2LUPB

Rdc refined solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with the terminal rna hairpin of snr47 precursor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a yeast RNase III dsRBD complex with a noncanonical RNA substrate provides new insights into binding specificity of dsRBDs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
molecule keywords RNA (32-MER)
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lupB00
3C4BA 1T4OA 1UHZA 1UILA 2L3JA 1YYKA 3ADLA 2LTRA 2F4VE 4DV4E 2DIXA 2ZM6E 2JY9A 2L33A 1RC7A 1J5EE 4OOGC 2CPNA 4YHHE 1WHNA 1QU6A 4OX9E 4DV5E 2MDRA 2UXDE 2UUCE 2LJHA 4B3TE 1YYWA 1IBLE 4JI6E 1DI2A 1FJGE 1STUA 1YZ9A 1X47A 1T4NA 2JVAA 2NUEA 2UXBE 2NA2A 4DV6E 2UUBE 1XNQE 1PKPA 4DV1E 2VQEE 1HR0E 1EKZA 4B3RE 3T1HE 2L3CA 4NXME 4JI8E 5IWAE 4JI3E 4LF8E 2L2MA 4M30A 1O0WA 3ADJA 4X62E 2LUPB 2RS6A 4DV2E 2LUQA 3VYXA 4M2ZA 1T4LB 1XNRE 2YT4A 4X8WA 1IBME 2L2NA 4B3SE 2LTSA 1I94E 4DR2E 4DKKA 2RS7A 1J26A 4WFTA 4X65E 3ADIA 4LF4E 2NUGA 3C4TA 1GQEA 4LFCE 4DV3E 4JV5E 4DR7E 4LF7E 1FKAE 4LFBE 4X66E 2EZ6A 4DUZE 3J7Yp 4DR4E 2LBSB 2B3TB 2E5LE 2RSMA 4JYAE 2KHXA 1YYOA 2UUAE 1XMOE 4DR6E 2IHR1 2LRSA 1N33E 4KHPE 4DR3E 4X64E 4JI1E 2N3HA 4JI5E 2DB2A 4DR1E 4AQYE 2B7VA 4GKJE 4NXNE 1RQ0A 1N32E 4WYQB 1N34E 3T1YE 1ZBTA 3VYYA 2HHHE 5LMNE 2UXCE 4LF9E 4JI2E 1HNZE 2RTXA 3P1XA 5LMUE 4GKKE 2N3GA 3HTXA 3ADGA 4JI7E 2NUFA 3OTOE 1WHQA 4K0KE 4B3ME 4DV7E 4YY3E 4LF6E 2VQFE 1HNXE 1X49A 2UU9E 1N36E 4DV0E 3LLHA 4LF5E 5CFFE 4JI0E 5BR8E 4DUYE 2L2KB 1IBKE 4JI4E 1X48A 2B7TA 1HNWE 4LFAE 4DR5E 2DMYA 1XMQE
chains in the Genus database with same CATH superfamily
1T38A 2JPAA 2L3JA 2EQ1A 3IWCA 3JTZA 2RSIA 4BCAA 3ADLA 3JAMC 4DV4E 2R1FA 2DIXA 5AC5A 5IXMB 4ZYEA 4OOGC 4R2CA 3J81C 1WHNA 4N4RB 1WXRA 2UUCE 2L6MA 2V85A 2LJHA 1QNTA 2DSYA 4X9JA 3K6QA 2DMIA 1T4NA 5T6JA 2HGHA 2UUBE 1XNQE 1PKPA 4R2RA 1B69A 2EL5A 1EKZA 1A1JA 4NXME 2JWOA 2EPNA 3ADJA 4X62E 1EH8A 4RH8A 2ELYA 3M99B 5ADZA 1XNRE 2YT4A 1IBME 3EPHA 2LE2A 4DKKA 4L5NC 2RS7A 3HXLA 5A6AA 2YSOA 2NUGA 2MC5A 2EOEA 5KL4A 4DV3E 4F6MA 4DR7E 2H36X 4LF7E 2LVHA 5F3WA 4HEIA 3THOB 1MEYC 4KWYA 2LBSB 5FLXC 2A25A 2V88A 2KHXA 2L8TA 2KONA 1XMOE 1YUIA 4DR6E 1IMUA 2LRSA 4JI1E 2EOQA 3MHHC 2DB2A 2EN6A 3DF6A 2PRTA 4GKJE 2EP3A 4WPYA 1ZBTA 2YTEA 2JYAA 3EPJA 2EPMX 3L00A 1TN9A 2EN2A 2EM7A 2MKDA 1WRJA 1PJSA 2EPCA 2N3GA 2MDGA 4NHRA 1JK2A 3AV0A 3MHSC 5A6BA 2EPOA 3OTOE 1WHQA 2EL4A 4DV7E 1IQOA 1ZBQA 1A1GA 4Q35B 3THNA 1N36E 2MC6A 3F6HA 3FIGA 2JOBA 1JK1A 3JU0A 2L2KB 4JI4E 1X48A 2EPRA 1HNWE 4DR5E 3BF2A 1T4OA 2EN8A 2LTRA 2F4VE 3H09A 5IT9C 2V89A 2L33A 2BB8A 1RC7A 4O5GA 2EMBA 2CPNA 5KL5A 2ENHA 1QU6A 4DV5E 2EN7A 2MDRA 2UXDE 1N3GA 1SR9A 4B3TE 1YYWA 1IBLE 2DLKA 2EMZA 3C6MA 2UXBE 2ENCA 4DV1E 1PJQA 4MLVA 4R8OA 4JI8E 1X5WA 2LO3A 1BB8A 2EOXA 2FV4B 2RS6A 2JOXA 2K4VA 2EQ3A 3VYXA 1T4LB 1GZ6A 2FTXB 4FK5C 3DJWA 4F9BB 4X8WA 4WXDA 2LTSA 4TUIA 2CTDA 2EOJA 3EPKA 2JP9A 1J26A 4X65E 1KYQA 1X6HA 4JV5E 1ZR9A 1G2DC 1FKAE 2RPCA 4DUZE 3J7Yp 1RMDA 4L8NA 2YTJA 4DR4E 4R03A 4ZYHA 2D9HA 2EOHA 4R2EA 1YYOA 2UUAE 4JYAE 1N33E 4X64E 1A1IA 4R2AA 2WCC3 4BMJA 1UBDC 2EMWA 4JI5E 2EM9A 4DR1E 1RQ0A 2VRDA 2GLIA 4LTYA 3TQMA 3VYYA 1X6FA 2YTDA 2V83A 2EM6A 4JI2E 4GZNC 3F6GA 3C6KA 4P7DA 5A6KA 4O4KA 4JI7E 1AH5A 2NUFA 2BBGA 4B3ME 2KOUA 1HNXE 2ODRC 3VHTB 3LLHA 2ELZA 3HQ1A 5CFFE 1A1LA 1IBKE 1BBGA 2EPPA 2LJUA 2B7TA 1EH6A 2HC5A 2RQLA 2DMYA 3C4BA 5AASA 1UN6B 1TF3A 2JY9A 2ODRD 4F54A 2M4IA 2FGGA 2G7HA 4DMIA 4MLQA 1GTKA 2EN1A 3BGHA 1DI2A 2EPZA 2DLQA 1PDAA 3IWBA 1X47A 4WSGA 1YZ9A 2JVAA 2YTFA 4R2DA 2NA2A 1Z1BA 4BHCA 4O43A 4IS1C 3UK3C 1HR0E 1NCSA 1IQSA 3T1HE 2L3CA 2EM8A 4GEQB 2L2MA 1O0WA 3KZYA 2GPIA 2M9AA 2EM0A 1EH7A 2EOSA 2I9IA 2LUQA 4DV2E 4M2ZA 2EOFA 4ZYDA 2B9DA 2EOZA 3J80C 2YTIA 4IJDA 2YTNA 1AAYA 2YRMA 2WBSA 2EOMA 3LMLA 4KZSA 2EMFA 3HPZA 4LF4E 2GHFA 2K7IA 1PJTA 2EOYA 5AC4A 4F9CB 1G2FC 4X66E 2EZ6A 2VE7C 2WBTA 2B3TB 2Q8UA 2ADRA 2RSMA 5LLQA 2EMGA 3BBGA 2EPLX 2IHR1 4DR3E 1TF6A 2N3HA 4M0VA 4AQYE 4ZYGA 2B7VA 2EMAA 3EPLA 4WSPA 5A69A 2EORA 1ZU1A 2EMKA 1YPNA 2HHHE 1BBOA 2UXCE 2MKNA 4LF9E 2ENAA 2DRPA 2I13A 2JR1A 2V8QB 1HNZE 1A1HA 2RTXA 2EM4A 2YTQA 2EMXA 2LMZA 2LV2A 2EMCA 4R2QA 1YFHA 4K0KE 2EPUA 2NABA 1X49A 1A1KA 1A1FA 2UU9E 4DV0E 4R2SA 4LF5E 2EPAA 2J7JA 5BR8E 4F2JC 1ZAAC 1NEIA 3VK6A 4LFAE 3HPSA 3ECRA 2YU5A 2JXPA 4RHBB 1UHZA 2CT1A 1YSAC 1DQ3A 1UILA 1YYKA 4R2PA 2EN3A 2ZM6E 2EM2A 2N8XA 5A2QC 1J5EE 2YSPA 4YHHE 4OX9E 2F8BA 4Q28A 2LT7A 3ZOQB 2EPXA 4JI6E 4NZVA 1FJGE 1STUA 2EL6A 2EOOA 5A6BD 3J7AG 1KJKA 2EM3A 2NUEA 4P78A 2V86A 3RMPA 3MSWA 4DV6E 4WXCA 5DNYA 2VQEE 4B3RE 5IWAE 2EMLA 1T39A 4JI3E 4M30A 4LF8E 2LUPB 1P47A 4F9AB 4BC7A 5KL2A 2EWLA 2WZOA 2L2NA 4B3SE 2E1MA 2R76A 1I94E 4DR2E 2LCEA 5KL3A 4WFTA 2YPNA 3ADIA 2V87A 5KL6A 3C4TA 1GQEA 2EJ4A 4J8ZA 4LFCE 1SFEA 2WBUA 2EMIA 4LFBE 1DGCA 2M7QA 2YTGA 1F2IG 5A6JA 2YRHA 4BS9A 2E5LE 1X6EA 2YU8A 3IWDA 4I8OA 1LLMC 2EMYA 4KHPE 5TSEA 2EE8A 4HTGA 4NXNE 1N32E 2EMHA 2E72A 3BIDA 4WYQB 3T1YE 1N34E 4LU9A 4BC9A 4WX9A 2EPKX 5LMNE 3EQ1A 3KZZA 1MGTA 2EN4A 5IV8B 2M1SA 3P1XA 4O24A 4BHBA 5LMUE 4GKKE 4BBYA 1L4SA 3HTXA 2EQ0A 3ADGA 5KL7A 2YZTA 4YY3E 4LF6E 2EM5A 5LL6R 2VF1A 3AUZA 2VQFE 2DGCA 2CSHA 2YRKA 5AE2A 1YUJA 2YWQA 2HJJA 2YTOA 4JI0E 4M9VC 4F6NA 4TUGA 2YTPA 4DUYE 2L92A 3OMLA 1X3CA 5AE3A 3KWRA 5AE1A 2EOIA 1XMQE 1WJPA 3QG5C
chains in the Genus database with same CATH topology
3C4BA 1T4OA 1UHZA 5AASA 1DQ3A 1UILA 2L3JA 1YYKA 3IWCA 4BCAA 3JTZA 2LTRA 3ADLA 3H09A 2F4VE 3JAMC 4DV4E 5IT9C 2DIXA 2ZM6E 5A2QC 2JY9A 2V89A 2ODRD 2L33A 4F54A 2M4IA 1RC7A 1J5EE 2FGGA 4OOGC 2CPNA 4YHHE 3J81C 1WHNA 1QU6A 2F8BA 2G7HA 4Q28A 4DMIA 2MDRA 1WXRA 4DV5E 2UUCE 2UXDE 2L6MA 2V85A 1SR9A 2LJHA 3ZOQB 4B3TE 1YYWA 2DSYA 1IBLE 4JI6E 1DI2A 1FJGE 1STUA 3K6QA 1YZ9A 3IWBA 1X47A 1T4NA 3J7AG 2JVAA 2NUEA 5T6JA 4P78A 2V86A 2NA2A 3RMPA 2UXBE 3MSWA 4DV6E 2UUBE 4OX9E 1XNQE 1PKPA 5DNYA 2VQEE 4DV1E 1HR0E 1EKZA 4R8OA 4B3RE 3T1HE 2L3CA 4NXME 4GEQB 4JI8E 2JWOA 5IWAE 4JI3E 2L2MA 4M30A 1O0WA 4LF8E 3ADJA 4X62E 2FV4B 2LUPB 2RS6A 2JOXA 4F9AB 4DV2E 2K4VA 2LUQA 4BC7A 3VYXA 4M2ZA 1T4LB 3J80C 1GZ6A 2B9DA 2EWLA 2FTXB 2WZOA 5ADZA 3DJWA 1XNRE 4F9BB 2YT4A 4X8WA 1IBME 2L2NA 4B3SE 2E1MA 2LTSA 1I94E 2LE2A 3LMLA 4KZSA 4DKKA 4DR2E 4L5NC 4TUIA 2RS7A 3HXLA 1J26A 4WFTA 4X65E 3HPZA 3ADIA 4LF4E 2V87A 2NUGA 2MC5A 3C4TA 1GQEA 4J8ZA 4LFCE 4DV3E 4JV5E 4DR7E 2H36X 1FKAE 4LF7E 4LFBE 4X66E 2EZ6A 2M7QA 4DUZE 5F3WA 3J7Yp 2VE7C 4L8NA 4DR4E 2LBSB 5FLXC 2V88A 4R03A 2B3TB 4BS9A 2E5LE 2RSMA 4JYAE 2KHXA 2L8TA 1YYOA 2KONA 1XMOE 2UUAE 4DR6E 2IHR1 3IWDA 4I8OA 2LRSA 1N33E 4KHPE 4DR3E 4X64E 4JI1E 2N3HA 4BMJA 4M0VA 4JI5E 2DB2A 3DF6A 4DR1E 4AQYE 2B7VA 4GKJE 4NXNE 1RQ0A 1N32E 4LTYA 4WSPA 4WYQB 1N34E 3T1YE 4WPYA 1ZBTA 3VYYA 4LU9A 4BC9A 2HHHE 5LMNE 2V83A 2UXCE 4LF9E 4JI2E 2JR1A 2V8QB 3F6GA 1HNZE 2M1SA 2RTXA 3P1XA 4P7DA 5LMUE 4GKKE 4BBYA 2N3GA 3HTXA 2LMZA 3ADGA 4JI7E 3AV0A 2YZTA 2NUFA 3OTOE 1WHQA 4K0KE 4B3ME 4DV7E 4YY3E 4LF6E 1ZBQA 2KOUA 2VF1A 3AUZA 5LL6R 2VQFE 1HNXE 1X49A 2UU9E 2ODRC 1N36E 4DV0E 3LLHA 4LF5E 2MC6A 5CFFE 3HQ1A 3F6HA 3FIGA 5AE2A 4JI0E 2JOBA 3JU0A 5BR8E 4TUGA 4DUYE 2L2KB 1IBKE 4JI4E 1X48A 2L92A 3OMLA 3VK6A 5AE3A 2B7TA 1HNWE 3KWRA 4LFAE 5AE1A 3HPSA 4DR5E 2DMYA 1XMQE 4F9CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4B A;  1T4O A;  1UHZ A;  1UIL A;  2L3J A;  1YYK A;  3ADL A;  2LTR A;  2F4V E;  4DV4 E;  2DIX A;  2ZM6 E;  2JY9 A;  2L33 A;  1RC7 A;  1J5E E;  4OOG C;  2CPN A;  4YHH E;  1WHN A;  1QU6 A;  4OX9 E;  4DV5 E;  2MDR A;  2UXD E;  2UUC E;  2LJH A;  4B3T E;  1YYW A;  1IBL E;  4JI6 E;  1DI2 A;  1FJG E;  1STU A;  1YZ9 A;  1X47 A;  1T4N A;  2JVA A;  2NUE A;  2UXB E;  2NA2 A;  4DV6 E;  2UUB E;  1XNQ E;  1PKP A;  4DV1 E;  2VQE E;  1HR0 E;  1EKZ A;  4B3R E;  3T1H E;  2L3C A;  4NXM E;  4JI8 E;  5IWA E;  4JI3 E;  4LF8 E;  2L2M A;  4M30 A;  1O0W A;  3ADJ A;  4X62 E;  2LUP B;  2RS6 A;  4DV2 E;  2LUQ A;  3VYX A;  4M2Z A;  1T4L B;  1XNR E;  2YT4 A;  4X8W A;  1IBM E;  2L2N A;  4B3S E;  2LTS A;  1I94 E;  4DR2 E;  4DKK A;  2RS7 A;  1J26 A;  4WFT A;  4X65 E;  3ADI A;  4LF4 E;  2NUG A;  3C4T A;  1GQE A;  4LFC E;  4DV3 E;  4JV5 E;  4DR7 E;  4LF7 E;  1FKA E;  4LFB E;  4X66 E;  2EZ6 A;  4DUZ E;  3J7Y p;  4DR4 E;  2LBS B;  2B3T B;  2E5L E;  2RSM A;  4JYA E;  2KHX A;  1YYO A;  2UUA E;  1XMO E;  4DR6 E;  2IHR 1;  2LRS A;  1N33 E;  4KHP E;  4DR3 E;  4X64 E;  4JI1 E;  2N3H A;  4JI5 E;  2DB2 A;  4DR1 E;  4AQY E;  2B7V A;  4GKJ E;  4NXN E;  1RQ0 A;  1N32 E;  4WYQ B;  1N34 E;  3T1Y E;  1ZBT A;  3VYY A;  2HHH E;  5LMN E;  2UXC E;  4LF9 E;  4JI2 E;  1HNZ E;  2RTX A;  3P1X A;  5LMU E;  4GKK E;  2N3G A;  3HTX A;  3ADG A;  4JI7 E;  2NUF A;  3OTO E;  1WHQ A;  4K0K E;  4B3M E;  4DV7 E;  4YY3 E;  4LF6 E;  2VQF E;  1HNX E;  1X49 A;  2UU9 E;  1N36 E;  4DV0 E;  3LLH A;  4LF5 E;  5CFF E;  4JI0 E;  5BR8 E;  4DUY E;  2L2K B;  1IBK E;  4JI4 E;  1X48 A;  2B7T A;  1HNW E;  4LFA E;  4DR5 E;  2DMY A;  1XMQ E; 
#chains in the Genus database with same CATH topology
 1T38 A;  2JPA A;  2L3J A;  2EQ1 A;  3IWC A;  3JTZ A;  2RSI A;  4BCA A;  3ADL A;  3JAM C;  4DV4 E;  2R1F A;  2DIX A;  5AC5 A;  5IXM B;  4ZYE A;  4OOG C;  4R2C A;  3J81 C;  1WHN A;  4N4R B;  1WXR A;  2UUC E;  2L6M A;  2V85 A;  2LJH A;  1QNT A;  2DSY A;  4X9J A;  3K6Q A;  2DMI A;  1T4N A;  5T6J A;  2HGH A;  2UUB E;  1XNQ E;  1PKP A;  4R2R A;  1B69 A;  2EL5 A;  1EKZ A;  1A1J A;  4NXM E;  2JWO A;  2EPN A;  3ADJ A;  4X62 E;  1EH8 A;  4RH8 A;  2ELY A;  3M99 B;  5ADZ A;  1XNR E;  2YT4 A;  1IBM E;  3EPH A;  2LE2 A;  4DKK A;  4L5N C;  2RS7 A;  3HXL A;  5A6A A;  2YSO A;  2NUG A;  2MC5 A;  2EOE A;  5KL4 A;  4DV3 E;  4F6M A;  4DR7 E;  2H36 X;  4LF7 E;  2LVH A;  5F3W A;  4HEI A;  3THO B;  1MEY C;  4KWY A;  2LBS B;  5FLX C;  2A25 A;  2V88 A;  2KHX A;  2L8T A;  2KON A;  1XMO E;  1YUI A;  4DR6 E;  1IMU A;  2LRS A;  4JI1 E;  2EOQ A;  3MHH C;  2DB2 A;  2EN6 A;  3DF6 A;  2PRT A;  4GKJ E;  2EP3 A;  4WPY A;  1ZBT A;  2YTE A;  2JYA A;  3EPJ A;  2EPM X;  3L00 A;  1TN9 A;  2EN2 A;  2EM7 A;  2MKD A;  1WRJ A;  1PJS A;  2EPC A;  2N3G A;  2MDG A;  4NHR A;  1JK2 A;  3AV0 A;  3MHS C;  5A6B A;  2EPO A;  3OTO E;  1WHQ A;  2EL4 A;  4DV7 E;  1IQO A;  1ZBQ A;  1A1G A;  4Q35 B;  3THN A;  1N36 E;  2MC6 A;  3F6H A;  3FIG A;  2JOB A;  1JK1 A;  3JU0 A;  2L2K B;  4JI4 E;  1X48 A;  2EPR A;  1HNW E;  4DR5 E;  3BF2 A;  1T4O A;  2EN8 A;  2LTR A;  2F4V E;  3H09 A;  5IT9 C;  2V89 A;  2L33 A;  2BB8 A;  1RC7 A;  4O5G A;  2EMB A;  2CPN A;  5KL5 A;  2ENH A;  1QU6 A;  4DV5 E;  2EN7 A;  2MDR A;  2UXD E;  1N3G A;  1SR9 A;  4B3T E;  1YYW A;  1IBL E;  2DLK A;  2EMZ A;  3C6M A;  2UXB E;  2ENC A;  4DV1 E;  1PJQ A;  4MLV A;  4R8O A;  4JI8 E;  1X5W A;  2LO3 A;  1BB8 A;  2EOX A;  2FV4 B;  2RS6 A;  2JOX A;  2K4V A;  2EQ3 A;  3VYX A;  1T4L B;  1GZ6 A;  2FTX B;  4FK5 C;  3DJW A;  4F9B B;  4X8W A;  4WXD A;  2LTS A;  4TUI A;  2CTD A;  2EOJ A;  3EPK A;  2JP9 A;  1J26 A;  4X65 E;  1KYQ A;  1X6H A;  4JV5 E;  1ZR9 A;  1G2D C;  1FKA E;  2RPC A;  4DUZ E;  3J7Y p;  1RMD A;  4L8N A;  2YTJ A;  4DR4 E;  4R03 A;  4ZYH A;  2D9H A;  2EOH A;  4R2E A;  1YYO A;  2UUA E;  4JYA E;  1N33 E;  4X64 E;  1A1I A;  4R2A A;  2WCC 3;  4BMJ A;  1UBD C;  2EMW A;  4JI5 E;  2EM9 A;  4DR1 E;  1RQ0 A;  2VRD A;  2GLI A;  4LTY A;  3TQM A;  3VYY A;  1X6F A;  2YTD A;  2V83 A;  2EM6 A;  4JI2 E;  4GZN C;  3F6G A;  3C6K A;  4P7D A;  5A6K A;  4O4K A;  4JI7 E;  1AH5 A;  2NUF A;  2BBG A;  4B3M E;  2KOU A;  1HNX E;  2ODR C;  3VHT B;  3LLH A;  2ELZ A;  3HQ1 A;  5CFF E;  1A1L A;  1IBK E;  1BBG A;  2EPP A;  2LJU A;  2B7T A;  1EH6 A;  2HC5 A;  2RQL A;  2DMY A;  3C4B A;  5AAS A;  1UN6 B;  1TF3 A;  2JY9 A;  2ODR D;  4F54 A;  2M4I A;  2FGG A;  2G7H A;  4DMI A;  4MLQ A;  1GTK A;  2EN1 A;  3BGH A;  1DI2 A;  2EPZ A;  2DLQ A;  1PDA A;  3IWB A;  1X47 A;  4WSG A;  1YZ9 A;  2JVA A;  2YTF A;  4R2D A;  2NA2 A;  1Z1B A;  4BHC A;  4O43 A;  4IS1 C;  3UK3 C;  1HR0 E;  1NCS A;  1IQS A;  3T1H E;  2L3C A;  2EM8 A;  4GEQ B;  2L2M A;  1O0W A;  3KZY A;  2GPI A;  2M9A A;  2EM0 A;  1EH7 A;  2EOS A;  2I9I A;  2LUQ A;  4DV2 E;  4M2Z A;  2EOF A;  4ZYD A;  2B9D A;  2EOZ A;  3J80 C;  2YTI A;  4IJD A;  2YTN A;  1AAY A;  2YRM A;  2WBS A;  2EOM A;  3LML A;  4KZS A;  2EMF A;  3HPZ A;  4LF4 E;  2GHF A;  2K7I A;  1PJT A;  2EOY A;  5AC4 A;  4F9C B;  1G2F C;  4X66 E;  2EZ6 A;  2VE7 C;  2WBT A;  2B3T B;  2Q8U A;  2ADR A;  2RSM A;  5LLQ A;  2EMG A;  3BBG A;  2EPL X;  2IHR 1;  4DR3 E;  1TF6 A;  2N3H A;  4M0V A;  4AQY E;  4ZYG A;  2B7V A;  2EMA A;  3EPL A;  4WSP A;  5A69 A;  2EOR A;  1ZU1 A;  2EMK A;  1YPN A;  2HHH E;  1BBO A;  2UXC E;  2MKN A;  4LF9 E;  2ENA A;  2DRP A;  2I13 A;  2JR1 A;  2V8Q B;  1HNZ E;  1A1H A;  2RTX A;  2EM4 A;  2YTQ A;  2EMX A;  2LMZ A;  2LV2 A;  2EMC A;  4R2Q A;  1YFH A;  4K0K E;  2EPU A;  2NAB A;  1X49 A;  1A1K A;  1A1F A;  2UU9 E;  4DV0 E;  4R2S A;  4LF5 E;  2EPA A;  2J7J A;  5BR8 E;  4F2J C;  1ZAA C;  1NEI A;  3VK6 A;  4LFA E;  3HPS A;  3ECR A;  2YU5 A;  2JXP A;  4RHB B;  1UHZ A;  2CT1 A;  1YSA C;  1DQ3 A;  1UIL A;  1YYK A;  4R2P A;  2EN3 A;  2ZM6 E;  2EM2 A;  2N8X A;  5A2Q C;  1J5E E;  2YSP A;  4YHH E;  4OX9 E;  2F8B A;  4Q28 A;  2LT7 A;  3ZOQ B;  2EPX A;  4JI6 E;  4NZV A;  1FJG E;  1STU A;  2EL6 A;  2EOO A;  5A6B D;  3J7A G;  1KJK A;  2EM3 A;  2NUE A;  4P78 A;  2V86 A;  3RMP A;  3MSW A;  4DV6 E;  4WXC A;  5DNY A;  2VQE E;  4B3R E;  5IWA E;  2EML A;  1T39 A;  4JI3 E;  4M30 A;  4LF8 E;  2LUP B;  1P47 A;  4F9A B;  4BC7 A;  5KL2 A;  2EWL A;  2WZO A;  2L2N A;  4B3S E;  2E1M A;  2R76 A;  1I94 E;  4DR2 E;  2LCE A;  5KL3 A;  4WFT A;  2YPN A;  3ADI A;  2V87 A;  5KL6 A;  3C4T A;  1GQE A;  2EJ4 A;  4J8Z A;  4LFC E;  1SFE A;  2WBU A;  2EMI A;  4LFB E;  1DGC A;  2M7Q A;  2YTG A;  1F2I G;  5A6J A;  2YRH A;  4BS9 A;  2E5L E;  1X6E A;  2YU8 A;  3IWD A;  4I8O A;  1LLM C;  2EMY A;  4KHP E;  5TSE A;  2EE8 A;  4HTG A;  4NXN E;  1N32 E;  2EMH A;  2E72 A;  3BID A;  4WYQ B;  3T1Y E;  1N34 E;  4LU9 A;  4BC9 A;  4WX9 A;  2EPK X;  5LMN E;  3EQ1 A;  3KZZ A;  1MGT A;  2EN4 A;  5IV8 B;  2M1S A;  3P1X A;  4O24 A;  4BHB A;  5LMU E;  4GKK E;  4BBY A;  1L4S A;  3HTX A;  2EQ0 A;  3ADG A;  5KL7 A;  2YZT A;  4YY3 E;  4LF6 E;  2EM5 A;  5LL6 R;  2VF1 A;  3AUZ A;  2VQF E;  2DGC A;  2CSH A;  2YRK A;  5AE2 A;  1YUJ A;  2YWQ A;  2HJJ A;  2YTO A;  4JI0 E;  4M9V C;  4F6N A;  4TUG A;  2YTP A;  4DUY E;  2L92 A;  3OML A;  1X3C A;  5AE3 A;  3KWR A;  5AE1 A;  2EOI A;  1XMQ E;  1WJP A;  3QG5 C; 
#chains in the Genus database with same CATH homology
 3C4B A;  1T4O A;  1UHZ A;  5AAS A;  1DQ3 A;  1UIL A;  2L3J A;  1YYK A;  3IWC A;  4BCA A;  3JTZ A;  2LTR A;  3ADL A;  3H09 A;  2F4V E;  3JAM C;  4DV4 E;  5IT9 C;  2DIX A;  2ZM6 E;  5A2Q C;  2JY9 A;  2V89 A;  2ODR D;  2L33 A;  4F54 A;  2M4I A;  1RC7 A;  1J5E E;  2FGG A;  4OOG C;  2CPN A;  4YHH E;  3J81 C;  1WHN A;  1QU6 A;  2F8B A;  2G7H A;  4Q28 A;  4DMI A;  2MDR A;  1WXR A;  4DV5 E;  2UUC E;  2UXD E;  2L6M A;  2V85 A;  1SR9 A;  2LJH A;  3ZOQ B;  4B3T E;  1YYW A;  2DSY A;  1IBL E;  4JI6 E;  1DI2 A;  1FJG E;  1STU A;  3K6Q A;  1YZ9 A;  3IWB A;  1X47 A;  1T4N A;  3J7A G;  2JVA A;  2NUE A;  5T6J A;  4P78 A;  2V86 A;  2NA2 A;  3RMP A;  2UXB E;  3MSW A;  4DV6 E;  2UUB E;  4OX9 E;  1XNQ E;  1PKP A;  5DNY A;  2VQE E;  4DV1 E;  1HR0 E;  1EKZ A;  4R8O A;  4B3R E;  3T1H E;  2L3C A;  4NXM E;  4GEQ B;  4JI8 E;  2JWO A;  5IWA E;  4JI3 E;  2L2M A;  4M30 A;  1O0W A;  4LF8 E;  3ADJ A;  4X62 E;  2FV4 B;  2LUP B;  2RS6 A;  2JOX A;  4F9A B;  4DV2 E;  2K4V A;  2LUQ A;  4BC7 A;  3VYX A;  4M2Z A;  1T4L B;  3J80 C;  1GZ6 A;  2B9D A;  2EWL A;  2FTX B;  2WZO A;  5ADZ A;  3DJW A;  1XNR E;  4F9B B;  2YT4 A;  4X8W A;  1IBM E;  2L2N A;  4B3S E;  2E1M A;  2LTS A;  1I94 E;  2LE2 A;  3LML A;  4KZS A;  4DKK A;  4DR2 E;  4L5N C;  4TUI A;  2RS7 A;  3HXL A;  1J26 A;  4WFT A;  4X65 E;  3HPZ A;  3ADI A;  4LF4 E;  2V87 A;  2NUG A;  2MC5 A;  3C4T A;  1GQE A;  4J8Z A;  4LFC E;  4DV3 E;  4JV5 E;  4DR7 E;  2H36 X;  1FKA E;  4LF7 E;  4LFB E;  4X66 E;  2EZ6 A;  2M7Q A;  4DUZ E;  5F3W A;  3J7Y p;  2VE7 C;  4L8N A;  4DR4 E;  2LBS B;  5FLX C;  2V88 A;  4R03 A;  2B3T B;  4BS9 A;  2E5L E;  2RSM A;  4JYA E;  2KHX A;  2L8T A;  1YYO A;  2KON A;  1XMO E;  2UUA E;  4DR6 E;  2IHR 1;  3IWD A;  4I8O A;  2LRS A;  1N33 E;  4KHP E;  4DR3 E;  4X64 E;  4JI1 E;  2N3H A;  4BMJ A;  4M0V A;  4JI5 E;  2DB2 A;  3DF6 A;  4DR1 E;  4AQY E;  2B7V A;  4GKJ E;  4NXN E;  1RQ0 A;  1N32 E;  4LTY A;  4WSP A;  4WYQ B;  1N34 E;  3T1Y E;  4WPY A;  1ZBT A;  3VYY A;  4LU9 A;  4BC9 A;  2HHH E;  5LMN E;  2V83 A;  2UXC E;  4LF9 E;  4JI2 E;  2JR1 A;  2V8Q B;  3F6G A;  1HNZ E;  2M1S A;  2RTX A;  3P1X A;  4P7D A;  5LMU E;  4GKK E;  4BBY A;  2N3G A;  3HTX A;  2LMZ A;  3ADG A;  4JI7 E;  3AV0 A;  2YZT A;  2NUF A;  3OTO E;  1WHQ A;  4K0K E;  4B3M E;  4DV7 E;  4YY3 E;  4LF6 E;  1ZBQ A;  2KOU A;  2VF1 A;  3AUZ A;  5LL6 R;  2VQF E;  1HNX E;  1X49 A;  2UU9 E;  2ODR C;  1N36 E;  4DV0 E;  3LLH A;  4LF5 E;  2MC6 A;  5CFF E;  3HQ1 A;  3F6H A;  3FIG A;  5AE2 A;  4JI0 E;  2JOB A;  3JU0 A;  5BR8 E;  4TUG A;  4DUY E;  2L2K B;  1IBK E;  4JI4 E;  1X48 A;  2L92 A;  3OML A;  3VK6 A;  5AE3 A;  2B7T A;  1HNW E;  3KWR A;  4LFA E;  5AE1 A;  3HPS A;  4DR5 E;  2DMY A;  1XMQ E;  4F9C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...