F2JC 1L0OC 2EMKA 4RDUA 4WK8F 1WH5A 2EM0A 3K6QA 2CUJA 2K4JA 4P1WA 4FE7A 1NK3P 3HGGA 1GQEA 1F2IG 1QHHD 2AXTC 4NHRA 3TDUC 2RPCA 5E17F 2FE3A 4X8WA 2I5UA 2E2HJ 3VYXA 4JQFA 2IPQX 2LH9A 4F6MA 1YOVB 4HSRA 3GTQJ 1VI0A 4E7LA 2Z5UA 3ZMTA 2K86A 1TF3A 2XSJC 4A2UA 4MEXF 2JJ7A 1BC7C 3DJWA 3RPUA 1ZK8A 4L9NA 1IJWC 5ILVA 1MNEA 1J26A 3IWCA 5F6FA 1UELB 1X1DA 1NEIA 1S7EA 4E7SA 4I8OA 1IZ1A 1Y39A 3ZOQB 2XV4S 3OSGA 1OCPA 2JZYA 3LL7A 3BG6A 4A3JJ 2N3HA 4FTHA 4U88A 2GA2A 3BQZA 4IHVA 4DYRA 3BJAA 2EA4A 2FX0A 1A6IA 2JPCA 5KL4A 1IDYA 2DT6A 2E5NA 3KCCA 2IAIA 1FP2A 3K70D 4JI3E 2JSCA 1PJQA 4UB8C 5DD4A 2EN8A 4IOAF 4MGRA 3E5QA 1ZG3A 1WSUA 2DA1A 3G73A 4PJMA 1BBYA 5LL6R 2M4KA 1Z77A 2GQQA 2V1XA 3CF2A 4PJLA 3SZGA 2LMZA 1DQ3A 5KL5A 3NWTA 1R49A 1PJTA 2UXXA 2DMUA 1FOKA 3FISA 3IWBA 3RI4A 4DR2E 2OBPA 1KU7A 2RV8A 2ID3A 4QLCU 5GP9A 3JRHA 1R9TJ 5JVTA 1BA5A 3VOEA 1UG2A 3I59A 2CYYA 4BXFA 2VBYA 1HCRA 2LVHA 1ITYA 3B73A 1BI3A 1WJBA 3O8GA 4RM3A 4LMYA 2DQRA 4B4CA 4L5JA 1R58A 3H9JA 3C3WA 1YUJA 3RPUD 4L9VA 5JVGF 4EJTA 1GTKA 2LV2A 1YYOA 1ONVA 3BTIA 4WSGA 2R7WA 2HKXA 1STUA 4M6YA 4A3IJ 1XGMA 2MD0A 1XCVA 2JA5J 2DO7A 1X3WB 3S3OA 2JXPA 3OOUA 4P7DA 2M45A 2F2EA 4MLOA 5CYVA 3Q3SA 3E5XA 3WU1B 1E3HA 3W2WA 2V87A 1KONA 1ENHA 1DI2A 1FBSA 4B43A 2CW0F 4AUXA 2E72A 3ZGKA 1BW5A 2VKEA 2EOYA 2ODRC 1KYZA 4QPQA 4ZDLA 2B9SA 1FEXA 4AIJA 2H8RA 5FFZA 2YTPA 1WHUA 4AC0A 4DR3E 1N36E 3WTYC 1TWGJ 1U0JA 2XPUA 3IKTA 4MLVA 4M3GA 1D0ZA 3R0AA 3ZMDA 4FK5C 1X4PA 2A68F 5B66C 3U21A 1BR1A 3QG5C 2V1DA 4D0PA 2BXZA 3R4KA 5ICEA 1R71A 2UXCE 4XRSA 2OUMA 1YE9A 3PSIA 2JK3A 4PJJA 1P47A 2EWNA 2XB5A 1YG2A 3P9CA 1W5CC 2Y0SA 2H94A 4ESFA 2R92J 2RTXA 1P92A 2HHHE 2NUFA 1LDKB 4YIFA 1VQKI 2RDPA 5GPAA 4EQQA 3OMYA 4KN7X 5ERIA 2DT7B 1T8IA 2KPMA 3D0SA 2IS4A 3P9KA 4BE2A 1SD4A 2XGDA 4PJNA 2XF6A 2LR8A 3ECRA 4LTYA 4YEJA 4WXCA 5ICFA 4XIDA 1PUFB 4YG2F 4N4RB 2ID6A 2NVUB 4KFCA 3CTAA 3MKLA 1ZQ3P 4UV8A 2DA3A 1JKOC 4ZZDA 3EPKA 2DMTA 3FWEA 3FXKA 2RC4A 3CMYA 1FP1D 3HB9A 2VPLA 4DV3E 4A3LJ 1WJPA 2V8QB 3J81C 4A0XA 1P4AA 4A3MJ 3ZQFA 1N78A 1IN7A 4MLQA 2MC4A 2RAEA 1YS7A 2QEXI 1JE8A 1X49A 4XRSG 3ZN1A 3LA2A 1NK2P 4A3GJ 2E5LE 2FTXB 3DEWA 1JHFA 1UILA 3AG3H 4I01A 3HHHA 3RZDJ 1FOXA 1VQ9I 4EGZA 2IGOA 2VASA 2YUSA 2V9PA 3HL2A 4ZYAA 2HS5A 1FOWA 3DLAA 1RC7A 3C7JA 1WPKA 2WC2A 1YX3A 2CG4A 4HF0A
chains in the Genus database with same CATH topology
2VOPA 1O7LA 3WU0A 1HQCA 3AAFA 6PAXA 3LAPA 4FX0A 4M9XA 3KP6A 2MH9A 3RDIA 5ILUA 2MD5A 5HS7A 2VC0A 5K5OA 2HFHA 2IP2A 1ZAOA 2FBHA 1XSVA 2R7FA 5JFRA 1LNWA 1R7JA 3I4PA 5KVRA 2QUFA 2V1UA 4IVNA 3LA7A 4S04A 1OPCA 1IXRC 1SD7A 4BQAA 3HRMA 3ERED 2B0LA 3K9TA 1IRFA 1Z1DA 5F64A 4Q47A 3I54A 2BE5F 2PFBA 3C1DA 4P96A 2NRAC 5E1WA 4EVIA 4M72A 3RYRA 4RAZA 3PFIA 3V4GA 2FSWA 3H92A 5E1ZB 2J5PA 1P6RA 2DW4A 1QZYA 1YS6A 3M7GA 2D45A 1W7PD 4BXUA 1RZ4A 2F5FA 1B4AA 1X3UA 2E7WA 2ZXJA 4MHGA 4KMUX 2ISYA 5L3FA 3BY6A 1J5YA 1AWCA 2FNAA 5DV5A 4ON0A 5HLHA 1K7AA 1W4MA 1MDMB 1XD7A 3TGNA 2EFOA 3W6JB 4UVCA 1D8JA 3PQJA 5BQTA 1C0WA 3ZN0A 3KZZA 5D4SA 1K78A 5A2QZ 2ZKZA 1F1ZA 2K02A 4EGYA 1UHWA 3PQKA 4G94A 1A04A 4B8XA 4EJWA 2LDUA 4KIFA 3QAHA 3ZMUA 3T8RA 5EEHA 2HQRA 2MH2A 3LWFA 3FXQA 4Y17A 4MTEA 4OIRF 4RGRA 1REPC 2P5LC 1WWXA 4Y15A 2K27A 2LF7A 2A3SA 1FNNA 2QZ8A 3QP5A 1KQ0A 1I6XA 2L3DA 3ABTA 1J0RA 4L9JA 4L5IA 1BC8C 1QGPA 1Y0UA 2W85A 3T0YA 3E6CC 5DEQA 3LSTA 4BAYA 4G7HF 1OKRA 1O7FA 2FEZA 4OMZA 2ESNA 1ZG5A 1T0FA 1QBJA 4XBFA 1YIOA 2FRHA 2P8TA 3IKVA 1G3YA 4GO1A 1V4RA 1ZYRF 2HTSA 3H3ZA 3I59B 1I5ZA 1W5TA 4I98B 2DQLA 5DD8A 2DPUA 1S7OA 1F4KA 2AXLA 1ZN2A 5BMZA 1RUNA 3RKWA 3MEXA 2WWYA 1B6AA 1LDJA 2VE9A 2BGCA 3KP5A 4N9HA 1TW3A 3HOTA 1W7PA 2VXZA 2H6CA 3E6BA 1B59A 1HKQA 1LEBA 2VN2A 3IL2A 2TDXA 1T98A 5H20A 3T5XA 1HXDA 4IHTA 3U2RA 2LKPA 2BV6A 3TO6A 3EETA 4M71A 2MLKA 3P9IA 5ICCA 4LB6B 3FXRA 3HHGA 2ZFWA 1RIOH 2DLLA 5CLSA 2DK8A 2ADUA 1S3JA 1WKMA 4YIIA 4UVBA 1K79A 4IRIA 5HOOA 2O03A 1FYMA 4GCVA 3FX3A 2P7CB 3MAJA 5LGNA 3NQOA 2HOEA 1USTA 2Z9OA 4HX7A 1VTNC 2W24A 2A6HF 1TBXA 1U6GA 4LLGF 1XMKA 2YX7A 2PBIA 1LQ1A 2QLZA 3O2PE 4DNCA 3RIRA 3IC7A 1MD0A 2QQBA 3V7RA 3GFJA 4RB3C 5FD5A 1GVJA 5CJ9A 4YFKF 3ZQ7A 3WG9A 3RJPA 1YQAA 4R8HA 2XKOA 1T39A 4EM1A 3V8LA 4OU0A 4ZYHA 4A6DA 4OIPF 2W25A 1NHAA 2DT5A 1XSDA 3LQRA 3ABUA 3WTTC 1SD5A 2L01A 5FB2A 4OINF 4ENNA 1PDNC 2JRTA 1USSA 4HOBA 3D5LA 5DUIA 3GFLA 1XMAA 2CWEA 1I27A 1MGTA 1T38A 2EFNA 1O3RA 2QWWA 2G7HA 3MFKA 3TDZC 1J59A 1EH7A 2QVOA 2COMA 3GVAA 2ZNZA 1F9NA 3DPLC 1QQIA 1DPRA 1T6SA 3HRTA 2A69F 3NRVA 2DU9A 2IJLA 3FMRA 3P7NA 4K2EA 1TQIA 2E1CA 3TQNA 2ACJA 3GO5A 3EYIA 3I0TA 5FLXZ 1LB2A 4EV0A 4RGUA 1YO5C 2F5CA 2ZMEA 2KKOA 1UHMA 2ETHA 2C6YA 4OIOF 1SFXA 1MKMA 1P4WA 5D8KB 5IT9K 2VBXA 2DTRA 1PP8F 2IT0A 3ML6A 3SHFA 2PQ8A 2CFXA 4KUMA 2Q8KA 1DUXC 4KIBA 2STWA 3BJ6A 2Y0MA 1KQ8A 1H9TA 3RKXA 4HQEA 2XGXA 2K7LA 5HLIA 1TW2A 4ZH4F 2L4MA 1EV7A 1ZHFA 4U7DA 1ZLJA 2XASA 2P6SA 1GXQA 3WTUC 5FGMA 1HBXG 3DFGA 3EYYA 1CF7B 5HS9A 3ZPLA 5CVUA 5KK1A 2GZWA 2HWVA 4ENJA 2PI0A 2XVCA 2Y75A 3CUQC 4Y13A 2R7DA 2XKPA 3GLXA 4BHCA 4ZYGA 5D5UB 1J9IA 5BPDA 3HUGA 4IHSA 4OOIA 1FPQA 3WTXC 3HOSA 1WQ2A 1FBQA 3O3KA 3EUHA 1J2XA 1QPMA 3DF8A 2PMHA 1F5TA 2FMLA 3GF2A 2PN6A 2X4HA 5CVIA 5F1RA 3BPVA 2W84A 4KIGA 3TOAA 1U5TB 1YTYA 2QBYA 4L0ZB 1G4DA 1JHHA 2PMUA 2MC3A 1IN6A 5JI6A 3GXOA 1FYKA 2M87A 5HDGA 4IJAA 4MNUA 4M6XA 1ZLKA 2D1VA 3ROUA 1P2FA 2XRNA 4WXHA 3HSEA 3OOPA 3F8NA 2XAGA 1D8KA 4HF1A 1SMTA 3Q5FA 3F8CA 1ZRDA 2IRFG 3QPTA 1WI9A 2XUBA 3GYHX 4WXDA 3F21A 5ILSA 4GGGA 2K4BA 4G9YA 2QYOA 5LHGA 5K1YA 4JBAA 2FBIA 1MJBA 4LK0F 3JAMZ 1UB9A 1YFHA 2J5OA 2MBFA 4Z2YA 2EFWA 2RGVA 3RKYA 3QOPA 3GX4X 5DCFA 5FD6A 5BOXA 1ODDA 4EJVA 1MJ9A 3L09A 2KRFA 1FSEA 1IF1A 3GFMA 1SMYF 4IRHA 3TO7A 3DXJF 4M9SA 4DQ2A 4UHTA 3HYIA 2PG4A 2JTVA 5AIPA 2HEOA 1P4XA 2EFQA 1PUEE 4ENMA 3QU3A 2EV6A 3O6BB 2Q2EA 3L2CA 4HW0A 3H3UA 1ZREA 2GWRA 1YW7A 2E1NA 3DPTA 4NB5A 1ZG1A 4KDPA 3K1PA 2M8EA 2F5EA 4UUVA 1R00A 1B1BA 5LRSA 2BEOA 3GZ5A 5DYMA 2O61A 4ZYDA 1U8RA 2ZCWA 4M73A 1T2KA 3GEZA 1FSHA 3C18A 2DPDA 3F8MA 1RNLA 4RB1A 1OR7A 4KICA 1BOAA 3VEPA 1IN4A 1FWZA 5J6XA 4LB5A 4AVPA 3V8KA 5E1XA 2RN7A 2Z3YA 4TV7A 2PJPA 1HKSA 4UNOA 2ELHA 3QPHA 3MZYA 3W6KB 1XN7A 4HDVA 5BS6A 5CVRA 3GFIA 1G3WA 2Z99A 2GXGA 4R79A 1EH6A 1OMIA 1L3LA 1HKTA 2V79A 2IA0A 2VT2A 2DFIA 3WTZA 5L3DA 2NYXA 2HZTA 2STTA 4GXOA 2EA2A 2UZKA 1XB4A 5LRRA 3HSFA 4G7OF 1S29A 2L54A 4A5MA 3QU6A 3E97A 4M74A 1BM9A 3ECOA 3KEOA 3S2WA 5FLXK 2YSRA 2XAQA 3I58A 4RB0A 3T1BA 4P5OA 2F5DA 4RAYA 4F7ZA 4CZZA 4U7BA 3IWZA 1R5GA 4KMFA 3V7CA 5IT9Z 2BYVE 1DPUA 2O0YA 3MZHA 5LGUA 1QZZA 2EJRA 3I64A 3VB2A 5D4RA 2H27A 4KT5C 1U5TC 1FYLA 1KU3A 3GUDA 3L7WA 4BH9A 4Q4ZF 3ZMSA 3BROA 2OU2A 2VE8A 4UXNA 4YFXF 2ZNYA 3U1DA 1GHCA 4BHPA 3JTGA 2YU3A 2R3SA 2OZ6A 2D2WA 2FXAA 2H6BA 5FFXA 4ETSA 2NNYA 4IXAA 4R1HA 2DK5A 3N97A 1AOYA 4L18B 2EV0A 1SFEA 5E20A 1IW7F 1TQPA 4GYGA 1SD6A 3F23A 2QENA 4FHTA 1IXCA 2EB7A 2FOKA 1SAXA 4A5NA 4N0BA 1ON1A 5JHUA 3COAC 3ISPA 2IW5A 3DP7A 4I02A 2ESHA 3KZYA 3I53A 4L0YB 4A0ZA 1XGSA 3ZMVA 3F6OA 2CGPA 4PZJA 2OD5A 1CGPA 4MQVA 1JGSA 2O3FA 5D8LB 5HLGA 2RVCA 3SQNA 1XDUA 5H6QA 3V8JA 2P5VA 1W7PB 2FBKA 3B02A 3M9AA 3BJOA 2NAZA 1U2WA 1Z9CA 3CO6C 3KP3A 2YR2A 3CUOA 4NHJA 3M8EA 4I2OA 1V3FA 4A12A 2G9WA 1TTYA 4PGGA 2FF4A 5ICGA 4A0YA 1LEAA 4ESJA 2P6TA 2LNBA 2AS5F 1S7AA 1TLHB 1R1VA 1BN5A 2XAFA 5JR3A 2VODA 1G3SA 1QNTA 2QBYB 4HQMA 2GAUA 4O5VA 1ZRFA 2DI3A 3F8BA 3MCZA 3KE2A 2VBZA 1O3QA 4I0AA 1BI0A 3J80Z 4LJZF 1DP7P 3BZ6A 1GXPA 3FM5A 4EJUA 4U0WA 2VONA 2BBYA 4KYWA 4LD5A 3I71A 3K0LA 3BP8A 2GA1A 4PDKA 2L02A 4S05A 5LEKA 5HVQC 1KU2A 1TNSA 2YX4A 3BPXA 5LLQA 3RYPA 4LG0B 3RTRA 3QRFF 2Q0OA 4WWCA 5CVJA 2ZO4A 3DV8A 4LLNA 3ECHA 5D5VB 2JPBA 2HTJA 1ZGJA 4I0BA 5D5XB 1OYIA 1UCRA 2GXBA 2Y48A 2UWMA 3HIFA 2W57A 3WGHA 4KA4A 1YYVA 3E3VA 4JK1X 5DCMB 3R0JA 3JSOA 1ON2A 3EDPA 5L3CA 2HYGD 1KGSA 1IRGA 3DQVC 3REOA 1G3TA 4I7HA 4IPAA 4LK1F 4XSZF 2ISZA 2HKOA 4KN4X 3CUQB 4L9TA 4M9ZA 1XCBA 1HSTA 4MEYF 5HDKA 1R36A 3M8FA 3HRSA 3Q9VA 2Z33A 3J81Z 2QM3A 1ZARA 3CJNA 4HX8A 5CVVA 4U0YA 5LHHA 1DDNA 4G8XA 4UVAA 1BJAA 5L3GA 3HTUA 5LEJA 2OAZA 3WTWC 4HYEA 1EH8A 3WGIA 3JTHA 1ZGAA 4ENKA 1J75A 3KP7A 2FQ3A 2A6EF 1FBUA 3M1EA 1PP7U 4IF4A 2O8XA 1D5VA 3SXYA 5L3EA 3CDHA 4N9IA 4LFUA 1HW2A 2O6GE 1K6OA 1RUOA 3EQLF 4G6DA 4MQ9F 1FC3A 1OYWA 1FT9A 2RQPA 5J8CA 2P5KA 1HSJA 2FA5A 3ELKA 2XAHA 3WE2A 1QO0D 5LBQA 4XLNF 1K78B 1FZPB 5A2QK 3SZTA 5ED4A 4HAMA 4G6QA 2DBBA 1Z7UA 5AONA 1XGOA 4EM2A 3VODA 4WF2A 2OZUA 1E2XA 4RB2C 3N4MA 3NEUA 3TOBA 4LG0A 3TKYA 4EM0B 2CQKA 2XHKA 1D3YA 3HRUA 1HW5A 2V6CA 4CO8A 4HZFA 4EMSA 3KP2A 1IXSB 1H0MA 1IN8A 2KJCA 1YW8A 4ESBA 2VT3A 3J81K 4ZZLA 2HR3A 3HSRA 3WGGA 4BYYA 3MWMA 5DCMA 1TNTA 3QP6A 4Q5SF 3U9GA 1IN5A 3E5UA 1W5SA 5TRDA 3K1NA 5TJJA 1MZBA 5HDNA 3GW2A 1R5HA 3SZPA 4CGZA 2MA3A 2OQRA 2RKHA 4P9FA 4OMYA 2RNJA 5AIQA 2ZBKA 1B9MA 4CXFA 1BIAA 4H0EA 2OA4A 3TO9A 3G3ZA 4U0VA 3L00A 5E8GA 3LAJA 1UFMA 1S6LA 1XDSA 3JW4A 2CSOA 3GWZA 2HDCA 4PGHA 2JT1A 3E6MA 1TQMA 1SFUA 4XSXF 1J7KA 2HGCA 5LGTA 4WCGA 3KEQA 3CO7C 3K69A 1FY7A 3RPQA 3SFZA 5K5QA 3JSPA 2KIUA 5L3BA 4XLPF 3DKWA 2EFPA 5BPIA 2VOOA 2IVMA 1O3TA 1BI1A 2DAOA 3IHUA 2OQGA 1STZA 1U78A 3FXUA 1LVAA 2IA2A 4I09A 4P55A 2A5YB 4ZYEA 5E18F 2D1HA 1LJ9A 4HA8A 3WODF 3I5UA 5HS8A 2LF8A 4P9UA 2NNNA 4HV6A 3V7SA 1I1GA 3CLOA 4AWXB 4AD9A 5DUKA 1S8NA 1BI2A 1Z05A 2VBWA 1KU9A 2HYFA 3R60A 4A6EA 2ZMEB 4RS8A 2KIFA 2M5WA 5D6FA 3KETA 1ZH5A 5E8IA 1Z91A 1KYWA 4Q48A 4G7ZF 4RGSA 2L4AA 3IRRA 1ZRCA 3Q9SA 2X0LA 1ULYA 3BOQA 1FX7A 4HLXA 3F8FA 5LHIA 3BDDA 4AIHA 1Z6RA 5H6RA 1Q1HA 4CDGA 1U5TA 4HF2A 4RGXA 3FZVA 2YPRA 3JAMK 3L9FA 4PCQA 3MQ0A 2FMYA 3LQQA 2FU4A 3KP4A 2A61A 1HW1A 3FF5A 1I1SA 1R1UA 3CUQA 2UXNA 3ZP5A 2XROA 2M1BA 2XIGA 5K5RA 4AIKA 2A07F 4E70A 4FX4A 2KIMA 5FO5A 5IT3A 2WV0A 2EK5A 4KNYA 1O57A 5D6EA 4XRFA 4MTDA 2WTEA 3IRQA 2H09A 3E6DA 3KLNA 3T8TA 4YFNF 2PEXA 4LGWA 3K2ZA 3WE3A 4CICA 5DDGA 3F3XA 1XGNA 2EV5A 2P4WA 4O3MA 2E7XA 1RI7A 3DEUA 4WX9A 2HQNA 3LFKA 2P7VB 4BHBA 3J80K 2LSOA 4B09A 1B9NA 1R1TA 3FMSA 4EJOA 4HLYA 4NQWA 3GZ6A 3R61A 4HV5A 4QWQA 1LDDA 2GIVA 5EEGA 2QQ9A 4OIQF 4HX4A 3BWGA 1YW9A 2FNPA 4IRGA 3VFZA 1KA8A 1Z6TA 3K1MA 1YLFA 1BIBA 3IWFA 2QQAA 1E17A 4CYDA 3WTVC 1FLIA 4BNCA 2XAJA 2V9VA 4ASNA 2NS0A 2CO5A 3FMQA 4CHUA 3OV8A 1WRJA 3KFWX 1MDMA 2PLYA 3FM3A 2KJBA 1O3SA 2VC1A 4LLLA 1H9GA 1R22A 3LA3A 1KQ9A 3J7AO 1R23A 2IA1A 3ZMZA 3HTSB 3ULQB 4GYIA 4FT8A 4HBLA 1MJAA 2M30A 5J8FA 3F72A 2MLGA 4O6JA 1G6NA 2ZJ2A 5D5WB 4UV9A 3R6SA 1OYYA 1CF7A 1JXSA 3FHZA 4HDUA 1IUYA 3KLOA 3F6VA 3F22A 1U3EM 1XSXA 3WTSC 2G7UA 1L0OC 4WK8F 2K4JA 3TDUC 5E17F 2FE3A 4JQFA 2IPQX 2Z5UA 3ZMTA 2K86A 4A2UA 4MEXF 1BC7C 3RPUA 4L9NA 5ILVA 5F6FA 1IZ1A 2XV4S 2JZYA 4U88A 2GA2A 3BJAA 2EA4A 2JPCA 3KCCA 1FP2A 2JSCA 5DD4A 4MGRA 3E5QA 1WSUA 1ZG3A 3G73A 1BBYA 2GQQA 2V1XA 2UXXA 1FOKA 3RI4A 2OBPA 1KU7A 2RV8A 4QLCU 5JVTA 3VOEA 3I59A 2CYYA 2VBYA 3B73A 1BI3A 4LMYA 2DQRA 4L5JA 1R58A 3C3WA 4L9VA 4EJTA 1ONVA 2HKXA 4M6YA 1XGMA 1XCVA 2DO7A 2M45A 2F2EA 5CYVA 3E5XA 3WU1B 1FBSA 2CW0F 1KYZA 4AIJA 5FFZA 3WTYC 3IKTA 3ZMDA 3R0AA