2LUPB

Rdc refined solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with the terminal rna hairpin of snr47 precursor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (32-MER)
publication title Structure of a yeast RNase III dsRBD complex with a noncanonical RNA substrate provides new insights into binding specificity of dsRBDs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lupB00
4NXNE 4OOGC 4DR7E 3T1HE 4JI5E 2UXBE 1HR0E 4LFAE 2N3GA 2EZ6A 3ADIA 3VYXA 2NA2A 2LTRA 2JY9A 4B3ME 1WHQA 1FKAE 4LF5E 3P1XA 1IBLE 2YT4A 4DR3E 2JVAA 4DV1E 4DV7E 2B3TB 2LBSB 2NUFA 4B3SE 4DKKA 4JI1E 2UUBE 4DR2E 4YY3E 1XMOE 1WHNA 4DUZE 2B7VA 4YHHE 2L33A 4X65E 2L2NA 4DV3E 2MDRA 2CPNA 2F4VE 1T4NA 4DUYE 1O0WA 1T4LB 3J7Yp 4DV4E 1X47A 5LMUE 3ADJA 1YYKA 1N33E 2DMYA 2LJHA 2UUCE 5IWAE 4JYAE 2L2MA 2RTXA 1PKPA 2NUGA 2RS6A 1XMQE 4GKKE 2L2KB 4JI8E 1HNXE 5BR8E 4LF6E 1HNWE 4GKJE 4B3TE 1FJGE 1IBME 3C4TA 5LMNE 2LTSA 2L3JA 3VYYA 4DV0E 1X49A 4LF8E 2IHR1 5CFFE 1X48A 2UUAE 2ZM6E 4X66E 1N34E 2L3CA 1ZBTA 1RC7A 1UHZA 2LUQA 1HNZE 4M2ZA 2KHXA 4JI0E 2B7TA 4X8WA 2E5LE 3LLHA 4WFTA 4JI3E 4LF7E 1EKZA 1QU6A 4JI4E 2UU9E 1XNRE 2RSMA 1STUA 1DI2A 4DR1E 2HHHE 4LF4E 4OX9E 1J26A 4JV5E 2VQFE 2RS7A 2LUPB 2DIXA 4DR5E 2UXDE 2N3HA 4DV5E 4LFCE 3ADLA 2DB2A 4DV2E 3ADGA 1UILA 4M30A 1YYWA 4AQYE 4LFBE 1N32E 4X62E 3T1YE 2UXCE 4JI2E 1XNQE 4JI7E 1N36E 1J5EE 3HTXA 4DR6E 4JI6E 4DV6E 1IBKE 1GQEA 4WYQB 3C4BA 1YZ9A 4K0KE 1T4OA 4KHPE 4B3RE 3OTOE 1RQ0A 2NUEA 2VQEE 1I94E 4DR4E 4NXME 4LF9E 2LRSA 4X64E 1YYOA
chains in the Genus database with same CATH superfamily
2A25A 4X9JA 5FLXC 2HJJA 1G2FC 2N3GA 2I13A 5KL7A 3VYXA 5F3WA 4B3ME 1WHQA 1FKAE 2L6MA 2EQ3A 4WXDA 2YWQA 3KWRA 4WPYA 2H36X 4F9CB 1DGCA 2EPAA 4DV1E 4DV7E 2B3TB 4B3SE 4DR2E 4YY3E 5A6JA 2EOSA 2EMIA 2M4IA 3EPJA 4YHHE 4R2AA 1GTKA 2JXPA 3VK6A 1F2IG 2EOFA 2MDRA 2I9IA 2CPNA 1T4NA 4O43A 2EPMX 5AC4A 2YSPA 5IXMB 2KOUA 5LMUE 2BB8A 2DLKA 2DMYA 2EMCA 5IV8B 5A6BD 4JYAE 1AAYA 2CTDA 1XMQE 2L2KB 4JI8E 2LCEA 4FK5C 4B3TE 3IWDA 3EQ1A 1KJKA 3HQ1A 2DSYA 5CFFE 2EMYA 3IWCA 2EMKA 2G7HA 2UUAE 4X66E 2JR1A 2LO3A 1MGTA 4IS1C 1HNZE 2EPKX 2V89A 2L92A 2EOYA 4WSGA 2E5LE 2L8TA 2EOOA 2UU9E 2PRTA 4LF4E 5IT9C 2MC6A 1WXRA 3BIDA 2UXDE 1YPNA 2N3HA 3F6GA 2DB2A 4DV2E 2EOXA 1JK1A 2ODRC 4N4RB 5LLQA 2YRMA 5DNYA 4O5GA 2EP3A 2MDGA 5KL4A 4BS9A 3OMLA 2EMWA 1N36E 4DR6E 4MLVA 2EN3A 3AV0A 4R2EA 4R03A 3DF6A 2VE7C 3C4BA 2LJUA 1L4SA 4K0KE 1T4OA 3BGHA 2MKDA 1BBOA 2VQEE 2GPIA 1I94E 1A1JA 4O4KA 4NXME 4X64E 1YYOA 1IMUA 1SR9A 3T1HE 4JI5E 2JYAA 3C6MA 3EPHA 2EMHA 2ENCA 2NA2A 2LTRA 2V88A 1A1HA 4R2CA 2YTEA 1QNTA 2EPCA 1IBLE 2EQ1A 2EOJA 1NCSA 2EMXA 2UUBE 2D9HA 4P78A 2EPNA 2YPNA 2B7VA 4X65E 2F8BA 2L2NA 4DV3E 2YTOA 3M99B 4GEQB 4J8ZA 2YSOA 1T4LB 1G2DC 2BBGA 3J7Yp 2LVHA 4DV4E 1X47A 1JK2A 1N33E 1X6HA 4RH8A 2UUCE 5IWAE 1A1GA 2EPPA 2JOXA 1PKPA 4GKKE 4ZYEA 2EORA 1HNXE 4BHBA 4LF6E 2R1FA 2EOEA 3THOB 5A6AA 2YTPA 3JTZA 1BB8A 3VYYA 2EOIA 2ADRA 4DV0E 1X49A 2LV2A 3K6QA 4R2RA 4LF8E 2IHR1 2EOHA 2VF1A 4MLQA 2ZM6E 2EE8A 4NHRA 1ZBTA 2LT7A 2EM3A 2YTNA 2KHXA 3THNA 4ZYDA 4RHBB 2EWLA 2RPCA 3LLHA 5AE1A 2EJ4A 4BC7A 2EL6A 2EMGA 2EN8A 4DR1E 3DJWA 2YTIA 4M9VC 4F54A 2WZOA 1EH7A 5ADZA 2RS7A 3H09A 2DIXA 4Q35B 1P47A 2MC5A 4DV5E 5KL2A 3ADGA 3MHHC 4KZSA 2EPUA 4KWYA 1Z1BA 4AQYE 2ENAA 4LFBE 5A6BA 2MKNA 3T1YE 3TQMA 2M1SA 1XNQE 1T39A 1TN9A 2V85A 4JI7E 2EN4A 3HTXA 5AC5A 2EPRA 4DV6E 4JI6E 1X6FA 1GQEA 1ZU1A 4KHPE 2RSIA 1ZR9A 4B3RE 1LLMC 1RQ0A 4DR4E 2NABA 4LF9E 5AASA 4NXNE 4L5NC 4OOGC 2UXBE 2B9DA 2DRPA 2CSHA 5LL6R 2GLIA 2DMIA 4BC9A 4I8OA 4F9BB 2JY9A 2YTJA 3JU0A 4LF5E 2EN6A 3BF2A 3HPZA 1EH8A 1X5WA 4F6MA 2JVAA 2K4VA 2YRHA 2LBSB 2NUFA 4DKKA 4JI1E 1XMOE 2ELZA 1YFHA 2EM7A 2EOQA 4TUIA 3C6KA 1PJSA 2YTQA 2EMFA 1A1IA 2ENHA 1N3GA 2F4VE 4LTYA 2YTFA 1PJTA 3ADJA 2HC5A 2N8XA 2EMBA 2EQ0A 2JOBA 5A6KA 3JAMC 2RTXA 4F6NA 4WX9A 2RS6A 2JP9A 2NUGA 2EMAA 4L8NA 1WJPA 5BR8E 1T38A 1HNWE 4GKJE 1FJGE 2EPXA 1BBGA 1IBME 2LTSA 2E72A 1A1FA 5KL3A 2CT1A 1X48A 2J7JA 2RQLA 4R2QA 2YRKA 2LMZA 4R8OA 2L3CA 1N34E 4ZYGA 3ZOQB 1UHZA 2LUQA 1PDAA 4P7DA 4JI0E 2B7TA 5T6JA 4X8WA 4WSPA 4JI3E 4WFTA 2KONA 1EKZA 1TF6A 4JI4E 2EM4A 2RSMA 1STUA 1DI2A 2HHHE 4OX9E 2YU8A 2YU5A 2EN7A 1IQOA 1J26A 3KZYA 2WBSA 3J80C 4DR5E 5KL6A 2EN2A 2WBUA 4M30A 2EL5A 3QG5C 3KZZA 3FIGA 5A2QC 3LMLA 1YUIA 2UXCE 4JI2E 1J5EE 2Q8UA 4R2PA 2M7QA 1IBKE 1X6EA 1SFEA 2EM9A 5KL5A 4Q28A 4BMJA 2FTXB 3VHTB 4TUGA 2EN1A 2E1MA 2NUEA 4ZYHA 2LRSA 5A69A 1B69A 2EMZA 4DR7E 2DGCA 4GZNC 2EM6A 4HEIA 1HR0E 3L00A 3AUZA 5AE2A 4R2SA 4LFAE 2EZ6A 3ADIA 2EMLA 2VRDA 1GZ6A 2FV4B 2V86A 2V83A 2HGHA 2EM8A 3EPLA 3RMPA 2V87A 1MEYC 3P1XA 3IWBA 2YT4A 1X3CA 2K7IA 4DR3E 2EPOA 4NZVA 3EPKA 3F6HA 5AE3A 2LE2A 4WXCA 2EPZA 4F9AB 1WHNA 4DUZE 1TF3A 2V8QB 1ZBQA 1PJQA 2L33A 2ELYA 1YUJA 2EM0A 1NEIA 4DUYE 1O0WA 1AH5A 1YYKA 2LJHA 1IQSA 2JWOA 2L2MA 2YZTA 2JPAA 3J81C 2WBTA 4BHCA 3C4TA 4DMIA 2L3JA 5LMNE 2ODRD 1WRJA 2R76A 4BBYA 1A1KA 1RC7A 1DQ3A 3HXLA 1KYQA 4BCAA 2WCC3 4M2ZA 1A1LA 1EH6A 3ECRA 4R2DA 1UN6B 4LF7E 3MSWA 1ZAAC 1QU6A 4M0VA 1XNRE 3UK3C 3HPSA 4LU9A 4JV5E 1YSAC 2EL4A 2VQFE 2LUPB 4LFCE 3ADLA 4IJDA 1UILA 4O24A 2EOZA 2YTDA 4HTGA 1YYWA 2EOMA 1RMDA 1N32E 4X62E 2GHFA 4F2JC 1UBDC 2FGGA 2EM2A 4WYQB 2EPLX 1YZ9A 2YTGA 2M9AA 3OTOE 5TSEA 2DLQA 2EM5A 3BBGA 3J7AG 3MHSC
chains in the Genus database with same CATH topology
4NXNE 1SR9A 4L5NC 4OOGC 4DR7E 3T1HE 4JI5E 2UXBE 2B9DA 5FLXC 1HR0E 3AUZA 5AE2A 4LFAE 2N3GA 5LL6R 2EZ6A 3ADIA 4BC9A 3VYXA 1GZ6A 2NA2A 4I8OA 2FV4B 2LTRA 2V88A 4F9BB 5F3WA 2V86A 2JY9A 2V83A 4B3ME 1WHQA 3RMPA 3JU0A 2L6MA 2V87A 1FKAE 4LF5E 3HPZA 3P1XA 1IBLE 3KWRA 3IWBA 2H36X 2YT4A 4WPYA 4F9CB 4DR3E 2JVAA 4DV1E 4DV7E 2K4VA 2B3TB 2LBSB 3F6HA 5AE3A 2NUFA 4DKKA 2LE2A 4F9AB 4DR2E 4YY3E 2UUBE 1XMOE 4B3SE 4JI1E 1WHNA 4P78A 4DUZE 4TUIA 2M4IA 2V8QB 2B7VA 1ZBQA 4YHHE 2L33A 4X65E 3VK6A 2F8BA 2L2NA 4DV3E 2MDRA 2CPNA 2F4VE 4GEQB 1T4NA 4J8ZA 4LTYA 4DUYE 1O0WA 1T4LB 3J7Yp 4DV4E 1X47A 2KOUA 3ADJA 5LMUE 1YYKA 1N33E 2DMYA 2LJHA 2JOBA 2JWOA 5IWAE 2UUCE 3JAMC 4JYAE 2L2MA 2JOXA 2RTXA 2YZTA 1PKPA 2NUGA 2RS6A 1XMQE 4GKKE 2L2KB 4JI8E 1HNXE 4L8NA 5BR8E 4LF6E 3J81C 1HNWE 4GKJE 4B3TE 1FJGE 1IBME 3IWDA 3C4TA 3JTZA 2LTSA 4DMIA 2L3JA 3HQ1A 5LMNE 3VYYA 2DSYA 2ODRD 4BBYA 4DV0E 1X49A 3K6QA 4LF8E 2IHR1 5CFFE 3IWCA 1X48A 2VF1A 2G7HA 2UUAE 2ZM6E 4X66E 2LMZA 4R8OA 2L3CA 1ZBTA 1N34E 2JR1A 1RC7A 3ZOQB 1DQ3A 1UHZA 3HXLA 2LUQA 4BCAA 1HNZE 4M2ZA 2KHXA 2V89A 4P7DA 2B7TA 5T6JA 4X8WA 1YYOA 2L92A 4WSPA 4JI0E 2E5LE 2EWLA 3LLHA 4WFTA 4JI3E 2L8TA 2KONA 5AE1A 3MSWA 4BC7A 1EKZA 4LF7E 1QU6A 4M0VA 4JI4E 2UU9E 1XNRE 2RSMA 1STUA 1DI2A 4DR1E 3DJWA 2HHHE 4LF4E 4OX9E 1J26A 3HPSA 4LU9A 2MC6A 5IT9C 4JV5E 1WXRA 4F54A 2WZOA 3J80C 5ADZA 2VQFE 2RS7A 3H09A 2DIXA 2LUPB 4DR5E 2MC5A 2UXDE 2N3HA 4DV5E 4LFCE 3F6GA 3ADLA 2DB2A 4DV2E 3ADGA 1UILA 2ODRC 4KZSA 4M30A 1YYWA 5DNYA 4AQYE 4LFBE 3FIGA 5A2QC 1N32E 4X62E 3LMLA 4BS9A 3T1YE 3OMLA 2UXCE 2M1SA 4JI2E 1XNQE 2V85A 4JI7E 1N36E 1J5EE 3HTXA 4DR6E 4JI6E 2FGGA 2M7QA 4DV6E 1IBKE 3AV0A 1GQEA 4R03A 4Q28A 4BMJA 2FTXB 4WYQB 3DF6A 2VE7C 3C4BA 4TUGA 1YZ9A 4K0KE 1T4OA 4KHPE 4B3RE 3OTOE 1RQ0A 2E1MA 2VQEE 1I94E 2NUEA 4DR4E 4NXME 4LF9E 2LRSA 4X64E 5AASA 3J7AG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN E;  4OOG C;  4DR7 E;  3T1H E;  4JI5 E;  2UXB E;  1HR0 E;  4LFA E;  2N3G A;  2EZ6 A;  3ADI A;  3VYX A;  2NA2 A;  2LTR A;  2JY9 A;  4B3M E;  1WHQ A;  1FKA E;  4LF5 E;  3P1X A;  1IBL E;  2YT4 A;  4DR3 E;  2JVA A;  4DV1 E;  4DV7 E;  2B3T B;  2LBS B;  2NUF A;  4B3S E;  4DKK A;  4JI1 E;  2UUB E;  4DR2 E;  4YY3 E;  1XMO E;  1WHN A;  4DUZ E;  2B7V A;  4YHH E;  2L33 A;  4X65 E;  2L2N A;  4DV3 E;  2MDR A;  2CPN A;  2F4V E;  1T4N A;  4DUY E;  1O0W A;  1T4L B;  3J7Y p;  4DV4 E;  1X47 A;  5LMU E;  3ADJ A;  1YYK A;  1N33 E;  2DMY A;  2LJH A;  2UUC E;  5IWA E;  4JYA E;  2L2M A;  2RTX A;  1PKP A;  2NUG A;  2RS6 A;  1XMQ E;  4GKK E;  2L2K B;  4JI8 E;  1HNX E;  5BR8 E;  4LF6 E;  1HNW E;  4GKJ E;  4B3T E;  1FJG E;  1IBM E;  3C4T A;  5LMN E;  2LTS A;  2L3J A;  3VYY A;  4DV0 E;  1X49 A;  4LF8 E;  2IHR 1;  5CFF E;  1X48 A;  2UUA E;  2ZM6 E;  4X66 E;  1N34 E;  2L3C A;  1ZBT A;  1RC7 A;  1UHZ A;  2LUQ A;  1HNZ E;  4M2Z A;  2KHX A;  4JI0 E;  2B7T A;  4X8W A;  2E5L E;  3LLH A;  4WFT A;  4JI3 E;  4LF7 E;  1EKZ A;  1QU6 A;  4JI4 E;  2UU9 E;  1XNR E;  2RSM A;  1STU A;  1DI2 A;  4DR1 E;  2HHH E;  4LF4 E;  4OX9 E;  1J26 A;  4JV5 E;  2VQF E;  2RS7 A;  2LUP B;  2DIX A;  4DR5 E;  2UXD E;  2N3H A;  4DV5 E;  4LFC E;  3ADL A;  2DB2 A;  4DV2 E;  3ADG A;  1UIL A;  4M30 A;  1YYW A;  4AQY E;  4LFB E;  1N32 E;  4X62 E;  3T1Y E;  2UXC E;  4JI2 E;  1XNQ E;  4JI7 E;  1N36 E;  1J5E E;  3HTX A;  4DR6 E;  4JI6 E;  4DV6 E;  1IBK E;  1GQE A;  4WYQ B;  3C4B A;  1YZ9 A;  4K0K E;  1T4O A;  4KHP E;  4B3R E;  3OTO E;  1RQ0 A;  2NUE A;  2VQE E;  1I94 E;  4DR4 E;  4NXM E;  4LF9 E;  2LRS A;  4X64 E;  1YYO A; 
#chains in the Genus database with same CATH topology
 2A25 A;  4X9J A;  5FLX C;  2HJJ A;  1G2F C;  2N3G A;  2I13 A;  5KL7 A;  3VYX A;  5F3W A;  4B3M E;  1WHQ A;  1FKA E;  2L6M A;  2EQ3 A;  4WXD A;  2YWQ A;  3KWR A;  4WPY A;  2H36 X;  4F9C B;  1DGC A;  2EPA A;  4DV1 E;  4DV7 E;  2B3T B;  4B3S E;  4DR2 E;  4YY3 E;  5A6J A;  2EOS A;  2EMI A;  2M4I A;  3EPJ A;  4YHH E;  4R2A A;  1GTK A;  2JXP A;  3VK6 A;  1F2I G;  2EOF A;  2MDR A;  2I9I A;  2CPN A;  1T4N A;  4O43 A;  2EPM X;  5AC4 A;  2YSP A;  5IXM B;  2KOU A;  5LMU E;  2BB8 A;  2DLK A;  2DMY A;  2EMC A;  5IV8 B;  5A6B D;  4JYA E;  1AAY A;  2CTD A;  1XMQ E;  2L2K B;  4JI8 E;  2LCE A;  4FK5 C;  4B3T E;  3IWD A;  3EQ1 A;  1KJK A;  3HQ1 A;  2DSY A;  5CFF E;  2EMY A;  3IWC A;  2EMK A;  2G7H A;  2UUA E;  4X66 E;  2JR1 A;  2LO3 A;  1MGT A;  4IS1 C;  1HNZ E;  2EPK X;  2V89 A;  2L92 A;  2EOY A;  4WSG A;  2E5L E;  2L8T A;  2EOO A;  2UU9 E;  2PRT A;  4LF4 E;  5IT9 C;  2MC6 A;  1WXR A;  3BID A;  2UXD E;  1YPN A;  2N3H A;  3F6G A;  2DB2 A;  4DV2 E;  2EOX A;  1JK1 A;  2ODR C;  4N4R B;  5LLQ A;  2YRM A;  5DNY A;  4O5G A;  2EP3 A;  2MDG A;  5KL4 A;  4BS9 A;  3OML A;  2EMW A;  1N36 E;  4DR6 E;  4MLV A;  2EN3 A;  3AV0 A;  4R2E A;  4R03 A;  3DF6 A;  2VE7 C;  3C4B A;  2LJU A;  1L4S A;  4K0K E;  1T4O A;  3BGH A;  2MKD A;  1BBO A;  2VQE E;  2GPI A;  1I94 E;  1A1J A;  4O4K A;  4NXM E;  4X64 E;  1YYO A;  1IMU A;  1SR9 A;  3T1H E;  4JI5 E;  2JYA A;  3C6M A;  3EPH A;  2EMH A;  2ENC A;  2NA2 A;  2LTR A;  2V88 A;  1A1H A;  4R2C A;  2YTE A;  1QNT A;  2EPC A;  1IBL E;  2EQ1 A;  2EOJ A;  1NCS A;  2EMX A;  2UUB E;  2D9H A;  4P78 A;  2EPN A;  2YPN A;  2B7V A;  4X65 E;  2F8B A;  2L2N A;  4DV3 E;  2YTO A;  3M99 B;  4GEQ B;  4J8Z A;  2YSO A;  1T4L B;  1G2D C;  2BBG A;  3J7Y p;  2LVH A;  4DV4 E;  1X47 A;  1JK2 A;  1N33 E;  1X6H A;  4RH8 A;  2UUC E;  5IWA E;  1A1G A;  2EPP A;  2JOX A;  1PKP A;  4GKK E;  4ZYE A;  2EOR A;  1HNX E;  4BHB A;  4LF6 E;  2R1F A;  2EOE A;  3THO B;  5A6A A;  2YTP A;  3JTZ A;  1BB8 A;  3VYY A;  2EOI A;  2ADR A;  4DV0 E;  1X49 A;  2LV2 A;  3K6Q A;  4R2R A;  4LF8 E;  2IHR 1;  2EOH A;  2VF1 A;  4MLQ A;  2ZM6 E;  2EE8 A;  4NHR A;  1ZBT A;  2LT7 A;  2EM3 A;  2YTN A;  2KHX A;  3THN A;  4ZYD A;  4RHB B;  2EWL A;  2RPC A;  3LLH A;  5AE1 A;  2EJ4 A;  4BC7 A;  2EL6 A;  2EMG A;  2EN8 A;  4DR1 E;  3DJW A;  2YTI A;  4M9V C;  4F54 A;  2WZO A;  1EH7 A;  5ADZ A;  2RS7 A;  3H09 A;  2DIX A;  4Q35 B;  1P47 A;  2MC5 A;  4DV5 E;  5KL2 A;  3ADG A;  3MHH C;  4KZS A;  2EPU A;  4KWY A;  1Z1B A;  4AQY E;  2ENA A;  4LFB E;  5A6B A;  2MKN A;  3T1Y E;  3TQM A;  2M1S A;  1XNQ E;  1T39 A;  1TN9 A;  2V85 A;  4JI7 E;  2EN4 A;  3HTX A;  5AC5 A;  2EPR A;  4DV6 E;  4JI6 E;  1X6F A;  1GQE A;  1ZU1 A;  4KHP E;  2RSI A;  1ZR9 A;  4B3R E;  1LLM C;  1RQ0 A;  4DR4 E;  2NAB A;  4LF9 E;  5AAS A;  4NXN E;  4L5N C;  4OOG C;  2UXB E;  2B9D A;  2DRP A;  2CSH A;  5LL6 R;  2GLI A;  2DMI A;  4BC9 A;  4I8O A;  4F9B B;  2JY9 A;  2YTJ A;  3JU0 A;  4LF5 E;  2EN6 A;  3BF2 A;  3HPZ A;  1EH8 A;  1X5W A;  4F6M A;  2JVA A;  2K4V A;  2YRH A;  2LBS B;  2NUF A;  4DKK A;  4JI1 E;  1XMO E;  2ELZ A;  1YFH A;  2EM7 A;  2EOQ A;  4TUI A;  3C6K A;  1PJS A;  2YTQ A;  2EMF A;  1A1I A;  2ENH A;  1N3G A;  2F4V E;  4LTY A;  2YTF A;  1PJT A;  3ADJ A;  2HC5 A;  2N8X A;  2EMB A;  2EQ0 A;  2JOB A;  5A6K A;  3JAM C;  2RTX A;  4F6N A;  4WX9 A;  2RS6 A;  2JP9 A;  2NUG A;  2EMA A;  4L8N A;  1WJP A;  5BR8 E;  1T38 A;  1HNW E;  4GKJ E;  1FJG E;  2EPX A;  1BBG A;  1IBM E;  2LTS A;  2E72 A;  1A1F A;  5KL3 A;  2CT1 A;  1X48 A;  2J7J A;  2RQL A;  4R2Q A;  2YRK A;  2LMZ A;  4R8O A;  2L3C A;  1N34 E;  4ZYG A;  3ZOQ B;  1UHZ A;  2LUQ A;  1PDA A;  4P7D A;  4JI0 E;  2B7T A;  5T6J A;  4X8W A;  4WSP A;  4JI3 E;  4WFT A;  2KON A;  1EKZ A;  1TF6 A;  4JI4 E;  2EM4 A;  2RSM A;  1STU A;  1DI2 A;  2HHH E;  4OX9 E;  2YU8 A;  2YU5 A;  2EN7 A;  1IQO A;  1J26 A;  3KZY A;  2WBS A;  3J80 C;  4DR5 E;  5KL6 A;  2EN2 A;  2WBU A;  4M30 A;  2EL5 A;  3QG5 C;  3KZZ A;  3FIG A;  5A2Q C;  3LML A;  1YUI A;  2UXC E;  4JI2 E;  1J5E E;  2Q8U A;  4R2P A;  2M7Q A;  1IBK E;  1X6E A;  1SFE A;  2EM9 A;  5KL5 A;  4Q28 A;  4BMJ A;  2FTX B;  3VHT B;  4TUG A;  2EN1 A;  2E1M A;  2NUE A;  4ZYH A;  2LRS A;  5A69 A;  1B69 A;  2EMZ A;  4DR7 E;  2DGC A;  4GZN C;  2EM6 A;  4HEI A;  1HR0 E;  3L00 A;  3AUZ A;  5AE2 A;  4R2S A;  4LFA E;  2EZ6 A;  3ADI A;  2EML A;  2VRD A;  1GZ6 A;  2FV4 B;  2V86 A;  2V83 A;  2HGH A;  2EM8 A;  3EPL A;  3RMP A;  2V87 A;  1MEY C;  3P1X A;  3IWB A;  2YT4 A;  1X3C A;  2K7I A;  4DR3 E;  2EPO A;  4NZV A;  3EPK A;  3F6H A;  5AE3 A;  2LE2 A;  4WXC A;  2EPZ A;  4F9A B;  1WHN A;  4DUZ E;  1TF3 A;  2V8Q B;  1ZBQ A;  1PJQ A;  2L33 A;  2ELY A;  1YUJ A;  2EM0 A;  1NEI A;  4DUY E;  1O0W A;  1AH5 A;  1YYK A;  2LJH A;  1IQS A;  2JWO A;  2L2M A;  2YZT A;  2JPA A;  3J81 C;  2WBT A;  4BHC A;  3C4T A;  4DMI A;  2L3J A;  5LMN E;  2ODR D;  1WRJ A;  2R76 A;  4BBY A;  1A1K A;  1RC7 A;  1DQ3 A;  3HXL A;  1KYQ A;  4BCA A;  2WCC 3;  4M2Z A;  1A1L A;  1EH6 A;  3ECR A;  4R2D A;  1UN6 B;  4LF7 E;  3MSW A;  1ZAA C;  1QU6 A;  4M0V A;  1XNR E;  3UK3 C;  3HPS A;  4LU9 A;  4JV5 E;  1YSA C;  2EL4 A;  2VQF E;  2LUP B;  4LFC E;  3ADL A;  4IJD A;  1UIL A;  4O24 A;  2EOZ A;  2YTD A;  4HTG A;  1YYW A;  2EOM A;  1RMD A;  1N32 E;  4X62 E;  2GHF A;  4F2J C;  1UBD C;  2FGG A;  2EM2 A;  4WYQ B;  2EPL X;  1YZ9 A;  2YTG A;  2M9A A;  3OTO E;  5TSE A;  2DLQ A;  2EM5 A;  3BBG A;  3J7A G;  3MHS C; 
#chains in the Genus database with same CATH homology
 4NXN E;  1SR9 A;  4L5N C;  4OOG C;  4DR7 E;  3T1H E;  4JI5 E;  2UXB E;  2B9D A;  5FLX C;  1HR0 E;  3AUZ A;  5AE2 A;  4LFA E;  2N3G A;  5LL6 R;  2EZ6 A;  3ADI A;  4BC9 A;  3VYX A;  1GZ6 A;  2NA2 A;  4I8O A;  2FV4 B;  2LTR A;  2V88 A;  4F9B B;  5F3W A;  2V86 A;  2JY9 A;  2V83 A;  4B3M E;  1WHQ A;  3RMP A;  3JU0 A;  2L6M A;  2V87 A;  1FKA E;  4LF5 E;  3HPZ A;  3P1X A;  1IBL E;  3KWR A;  3IWB A;  2H36 X;  2YT4 A;  4WPY A;  4F9C B;  4DR3 E;  2JVA A;  4DV1 E;  4DV7 E;  2K4V A;  2B3T B;  2LBS B;  3F6H A;  5AE3 A;  2NUF A;  4DKK A;  2LE2 A;  4F9A B;  4DR2 E;  4YY3 E;  2UUB E;  1XMO E;  4B3S E;  4JI1 E;  1WHN A;  4P78 A;  4DUZ E;  4TUI A;  2M4I A;  2V8Q B;  2B7V A;  1ZBQ A;  4YHH E;  2L33 A;  4X65 E;  3VK6 A;  2F8B A;  2L2N A;  4DV3 E;  2MDR A;  2CPN A;  2F4V E;  4GEQ B;  1T4N A;  4J8Z A;  4LTY A;  4DUY E;  1O0W A;  1T4L B;  3J7Y p;  4DV4 E;  1X47 A;  2KOU A;  3ADJ A;  5LMU E;  1YYK A;  1N33 E;  2DMY A;  2LJH A;  2JOB A;  2JWO A;  5IWA E;  2UUC E;  3JAM C;  4JYA E;  2L2M A;  2JOX A;  2RTX A;  2YZT A;  1PKP A;  2NUG A;  2RS6 A;  1XMQ E;  4GKK E;  2L2K B;  4JI8 E;  1HNX E;  4L8N A;  5BR8 E;  4LF6 E;  3J81 C;  1HNW E;  4GKJ E;  4B3T E;  1FJG E;  1IBM E;  3IWD A;  3C4T A;  3JTZ A;  2LTS A;  4DMI A;  2L3J A;  3HQ1 A;  5LMN E;  3VYY A;  2DSY A;  2ODR D;  4BBY A;  4DV0 E;  1X49 A;  3K6Q A;  4LF8 E;  2IHR 1;  5CFF E;  3IWC A;  1X48 A;  2VF1 A;  2G7H A;  2UUA E;  2ZM6 E;  4X66 E;  2LMZ A;  4R8O A;  2L3C A;  1ZBT A;  1N34 E;  2JR1 A;  1RC7 A;  3ZOQ B;  1DQ3 A;  1UHZ A;  3HXL A;  2LUQ A;  4BCA A;  1HNZ E;  4M2Z A;  2KHX A;  2V89 A;  4P7D A;  2B7T A;  5T6J A;  4X8W A;  1YYO A;  2L92 A;  4WSP A;  4JI0 E;  2E5L E;  2EWL A;  3LLH A;  4WFT A;  4JI3 E;  2L8T A;  2KON A;  5AE1 A;  3MSW A;  4BC7 A;  1EKZ A;  4LF7 E;  1QU6 A;  4M0V A;  4JI4 E;  2UU9 E;  1XNR E;  2RSM A;  1STU A;  1DI2 A;  4DR1 E;  3DJW A;  2HHH E;  4LF4 E;  4OX9 E;  1J26 A;  3HPS A;  4LU9 A;  2MC6 A;  5IT9 C;  4JV5 E;  1WXR A;  4F54 A;  2WZO A;  3J80 C;  5ADZ A;  2VQF E;  2RS7 A;  3H09 A;  2DIX A;  2LUP B;  4DR5 E;  2MC5 A;  2UXD E;  2N3H A;  4DV5 E;  4LFC E;  3F6G A;  3ADL A;  2DB2 A;  4DV2 E;  3ADG A;  1UIL A;  2ODR C;  4KZS A;  4M30 A;  1YYW A;  5DNY A;  4AQY E;  4LFB E;  3FIG A;  5A2Q C;  1N32 E;  4X62 E;  3LML A;  4BS9 A;  3T1Y E;  3OML A;  2UXC E;  2M1S A;  4JI2 E;  1XNQ E;  2V85 A;  4JI7 E;  1N36 E;  1J5E E;  3HTX A;  4DR6 E;  4JI6 E;  2FGG A;  2M7Q A;  4DV6 E;  1IBK E;  3AV0 A;  1GQE A;  4R03 A;  4Q28 A;  4BMJ A;  2FTX B;  4WYQ B;  3DF6 A;  2VE7 C;  3C4B A;  4TUG A;  1YZ9 A;  4K0K E;  1T4O A;  4KHP E;  4B3R E;  3OTO E;  1RQ0 A;  2E1M A;  2VQE E;  1I94 E;  2NUE A;  4DR4 E;  4NXM E;  4LF9 E;  2LRS A;  4X64 E;  5AAS A;  3J7A G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...