2LUPB

Rdc refined solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with the terminal rna hairpin of snr47 precursor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords RNA (32-MER)
publication title Structure of a yeast RNase III dsRBD complex with a noncanonical RNA substrate provides new insights into binding specificity of dsRBDs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lupB00
4JI6E 1X48A 4JI8E 4JI3E 4DV3E 1RC7A 5BR8E 1XMQE 2RTXA 2DB2A 1X47A 2CPNA 2IHR1 1QU6A 2N3GA 4DR2E 2UUCE 4JI5E 4X64E 1HR0E 4LF4E 4GKJE 4YHHE 3HTXA 4X65E 5IWAE 2UUAE 2LRSA 5LMUE 4DR3E 2LTSA 3ADJA 3VYXA 2UUBE 4DR7E 2L2NA 2N3HA 4M30A 1YZ9A 4B3ME 4DV5E 3OTOE 2NUGA 2LTRA 3C4TA 1T4OA 1HNWE 4LF6E 4JV5E 2VQFE 4KHPE 2L2MA 2RS7A 4DR6E 1X49A 1WHNA 1YYKA 2F4VE 2VQEE 4DUZE 4GKKE 1HNXE 2RS6A 5LMNE 2YT4A 1T4LB 1J26A 4B3RE 1DI2A 4YY3E 2B7TA 2JVAA 4JI0E 2ZM6E 4LF8E 1YYWA 4DUYE 2RSMA 1N36E 1J5EE 1N34E 4JI2E 5CFFE 3T1YE 1IBKE 4LFCE 1XNQE 4X62E 2L3JA 1IBME 4WFTA 1STUA 2LJHA 4X66E 4JYAE 4DR1E 2MDRA 4K0KE 4DV0E 2DIXA 2DMYA 4DR4E 4LF5E 2L33A 3J7Yp 2LBSB 3ADGA 3C4BA 2LUPB 2L3CA 3P1XA 3ADIA 4LFBE 4AQYE 4DKKA 3ADLA 4WYQB 4X8WA 4DV4E 1XNRE 4OX9E 4NXME 1T4NA 1O0WA 2E5LE 1PKPA 2HHHE 4OOGC 1FJGE 2B7VA 4JI1E 1N32E 2LUQA 1RQ0A 4NXNE 4LFAE 1UHZA 4DV7E 3LLHA 2EZ6A 3T1HE 2UXDE 2UU9E 1I94E 1HNZE 1ZBTA 1EKZA 4DV2E 2JY9A 4B3SE 4B3TE 4LF9E 4DV1E 2NUEA 1N33E 4DV6E 1FKAE 1YYOA 1GQEA 4M2ZA 3VYYA 2NUFA 4JI4E 1XMOE 4DR5E 2UXBE 2KHXA 1IBLE 4LF7E 2UXCE 2B3TB 1WHQA 2NA2A 4JI7E 2L2KB 1UILA
chains in the Genus database with same CATH superfamily
1RC7A 3FIGA 4WSGA 2RTXA 1XMQE 1X47A 1PJSA 2EQ0A 4F54A 2PRTA 3EPJA 4DR2E 2M7QA 1TF6A 1KJKA 1B69A 1JK2A 2LTSA 4R2QA 2JWOA 2M9AA 2N3HA 5IXMB 2EMBA 1YZ9A 4DV5E 1MGTA 2NUGA 4P7DA 4F9CB 2YTDA 3HXLA 2LTRA 3HPSA 2EN4A 2VQFE 3RMPA 4WXCA 4DUZE 2V88A 2JOBA 4P78A 3KZYA 3C6MA 2YTNA 2YT4A 1J26A 2MKNA 4B3RE 2VRDA 1DI2A 4YY3E 2EWLA 2ZM6E 4LF8E 3DJWA 2RSMA 3JTZA 2EPMX 2EN3A 2EN2A 2VF1A 2WBUA 2EOIA 2EOMA 3F6GA 3HPZA 1IBKE 2YZTA 4O5GA 1XNQE 1UBDC 1IBME 2YU8A 1STUA 4R2PA 3THOB 1UN6B 5AE1A 2GPIA 5A6BA 4M9VC 4DR4E 4X9JA 2EOSA 1GTKA 1ZU1A 2EMYA 2LBSB 2EJ4A 2LUPB 2EPXA 1WXRA 4NZVA 2LE2A 1T4NA 3QG5C 2DRPA 1PDAA 4DMIA 1FJGE 2V89A 2JXPA 4LFAE 2EPRA 3LLHA 1G2FC 1A1JA 2MDGA 3EPKA 1HNZE 4DV2E 2EMKA 2JY9A 1EH8A 2ODRC 4WX9A 4LF9E 2EM6A 1FKAE 2EMGA 1YUIA 3ECRA 2ODRD 4M2ZA 4JI4E 4MLVA 4DR5E 2UXBE 2HGHA 4O4KA 5A6KA 4LF7E 5AE2A 2UXCE 1BBOA 2EQ3A 2FTXB 3AUZA 5A6JA 4JI3E 1ZAAC 4DV3E 2DB2A 1SR9A 1NEIA 3HQ1A 4R2RA 2I13A 1QU6A 2UUCE 2L6MA 4I8OA 1EH7A 4YHHE 3HTXA 4X65E 3M99B 1X6HA 4BBYA 4R2SA 5LMUE 2VE7C 2FGGA 2L2NA 3BBGA 5A2QC 4GEQB 3C4TA 5F3WA 2KOUA 4JV5E 2YTJA 4DR6E 4ZYHA 1YYKA 3EQ1A 1HNXE 4LU9A 5A6BD 5LMNE 1WJPA 4JI0E 3TQMA 1N36E 1A1IA 1J5EE 2E1MA 4JI2E 5CFFE 2R76A 2DSYA 4BC7A 5KL7A 4X62E 2DMIA 2L3JA 4IS1C 2YSPA 2EPPA 4DR1E 4K0KE 2DIXA 2LO3A 3IWCA 4LF5E 1AH5A 2EM3A 1A1HA 2EOOA 2NABA 3C4BA 4HEIA 4HTGA 2EMZA 3ADIA 4LFBE 1ZR9A 4DKKA 4FK5C 4X8WA 1QNTA 4DV4E 1LLMC 4OX9E 4R2EA 1JK1A 3DF6A 2YTFA 1L4SA 2FV4B 2CSHA 4R2CA 2LUQA 1MEYC 5FLXC 3BF2A 4NXNE 2R1FA 4DV7E 4ZYDA 2EZ6A 2ENHA 2YTQA 2Q8UA 2V87A 2EPOA 2RSIA 2V86A 2UU9E 5AC5A 1I94E 2K4VA 1EKZA 3J81C 2EOHA 4B3SE 5T6JA 2DLKA 4DV1E 2NUEA 1N33E 2YPNA 1DGCA 2EOEA 2EOZA 2EOXA 3VYYA 2HJJA 1EH6A 2ADRA 2KHXA 1X6FA 2EPKX 1KYQA 4O24A 2EOFA 1WHQA 2EORA 3VHTB 2EP3A 4JI7E 5AC4A 3BGHA 4JI6E 4IJDA 4BC9A 2YTOA 4WXDA 2EPZA 2H36X 5BR8E 3UK3C 2CPNA 2EMCA 2IHR1 2YTGA 2N3GA 3L00A 4X64E 5A69A 5ADZA 5TSEA 4GKJE 3EPLA 2ENAA 3MSWA 3J80C 2UUAE 2KONA 4DR3E 2UUBE 1YFHA 2YTIA 4M30A 5AASA 1N3GA 4BMJA 2GHFA 4TUGA 3OTOE 1BB8A 1YUJA 3KZZA 2EM2A 2EM9A 4M0VA 1T4OA 1HNWE 3MHSC 2YWQA 2RS7A 1X49A 2F4VE 4GKKE 3EPHA 1T4LB 2EN7A 2JR1A 2JVAA 1YYWA 2JP9A 2F8BA 2M1SA 4DUYE 2V8QB 2BB8A 3H09A 1A1GA 2WZOA 2YTEA 3KWRA 2EM0A 2MC6A 4WFTA 1A1KA 2LJUA 4X66E 2LCEA 4JYAE 1YSAC 4DV0E 2DMYA 2YTPA 4F9BB 2EMLA 2EOJA 5KL4A 1IQSA 2M4IA 3ADGA 3ZOQB 2EL4A 3MHHC 4AQYE 3ADLA 2B9DA 3AV0A 1O0WA 4F6MA 2DLQA 2LV2A 1PKPA 2HHHE 1ZBQA 2B7VA 4KWYA 5KL6A 1UHZA 2EPLX 2ELYA 3T1HE 2UXDE 4NHRA 2E72A 2EOQA 1WRJA 4F6NA 1X5WA 2WBTA 2YSOA 4B3TE 2J7JA 1G2DC 2L8TA 4BHBA 4F2JC 1GQEA 5AE3A 1X3CA 5LLQA 1T38A 1IBLE 2CTDA 2ENCA 2B3TB 2LVHA 2WBSA 2NA2A 2L2KB 1PJQA 4R03A 1A1LA 2EPAA 1TF3A 2EM4A 1X48A 4JI8E 1A1FA 5KL3A 5KL2A 2G7HA 3C6KA 1X6EA 3OMLA 4JI5E 1HR0E 4WSPA 4LF4E 2EMFA 4R2AA 3J7AG 1RMDA 5IWAE 2L92A 2EN6A 2LRSA 2BBGA 2YRMA 3IWBA 3ADJA 2EL5A 5IT9C 3VYXA 4WPYA 4DR7E 2EMIA 2MC5A 3BIDA 1NCSA 5DNYA 4B3ME 2EM5A 4BS9A 1AAYA 4MLQA 2LMZA 4LF6E 2D9HA 4KHPE 2L2MA 1T39A 1WHNA 2VQEE 1GZ6A 2EMAA 4TUIA 2RS6A 4O43A 2K7IA 4BCAA 5IV8B 2YRHA 2B7TA 2DGCA 3K6QA 4F9AB 4J8ZA 2EMWA 1TN9A 1N34E 2EM7A 3T1YE 4RHBB 4LFCE 3THNA 2I9IA 2LJHA 3IWDA 4LTYA 2N8XA 2MDRA 2LT7A 3JAMC 4R2DA 2EE8A 5KL5A 2L33A 2EQ1A 3J7Yp 4RH8A 4ZYEA 2L3CA 2RQLA 3P1XA 2JYAA 4WYQB 1XNRE 3F6HA 4NXME 3LMLA 2GLIA 2E5LE 2EM8A 4OOGC 4JI1E 4L8NA 1N32E 4Q28A 1SFEA 1RQ0A 2EPCA 2EN1A 2HC5A 2RPCA 2EMXA 2WCC3 4BHCA 4KZSA 1DQ3A 1BBGA 1PJTA 2A25A 2EN8A 1ZBTA 2V85A 3JU0A 4R8OA 1P47A 2EPUA 2JPAA 4ZYGA 2V83A 4DV6E 1Z1BA 1YYOA 4Q35B 2EOYA 1IQOA 2EMHA 2YU5A 2NUFA 2MKDA 1XMOE 2EL6A 2EPNA 2YRKA 5A6AA 5LL6R 4GZNC 1IMUA 1YPNA 4L5NC 2CT1A 2ELZA 4N4RB 1F2IG 1UILA 3VK6A 2JOXA
chains in the Genus database with same CATH topology
4JI6E 1X48A 4JI8E 4JI3E 4BC9A 4DV3E 1RC7A 2H36X 5BR8E 3FIGA 1XMQE 2RTXA 2DB2A 1X47A 2G7HA 1SR9A 2CPNA 3HQ1A 2IHR1 1QU6A 2N3GA 4F54A 4DR2E 3OMLA 2M7QA 2UUCE 4X64E 4JI5E 1HR0E 4WSPA 2L6MA 4LF4E 4I8OA 5ADZA 4YHHE 3J7AG 3HTXA 4X65E 4GKJE 3MSWA 4BBYA 5IWAE 3J80C 2UUAE 2L92A 2KONA 2LRSA 2LTSA 3IWBA 5LMUE 2VE7C 3ADJA 4DR3E 5IT9C 2UUBE 2JWOA 4WPYA 3VYXA 2FGGA 2L2NA 2MC5A 2N3HA 4M30A 5AASA 5DNYA 4BMJA 5A2QC 4TUGA 3OTOE 4DV5E 4B3ME 1YZ9A 4BS9A 2NUGA 4P7DA 4GEQB 4F9CB 3HXLA 2LTRA 3HPSA 4M0VA 3C4TA 5F3WA 1T4OA 2LMZA 2KOUA 4LF6E 1HNWE 4JV5E 2VQFE 4KHPE 2L2MA 3RMPA 2RS7A 4DR6E 1X49A 1WHNA 1YYKA 2F4VE 2VQEE 2V88A 1GZ6A 4DUZE 4GKKE 4TUIA 1HNXE 2JOBA 4LU9A 2RS6A 4P78A 5LMNE 2YT4A 1T4LB 2JR1A 4BCAA 4B3RE 1J26A 1DI2A 4YY3E 2B7TA 2EWLA 2JVAA 4JI0E 2ZM6E 4LF8E 3DJWA 1YYWA 2F8BA 2M1SA 2RSMA 2V8QB 3JTZA 3K6QA 4J8ZA 4F9AB 4DUYE 1N36E 2VF1A 3H09A 1J5EE 1N34E 2E1MA 4JI2E 2WZOA 5CFFE 3T1YE 3F6GA 3KWRA 3HPZA 1IBKE 2MC6A 4LFCE 2YZTA 1XNQE 2DSYA 4BC7A 4X62E 2L3JA 4WFTA 1IBME 1STUA 2LJHA 3IWDA 5AE1A 4LTYA 4X66E 4JYAE 4DR1E 2MDRA 4K0KE 4DV0E 2DIXA 2DMYA 4DR4E 4F9BB 3JAMC 3IWCA 4LF5E 2L33A 2M4IA 3J7Yp 2LBSB 3ADGA 3C4BA 2LUPB 2L3CA 3ZOQB 3P1XA 3ADIA 4LFBE 4AQYE 4DKKA 3ADLA 1WXRA 4WYQB 4X8WA 2B9DA 4DV4E 4OX9E 1XNRE 2LE2A 1T4NA 3AV0A 1O0WA 3F6HA 4NXME 3LMLA 2E5LE 1PKPA 3DF6A 4DMIA 2HHHE 4OOGC 1ZBQA 2FV4B 1FJGE 2B7VA 2V89A 4L8NA 2LUQA 4JI1E 5FLXC 4Q28A 1N32E 1RQ0A 4NXNE 4LFAE 1UHZA 4DV7E 3LLHA 2EZ6A 4KZSA 1DQ3A 2V87A 3T1HE 2UXDE 2V86A 2UU9E 1I94E 1HNZE 1ZBTA 2K4VA 2V85A 3JU0A 4R8OA 3J81C 4DV2E 1EKZA 2JY9A 4DR7E 4B3SE 2ODRC 2V83A 5T6JA 4B3TE 4DV1E 4LF9E 2NUEA 1N33E 4DV6E 1FKAE 1YYOA 2L8TA 1GQEA 2ODRD 5AE3A 4M2ZA 3VYYA 2NUFA 4JI4E 1XMOE 4DR5E 2UXBE 5LL6R 2KHXA 1IBLE 4L5NC 4LF7E 5AE2A 2UXCE 2B3TB 1WHQA 2FTXB 2NA2A 3AUZA 4JI7E 2L2KB 4R03A 1UILA 3VK6A 2JOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 E;  1X48 A;  4JI8 E;  4JI3 E;  4DV3 E;  1RC7 A;  5BR8 E;  1XMQ E;  2RTX A;  2DB2 A;  1X47 A;  2CPN A;  2IHR 1;  1QU6 A;  2N3G A;  4DR2 E;  2UUC E;  4JI5 E;  4X64 E;  1HR0 E;  4LF4 E;  4GKJ E;  4YHH E;  3HTX A;  4X65 E;  5IWA E;  2UUA E;  2LRS A;  5LMU E;  4DR3 E;  2LTS A;  3ADJ A;  3VYX A;  2UUB E;  4DR7 E;  2L2N A;  2N3H A;  4M30 A;  1YZ9 A;  4B3M E;  4DV5 E;  3OTO E;  2NUG A;  2LTR A;  3C4T A;  1T4O A;  1HNW E;  4LF6 E;  4JV5 E;  2VQF E;  4KHP E;  2L2M A;  2RS7 A;  4DR6 E;  1X49 A;  1WHN A;  1YYK A;  2F4V E;  2VQE E;  4DUZ E;  4GKK E;  1HNX E;  2RS6 A;  5LMN E;  2YT4 A;  1T4L B;  1J26 A;  4B3R E;  1DI2 A;  4YY3 E;  2B7T A;  2JVA A;  4JI0 E;  2ZM6 E;  4LF8 E;  1YYW A;  4DUY E;  2RSM A;  1N36 E;  1J5E E;  1N34 E;  4JI2 E;  5CFF E;  3T1Y E;  1IBK E;  4LFC E;  1XNQ E;  4X62 E;  2L3J A;  1IBM E;  4WFT A;  1STU A;  2LJH A;  4X66 E;  4JYA E;  4DR1 E;  2MDR A;  4K0K E;  4DV0 E;  2DIX A;  2DMY A;  4DR4 E;  4LF5 E;  2L33 A;  3J7Y p;  2LBS B;  3ADG A;  3C4B A;  2LUP B;  2L3C A;  3P1X A;  3ADI A;  4LFB E;  4AQY E;  4DKK A;  3ADL A;  4WYQ B;  4X8W A;  4DV4 E;  1XNR E;  4OX9 E;  4NXM E;  1T4N A;  1O0W A;  2E5L E;  1PKP A;  2HHH E;  4OOG C;  1FJG E;  2B7V A;  4JI1 E;  1N32 E;  2LUQ A;  1RQ0 A;  4NXN E;  4LFA E;  1UHZ A;  4DV7 E;  3LLH A;  2EZ6 A;  3T1H E;  2UXD E;  2UU9 E;  1I94 E;  1HNZ E;  1ZBT A;  1EKZ A;  4DV2 E;  2JY9 A;  4B3S E;  4B3T E;  4LF9 E;  4DV1 E;  2NUE A;  1N33 E;  4DV6 E;  1FKA E;  1YYO A;  1GQE A;  4M2Z A;  3VYY A;  2NUF A;  4JI4 E;  1XMO E;  4DR5 E;  2UXB E;  2KHX A;  1IBL E;  4LF7 E;  2UXC E;  2B3T B;  1WHQ A;  2NA2 A;  4JI7 E;  2L2K B;  1UIL A; 
#chains in the Genus database with same CATH topology
 1RC7 A;  3FIG A;  4WSG A;  2RTX A;  1XMQ E;  1X47 A;  1PJS A;  2EQ0 A;  4F54 A;  2PRT A;  3EPJ A;  4DR2 E;  2M7Q A;  1TF6 A;  1KJK A;  1B69 A;  1JK2 A;  2LTS A;  4R2Q A;  2JWO A;  2M9A A;  2N3H A;  5IXM B;  2EMB A;  1YZ9 A;  4DV5 E;  1MGT A;  2NUG A;  4P7D A;  4F9C B;  2YTD A;  3HXL A;  2LTR A;  3HPS A;  2EN4 A;  2VQF E;  3RMP A;  4WXC A;  4DUZ E;  2V88 A;  2JOB A;  4P78 A;  3KZY A;  3C6M A;  2YTN A;  2YT4 A;  1J26 A;  2MKN A;  4B3R E;  2VRD A;  1DI2 A;  4YY3 E;  2EWL A;  2ZM6 E;  4LF8 E;  3DJW A;  2RSM A;  3JTZ A;  2EPM X;  2EN3 A;  2EN2 A;  2VF1 A;  2WBU A;  2EOI A;  2EOM A;  3F6G A;  3HPZ A;  1IBK E;  2YZT A;  4O5G A;  1XNQ E;  1UBD C;  1IBM E;  2YU8 A;  1STU A;  4R2P A;  3THO B;  1UN6 B;  5AE1 A;  2GPI A;  5A6B A;  4M9V C;  4DR4 E;  4X9J A;  2EOS A;  1GTK A;  1ZU1 A;  2EMY A;  2LBS B;  2EJ4 A;  2LUP B;  2EPX A;  1WXR A;  4NZV A;  2LE2 A;  1T4N A;  3QG5 C;  2DRP A;  1PDA A;  4DMI A;  1FJG E;  2V89 A;  2JXP A;  4LFA E;  2EPR A;  3LLH A;  1G2F C;  1A1J A;  2MDG A;  3EPK A;  1HNZ E;  4DV2 E;  2EMK A;  2JY9 A;  1EH8 A;  2ODR C;  4WX9 A;  4LF9 E;  2EM6 A;  1FKA E;  2EMG A;  1YUI A;  3ECR A;  2ODR D;  4M2Z A;  4JI4 E;  4MLV A;  4DR5 E;  2UXB E;  2HGH A;  4O4K A;  5A6K A;  4LF7 E;  5AE2 A;  2UXC E;  1BBO A;  2EQ3 A;  2FTX B;  3AUZ A;  5A6J A;  4JI3 E;  1ZAA C;  4DV3 E;  2DB2 A;  1SR9 A;  1NEI A;  3HQ1 A;  4R2R A;  2I13 A;  1QU6 A;  2UUC E;  2L6M A;  4I8O A;  1EH7 A;  4YHH E;  3HTX A;  4X65 E;  3M99 B;  1X6H A;  4BBY A;  4R2S A;  5LMU E;  2VE7 C;  2FGG A;  2L2N A;  3BBG A;  5A2Q C;  4GEQ B;  3C4T A;  5F3W A;  2KOU A;  4JV5 E;  2YTJ A;  4DR6 E;  4ZYH A;  1YYK A;  3EQ1 A;  1HNX E;  4LU9 A;  5A6B D;  5LMN E;  1WJP A;  4JI0 E;  3TQM A;  1N36 E;  1A1I A;  1J5E E;  2E1M A;  4JI2 E;  5CFF E;  2R76 A;  2DSY A;  4BC7 A;  5KL7 A;  4X62 E;  2DMI A;  2L3J A;  4IS1 C;  2YSP A;  2EPP A;  4DR1 E;  4K0K E;  2DIX A;  2LO3 A;  3IWC A;  4LF5 E;  1AH5 A;  2EM3 A;  1A1H A;  2EOO A;  2NAB A;  3C4B A;  4HEI A;  4HTG A;  2EMZ A;  3ADI A;  4LFB E;  1ZR9 A;  4DKK A;  4FK5 C;  4X8W A;  1QNT A;  4DV4 E;  1LLM C;  4OX9 E;  4R2E A;  1JK1 A;  3DF6 A;  2YTF A;  1L4S A;  2FV4 B;  2CSH A;  4R2C A;  2LUQ A;  1MEY C;  5FLX C;  3BF2 A;  4NXN E;  2R1F A;  4DV7 E;  4ZYD A;  2EZ6 A;  2ENH A;  2YTQ A;  2Q8U A;  2V87 A;  2EPO A;  2RSI A;  2V86 A;  2UU9 E;  5AC5 A;  1I94 E;  2K4V A;  1EKZ A;  3J81 C;  2EOH A;  4B3S E;  5T6J A;  2DLK A;  4DV1 E;  2NUE A;  1N33 E;  2YPN A;  1DGC A;  2EOE A;  2EOZ A;  2EOX A;  3VYY A;  2HJJ A;  1EH6 A;  2ADR A;  2KHX A;  1X6F A;  2EPK X;  1KYQ A;  4O24 A;  2EOF A;  1WHQ A;  2EOR A;  3VHT B;  2EP3 A;  4JI7 E;  5AC4 A;  3BGH A;  4JI6 E;  4IJD A;  4BC9 A;  2YTO A;  4WXD A;  2EPZ A;  2H36 X;  5BR8 E;  3UK3 C;  2CPN A;  2EMC A;  2IHR 1;  2YTG A;  2N3G A;  3L00 A;  4X64 E;  5A69 A;  5ADZ A;  5TSE A;  4GKJ E;  3EPL A;  2ENA A;  3MSW A;  3J80 C;  2UUA E;  2KON A;  4DR3 E;  2UUB E;  1YFH A;  2YTI A;  4M30 A;  5AAS A;  1N3G A;  4BMJ A;  2GHF A;  4TUG A;  3OTO E;  1BB8 A;  1YUJ A;  3KZZ A;  2EM2 A;  2EM9 A;  4M0V A;  1T4O A;  1HNW E;  3MHS C;  2YWQ A;  2RS7 A;  1X49 A;  2F4V E;  4GKK E;  3EPH A;  1T4L B;  2EN7 A;  2JR1 A;  2JVA A;  1YYW A;  2JP9 A;  2F8B A;  2M1S A;  4DUY E;  2V8Q B;  2BB8 A;  3H09 A;  1A1G A;  2WZO A;  2YTE A;  3KWR A;  2EM0 A;  2MC6 A;  4WFT A;  1A1K A;  2LJU A;  4X66 E;  2LCE A;  4JYA E;  1YSA C;  4DV0 E;  2DMY A;  2YTP A;  4F9B B;  2EML A;  2EOJ A;  5KL4 A;  1IQS A;  2M4I A;  3ADG A;  3ZOQ B;  2EL4 A;  3MHH C;  4AQY E;  3ADL A;  2B9D A;  3AV0 A;  1O0W A;  4F6M A;  2DLQ A;  2LV2 A;  1PKP A;  2HHH E;  1ZBQ A;  2B7V A;  4KWY A;  5KL6 A;  1UHZ A;  2EPL X;  2ELY A;  3T1H E;  2UXD E;  4NHR A;  2E72 A;  2EOQ A;  1WRJ A;  4F6N A;  1X5W A;  2WBT A;  2YSO A;  4B3T E;  2J7J A;  1G2D C;  2L8T A;  4BHB A;  4F2J C;  1GQE A;  5AE3 A;  1X3C A;  5LLQ A;  1T38 A;  1IBL E;  2CTD A;  2ENC A;  2B3T B;  2LVH A;  2WBS A;  2NA2 A;  2L2K B;  1PJQ A;  4R03 A;  1A1L A;  2EPA A;  1TF3 A;  2EM4 A;  1X48 A;  4JI8 E;  1A1F A;  5KL3 A;  5KL2 A;  2G7H A;  3C6K A;  1X6E A;  3OML A;  4JI5 E;  1HR0 E;  4WSP A;  4LF4 E;  2EMF A;  4R2A A;  3J7A G;  1RMD A;  5IWA E;  2L92 A;  2EN6 A;  2LRS A;  2BBG A;  2YRM A;  3IWB A;  3ADJ A;  2EL5 A;  5IT9 C;  3VYX A;  4WPY A;  4DR7 E;  2EMI A;  2MC5 A;  3BID A;  1NCS A;  5DNY A;  4B3M E;  2EM5 A;  4BS9 A;  1AAY A;  4MLQ A;  2LMZ A;  4LF6 E;  2D9H A;  4KHP E;  2L2M A;  1T39 A;  1WHN A;  2VQE E;  1GZ6 A;  2EMA A;  4TUI A;  2RS6 A;  4O43 A;  2K7I A;  4BCA A;  5IV8 B;  2YRH A;  2B7T A;  2DGC A;  3K6Q A;  4F9A B;  4J8Z A;  2EMW A;  1TN9 A;  1N34 E;  2EM7 A;  3T1Y E;  4RHB B;  4LFC E;  3THN A;  2I9I A;  2LJH A;  3IWD A;  4LTY A;  2N8X A;  2MDR A;  2LT7 A;  3JAM C;  4R2D A;  2EE8 A;  5KL5 A;  2L33 A;  2EQ1 A;  3J7Y p;  4RH8 A;  4ZYE A;  2L3C A;  2RQL A;  3P1X A;  2JYA A;  4WYQ B;  1XNR E;  3F6H A;  4NXM E;  3LML A;  2GLI A;  2E5L E;  2EM8 A;  4OOG C;  4JI1 E;  4L8N A;  1N32 E;  4Q28 A;  1SFE A;  1RQ0 A;  2EPC A;  2EN1 A;  2HC5 A;  2RPC A;  2EMX A;  2WCC 3;  4BHC A;  4KZS A;  1DQ3 A;  1BBG A;  1PJT A;  2A25 A;  2EN8 A;  1ZBT A;  2V85 A;  3JU0 A;  4R8O A;  1P47 A;  2EPU A;  2JPA A;  4ZYG A;  2V83 A;  4DV6 E;  1Z1B A;  1YYO A;  4Q35 B;  2EOY A;  1IQO A;  2EMH A;  2YU5 A;  2NUF A;  2MKD A;  1XMO E;  2EL6 A;  2EPN A;  2YRK A;  5A6A A;  5LL6 R;  4GZN C;  1IMU A;  1YPN A;  4L5N C;  2CT1 A;  2ELZ A;  4N4R B;  1F2I G;  1UIL A;  3VK6 A;  2JOX A; 
#chains in the Genus database with same CATH homology
 4JI6 E;  1X48 A;  4JI8 E;  4JI3 E;  4BC9 A;  4DV3 E;  1RC7 A;  2H36 X;  5BR8 E;  3FIG A;  1XMQ E;  2RTX A;  2DB2 A;  1X47 A;  2G7H A;  1SR9 A;  2CPN A;  3HQ1 A;  2IHR 1;  1QU6 A;  2N3G A;  4F54 A;  4DR2 E;  3OML A;  2M7Q A;  2UUC E;  4X64 E;  4JI5 E;  1HR0 E;  4WSP A;  2L6M A;  4LF4 E;  4I8O A;  5ADZ A;  4YHH E;  3J7A G;  3HTX A;  4X65 E;  4GKJ E;  3MSW A;  4BBY A;  5IWA E;  3J80 C;  2UUA E;  2L92 A;  2KON A;  2LRS A;  2LTS A;  3IWB A;  5LMU E;  2VE7 C;  3ADJ A;  4DR3 E;  5IT9 C;  2UUB E;  2JWO A;  4WPY A;  3VYX A;  2FGG A;  2L2N A;  2MC5 A;  2N3H A;  4M30 A;  5AAS A;  5DNY A;  4BMJ A;  5A2Q C;  4TUG A;  3OTO E;  4DV5 E;  4B3M E;  1YZ9 A;  4BS9 A;  2NUG A;  4P7D A;  4GEQ B;  4F9C B;  3HXL A;  2LTR A;  3HPS A;  4M0V A;  3C4T A;  5F3W A;  1T4O A;  2LMZ A;  2KOU A;  4LF6 E;  1HNW E;  4JV5 E;  2VQF E;  4KHP E;  2L2M A;  3RMP A;  2RS7 A;  4DR6 E;  1X49 A;  1WHN A;  1YYK A;  2F4V E;  2VQE E;  2V88 A;  1GZ6 A;  4DUZ E;  4GKK E;  4TUI A;  1HNX E;  2JOB A;  4LU9 A;  2RS6 A;  4P78 A;  5LMN E;  2YT4 A;  1T4L B;  2JR1 A;  4BCA A;  4B3R E;  1J26 A;  1DI2 A;  4YY3 E;  2B7T A;  2EWL A;  2JVA A;  4JI0 E;  2ZM6 E;  4LF8 E;  3DJW A;  1YYW A;  2F8B A;  2M1S A;  2RSM A;  2V8Q B;  3JTZ A;  3K6Q A;  4J8Z A;  4F9A B;  4DUY E;  1N36 E;  2VF1 A;  3H09 A;  1J5E E;  1N34 E;  2E1M A;  4JI2 E;  2WZO A;  5CFF E;  3T1Y E;  3F6G A;  3KWR A;  3HPZ A;  1IBK E;  2MC6 A;  4LFC E;  2YZT A;  1XNQ E;  2DSY A;  4BC7 A;  4X62 E;  2L3J A;  4WFT A;  1IBM E;  1STU A;  2LJH A;  3IWD A;  5AE1 A;  4LTY A;  4X66 E;  4JYA E;  4DR1 E;  2MDR A;  4K0K E;  4DV0 E;  2DIX A;  2DMY A;  4DR4 E;  4F9B B;  3JAM C;  3IWC A;  4LF5 E;  2L33 A;  2M4I A;  3J7Y p;  2LBS B;  3ADG A;  3C4B A;  2LUP B;  2L3C A;  3ZOQ B;  3P1X A;  3ADI A;  4LFB E;  4AQY E;  4DKK A;  3ADL A;  1WXR A;  4WYQ B;  4X8W A;  2B9D A;  4DV4 E;  4OX9 E;  1XNR E;  2LE2 A;  1T4N A;  3AV0 A;  1O0W A;  3F6H A;  4NXM E;  3LML A;  2E5L E;  1PKP A;  3DF6 A;  4DMI A;  2HHH E;  4OOG C;  1ZBQ A;  2FV4 B;  1FJG E;  2B7V A;  2V89 A;  4L8N A;  2LUQ A;  4JI1 E;  5FLX C;  4Q28 A;  1N32 E;  1RQ0 A;  4NXN E;  4LFA E;  1UHZ A;  4DV7 E;  3LLH A;  2EZ6 A;  4KZS A;  1DQ3 A;  2V87 A;  3T1H E;  2UXD E;  2V86 A;  2UU9 E;  1I94 E;  1HNZ E;  1ZBT A;  2K4V A;  2V85 A;  3JU0 A;  4R8O A;  3J81 C;  4DV2 E;  1EKZ A;  2JY9 A;  4DR7 E;  4B3S E;  2ODR C;  2V83 A;  5T6J A;  4B3T E;  4DV1 E;  4LF9 E;  2NUE A;  1N33 E;  4DV6 E;  1FKA E;  1YYO A;  2L8T A;  1GQE A;  2ODR D;  5AE3 A;  4M2Z A;  3VYY A;  2NUF A;  4JI4 E;  1XMO E;  4DR5 E;  2UXB E;  5LL6 R;  2KHX A;  1IBL E;  4L5N C;  4LF7 E;  5AE2 A;  2UXC E;  2B3T B;  1WHQ A;  2FTX B;  2NA2 A;  3AUZ A;  4JI7 E;  2L2K B;  4R03 A;  1UIL A;  3VK6 A;  2JOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...