2YTIA

Solution structure of the c2h2 type zinc finger (region 564-596) of human zinc finger protein 347
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCNECGKVFTQNSHLARHRGIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 564-596) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytiA01
1G2FC 2YTFA 2WCC3 1BB8A 1A1JA 3EPHA 2WBUA 2EPCA 2DGCA 2CTDA 2LVHA 2RSIA 3M99B 1YSAC 1KJKA 2EMHA 2EM3A 2YTEA 4M9VC 2EE8A 3VHTB 2JP9A 1F2IG 2EM8A 2EMCA 2ENAA 1X5WA 4X9JA 4R2CA 2EMFA 1A1GA 2EOXA 1NCSA 2EM4A 1JK1A 2EMAA 4R2EA 2EMKA 4FK5C 1A1FA 2JPAA 1BBOA 2EN6A 2EPUA 2YTOA 2E72A 4WSGA 2EOFA 2YSOA 2ELYA 1WJPA 2LV2A 2EOMA 4R2QA 2D9HA 1RMDA 5KL5A 2J7JA 1X6FA 2EOQA 2EMBA 2GHFA 3MHSC 2EL4A 1JK2A 2EMIA 3EPLA 2EM7A 2NABA 2EQ0A 1ZU1A 2EL6A 2WBSA 2BB8A 1LLMC 1YUIA 2A25A 2EJ4A 2EL5A 2MKDA 1A1KA 2I13A 2M9AA 2EN7A 1ZR9A 5KL6A 2EN1A 2EOJA 2YRHA 2YTPA 2YU8A 2DLKA 2EPAA 4F6NA 2YTIA 1Z1BA 2DMIA 2R1FA 1UBDC 2EN4A 1X6HA 4R2AA 2EN8A 1DGCA 1TF6A 2YU5A 2EPPA 2ELZA 2EOHA 4F2JC 2EOZA 2YTQA 2EOSA 2EP3A 3UK3C 2DRPA 2EM9A 1YUJA 2EM2A 2EMWA 2YTGA 2MKNA 3EPKA 2DLQA 4IS1C 2EQ3A 2EM6A 2EM5A 2YRKA 2CSHA 4R2RA 5KL4A 2LT7A 2YTDA 1AAYA 2EPXA 2VRDA 2PRTA 1TN9A 2YTJA 1A1IA 2EQ1A 2EN2A 1A1LA 2YTNA 4R2SA 1P47A 1UN6B 1TF3A 2EN3A 2EOYA 3EPJA 1G2DC 2EOOA 2EMXA 2EPRA 2EORA 2YSPA 2YRMA 1X6EA 3MHHC 5KL3A 2ENHA 5KL2A 4R2PA 4F6MA 1ZAAC 2MDGA 4IJDA 1B69A 2EM0A 2ADRA 2EOIA 2GLIA 2LO3A 5KL7A 2RPCA 2HGHA 1A1HA 2CT1A 2EMYA 2WBTA 2EPZA 2LCEA 2EMGA 2EMLA 4R2DA 2EOEA 2ENCA 4GZNC 2EMZA 1X3CA 1MEYC
chains in the Genus database with same CATH superfamily
3BIDA 4NZVA 2B7VA 1G2FC 2YTFA 3KWRA 2WCC3 3EPHA 3JU0A 3ECRA 4X64E 1GQEA 2EMHA 2YTEA 1HR0E 2EMCA 1X49A 2VF1A 4R2CA 3HQ1A 4P78A 1IMUA 2EMAA 3OTOE 4KHPE 4GKKE 2EN6A 1X48A 2YTOA 4L5NC 2E72A 4DV6E 4DR7E 2MC6A 4DV3E 2DMYA 1IBLE 2JOXA 4R2QA 2D9HA 4JI8E 2GPIA 2J7JA 2EPMX 4LF5E 4B3SE 5A6KA 2GHFA 3MHSC 2L3JA 1YYWA 4B3TE 2EQ0A 5LLQA 2A25A 2KONA 4M0VA 1A1KA 5AASA 4OOGC 4M30A 5AE2A 1ZBTA 2NUEA 1XMOE 4ZYDA 5A69A 2YU8A 2L2KB 2DLKA 2L2NA 1J5EE 5IWAE 2FGGA 2JYAA 1SR9A 1YYOA 1X6HA 4F9CB 2EN8A 4JI0E 5BR8E 2JY9A 2K4VA 4F2JC 3P1XA 2EP3A 1IBKE 1XNQE 2YZTA 2YTGA 3T1YE 1YYKA 3LMLA 2EQ3A 2EM5A 2EZ6A 4R2RA 1T4OA 2YTDA 2LT7A 2EPXA 4LF8E 2YWQA 1IQSA 3KZZA 1ZBQA 4WXCA 2EN3A 2WZOA 2EPRA 2YRMA 1ZAAC 2LUPB 2ENHA 3HPSA 2V83A 5KL2A 4R2PA 2MDGA 4F6MA 4BBYA 1XMQE 4X66E 1B69A 1IQOA 4X62E 1SFEA 2L2MA 1O0WA 2L6MA 4X8WA 1XNRE 4DR5E 2CT1A 4DV2E 4M2ZA 2EMYA 5A6BD 2N3GA 5LL6R 1BBGA 2EMGA 2EMLA 2V8QB 1FJGE 2EOEA 2ENCA 4GZNC 3C4TA 4JI1E 1KJKA 4JI4E 3J81C 4LF6E 1PJTA 2YT4A 1BB8A 1PJQA 5CFFE 1WHQA 2CTDA 2LVHA 4YHHE 2RSIA 4L8NA 3M99B 4HEIA 3BF2A 2EM3A 2LE2A 2VE7C 2R76A 1RQ0A 2V88A 2EM8A 4WYQB 4RH8A 2ENAA 4X9JA 4GKJE 2EMFA 2V87A 1A1GA 2EOXA 1NCSA 2EM4A 4Q35B 1JK1A 1T4NA 2EMKA 1A1FA 4HTGA 4JI7E 4WFTA 3RMPA 2UUAE 4I8OA 2VQEE 1N34E 2YSOA 2LV2A 4WPYA 4F54A 2ODRC 2EOMA 3VYXA 2N3HA 2F4VE 3AUZA 4O43A 5IT9C 4DUZE 2EMBA 1JK2A 1EH6A 2FV4B 1YZ9A 1PKPA 1ZU1A 4O24A 3H09A 2I13A 2EJ4A 3J7Yp 4BCAA 2M9AA 3THNA 5KL6A 3KZYA 4BC7A 4J8ZA 2EOJA 3MSWA 1AH5A 2UXBE 1RC7A 2EPAA 1WXRA 2DMIA 1NEIA 1UBDC 5DNYA 3L00A 4R2AA 1TF6A 2JWOA 2L8TA 2EPPA 4YY3E 3UK3C 2DRPA 4O5GA 2E5LE 1I94E 2CSHA 4N4RB 1N33E 4X65E 5KL4A 3HPZA 3J80C 1AAYA 2VRDA 3BGHA 3F6GA 1TN9A 1A1IA 2EN2A 2DIXA 3DJWA 1YFHA 1L4SA 1A1LA 3C6KA 4R2SA 3VYYA 2LJUA 3K6QA 2N8XA 1TF3A 4DV1E 5ADZA 2EOOA 4B3ME 2EMXA 1UILA 4JI2E 1GTKA 1X6EA 3MHHC 4RHBB 4LF4E 5A6BA 3ZOQB 2RS7A 2EOIA 1J26A 5KL7A 2UUCE 2RPCA 2CPNA 4DV0E 4P7DA 2B3TB 3JAMC 4BHBA 4WX9A 2ODRD 4LU9A 2NUFA 4WSPA 4ZYEA 3ADIA 2EMZA 4JI5E 4ZYHA 1IBME 4LFBE 2EPNA 1A1JA 2DGCA 2VQFE 4DV5E 3EQ1A 5LMUE 4MLVA 2M1SA 4R8OA 3HXLA 4BS9A 2EE8A 1T38A 4JV5E 5T6JA 4DV4E 1STUA 4O4KA 2F8BA 2I9IA 4R2EA 4FK5C 4WXDA 4BC9A 1WHNA 2LTSA 2L33A 2EOFA 5AC5A 2ELYA 4LFCE 2YPNA 4ZYGA 4DR1E 5KL5A 5AE1A 1FKAE 2EOQA 2EMIA 4AQYE 1WRJA 3JTZA 4JYAE 2EM7A 2EPOA 2NABA 3IWCA 2BB8A 1YUIA 2Q8UA 2EL5A 4KZSA 5IXMB 2EPKX 2EPLX 2EN7A 2EN1A 2E1MA 1N32E 4F6NA 1Z1BA 1T39A 4DR6E 1DI2A 4NXME 3OMLA 5IV8B 1DGCA 2ZM6E 2ELZA 2RQLA 2EOZA 2YTQA 2EM9A 2H36X 2UU9E 3EPKA 2DLQA 4IS1C 2YRKA 1PDAA 3BBGA 2EWLA 2LJHA 3DF6A 2PRTA 4R03A 5FLXC 2YTJA 5F3WA 1EH7A 5LMNE 4Q28A 1P47A 3C4BA 2M7QA 3EPJA 2EOYA 2EORA 5KL3A 2L92A 4TUIA 3T1HE 4LFAE 2EM0A 1GZ6A 4MLQA 2ADRA 2LRSA 4LF9E 2HC5A 5AC4A 2V89A 4DV7E 1EKZA 1A1HA 4GEQB 3LLHA 2WBTA 4DR2E 3F6HA 2EPZA 2LCEA 2HJJA 1N36E 2UUBE 3IWBA 4NXNE 1UN6B 1X3CA 1MEYC 2JR1A 4F9AB 2JXPA 3FIGA 2NA2A 2KHXA 2WBUA 4DR3E 2EPCA 1YSAC 2B7TA 2BBGA 4NHRA 4M9VC 4LF7E 3VHTB 1N3GA 1F2IG 2JP9A 2DSYA 2L3CA 1X5WA 3THOB 1KYQA 1X47A 2JPAA 5A2QC 1BBOA 2EPUA 2RS6A 4WSGA 1QNTA 1QU6A 2NUGA 1WJPA 2UXCE 2K7IA 4DKKA 1RMDA 4JI3E 3ADGA 1X6FA 2DB2A 1HNXE 2EL4A 4K0KE 3AV0A 2B9DA 3EPLA 2MDRA 4OX9E 5TSEA 3HTXA 2RTXA 2EL6A 2WBSA 3ADLA 1LLMC 1T4LB 4DR4E 2MKDA 3ADJA 4JI6E 1EH8A 1ZR9A 2FTXB 2G7HA 1DQ3A 4LTYA 2LUQA 2YRHA 2YTPA 2LMZA 2YTIA 2MC5A 2V85A 3TQMA 2R1FA 4DUYE 5AE3A 5A6JA 2EN4A 2JOBA 2YU5A 2M4IA 2EOHA 2EOSA 1YUJA 1MGTA 2EM2A 2EMWA 2IHR1 2V86A 2MKNA 4BMJA 4F9BB 2EM6A 3QG5C 1HNWE 2JVAA 1UHZA 1PJSA 4KWYA 3IWDA 2EQ1A 2UXDE 2YTNA 4DMIA 1G2DC 2LBSB 2RSMA 2YSPA 2HHHE 4BHCA 3J7AG 4TUGA 3VK6A 4IJDA 5A6AA 1YPNA 2GLIA 2LO3A 1HNZE 2HGHA 3C6MA 2LTRA 4R2DA 4B3RE 2KOUA
chains in the Genus database with same CATH topology
1G2FC 2YTFA 2WCC3 1BB8A 1A1JA 3EPHA 2WBUA 2EPCA 2DGCA 2CTDA 2LVHA 2RSIA 3M99B 1YSAC 1KJKA 2EMHA 2EM3A 2YTEA 4M9VC 2EE8A 3VHTB 2JP9A 1F2IG 2EM8A 2EMCA 2ENAA 1X5WA 4X9JA 4R2CA 2EMFA 1A1GA 2EOXA 1NCSA 2EM4A 1JK1A 2EMAA 4R2EA 2EMKA 4FK5C 1A1FA 2JPAA 1BBOA 2EN6A 2EPUA 2YTOA 2E72A 4WSGA 2EOFA 2YSOA 2ELYA 1WJPA 2LV2A 2EOMA 4R2QA 2D9HA 1RMDA 5KL5A 2J7JA 1X6FA 2EOQA 2EMBA 2GHFA 3MHSC 2EL4A 1JK2A 2EMIA 3EPLA 2EM7A 2NABA 2EQ0A 1ZU1A 2EL6A 2WBSA 2BB8A 1LLMC 1YUIA 2A25A 2EJ4A 2EL5A 2MKDA 1A1KA 2I13A 2M9AA 2EN7A 1ZR9A 5KL6A 2EN1A 2EOJA 2YRHA 2YTPA 2YU8A 2DLKA 2EPAA 4F6NA 2YTIA 1Z1BA 2DMIA 2R1FA 1UBDC 2EN4A 1X6HA 4R2AA 2EN8A 1DGCA 1TF6A 2YU5A 2EPPA 2ELZA 2EOHA 4F2JC 2EOZA 2YTQA 2EOSA 2EP3A 3UK3C 2DRPA 2EM9A 1YUJA 2EM2A 2EMWA 2YTGA 2MKNA 3EPKA 2DLQA 4IS1C 2EQ3A 2EM6A 2EM5A 2YRKA 2CSHA 4R2RA 5KL4A 2LT7A 2YTDA 1AAYA 2EPXA 2VRDA 2PRTA 1TN9A 2YTJA 1A1IA 2EQ1A 2EN2A 1A1LA 2YTNA 4R2SA 1P47A 1UN6B 1TF3A 2EN3A 2EOYA 3EPJA 1G2DC 2EOOA 2EMXA 2EPRA 2EORA 2YSPA 2YRMA 1X6EA 3MHHC 5KL3A 2ENHA 5KL2A 4R2PA 4F6MA 1ZAAC 2MDGA 4IJDA 1B69A 2EM0A 2ADRA 2EOIA 2GLIA 2LO3A 5KL7A 2RPCA 2HGHA 1A1HA 2CT1A 2EMYA 2WBTA 2EPZA 2LCEA 2EMGA 2EMLA 4R2DA 2EOEA 2ENCA 4GZNC 2EMZA 1X3CA 1MEYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2F C;  2YTF A;  2WCC 3;  1BB8 A;  1A1J A;  3EPH A;  2WBU A;  2EPC A;  2DGC A;  2CTD A;  2LVH A;  2RSI A;  3M99 B;  1YSA C;  1KJK A;  2EMH A;  2EM3 A;  2YTE A;  4M9V C;  2EE8 A;  3VHT B;  2JP9 A;  1F2I G;  2EM8 A;  2EMC A;  2ENA A;  1X5W A;  4X9J A;  4R2C A;  2EMF A;  1A1G A;  2EOX A;  1NCS A;  2EM4 A;  1JK1 A;  2EMA A;  4R2E A;  2EMK A;  4FK5 C;  1A1F A;  2JPA A;  1BBO A;  2EN6 A;  2EPU A;  2YTO A;  2E72 A;  4WSG A;  2EOF A;  2YSO A;  2ELY A;  1WJP A;  2LV2 A;  2EOM A;  4R2Q A;  2D9H A;  1RMD A;  5KL5 A;  2J7J A;  1X6F A;  2EOQ A;  2EMB A;  2GHF A;  3MHS C;  2EL4 A;  1JK2 A;  2EMI A;  3EPL A;  2EM7 A;  2NAB A;  2EQ0 A;  1ZU1 A;  2EL6 A;  2WBS A;  2BB8 A;  1LLM C;  1YUI A;  2A25 A;  2EJ4 A;  2EL5 A;  2MKD A;  1A1K A;  2I13 A;  2M9A A;  2EN7 A;  1ZR9 A;  5KL6 A;  2EN1 A;  2EOJ A;  2YRH A;  2YTP A;  2YU8 A;  2DLK A;  2EPA A;  4F6N A;  2YTI A;  1Z1B A;  2DMI A;  2R1F A;  1UBD C;  2EN4 A;  1X6H A;  4R2A A;  2EN8 A;  1DGC A;  1TF6 A;  2YU5 A;  2EPP A;  2ELZ A;  2EOH A;  4F2J C;  2EOZ A;  2YTQ A;  2EOS A;  2EP3 A;  3UK3 C;  2DRP A;  2EM9 A;  1YUJ A;  2EM2 A;  2EMW A;  2YTG A;  2MKN A;  3EPK A;  2DLQ A;  4IS1 C;  2EQ3 A;  2EM6 A;  2EM5 A;  2YRK A;  2CSH A;  4R2R A;  5KL4 A;  2LT7 A;  2YTD A;  1AAY A;  2EPX A;  2VRD A;  2PRT A;  1TN9 A;  2YTJ A;  1A1I A;  2EQ1 A;  2EN2 A;  1A1L A;  2YTN A;  4R2S A;  1P47 A;  1UN6 B;  1TF3 A;  2EN3 A;  2EOY A;  3EPJ A;  1G2D C;  2EOO A;  2EMX A;  2EPR A;  2EOR A;  2YSP A;  2YRM A;  1X6E A;  3MHH C;  5KL3 A;  2ENH A;  5KL2 A;  4R2P A;  4F6M A;  1ZAA C;  2MDG A;  4IJD A;  1B69 A;  2EM0 A;  2ADR A;  2EOI A;  2GLI A;  2LO3 A;  5KL7 A;  2RPC A;  2HGH A;  1A1H A;  2CT1 A;  2EMY A;  2WBT A;  2EPZ A;  2LCE A;  2EMG A;  2EML A;  4R2D A;  2EOE A;  2ENC A;  4GZN C;  2EMZ A;  1X3C A;  1MEY C; 
#chains in the Genus database with same CATH topology
 3BID A;  4NZV A;  2B7V A;  1G2F C;  2YTF A;  3KWR A;  2WCC 3;  3EPH A;  3JU0 A;  3ECR A;  4X64 E;  1GQE A;  2EMH A;  2YTE A;  1HR0 E;  2EMC A;  1X49 A;  2VF1 A;  4R2C A;  3HQ1 A;  4P78 A;  1IMU A;  2EMA A;  3OTO E;  4KHP E;  4GKK E;  2EN6 A;  1X48 A;  2YTO A;  4L5N C;  2E72 A;  4DV6 E;  4DR7 E;  2MC6 A;  4DV3 E;  2DMY A;  1IBL E;  2JOX A;  4R2Q A;  2D9H A;  4JI8 E;  2GPI A;  2J7J A;  2EPM X;  4LF5 E;  4B3S E;  5A6K A;  2GHF A;  3MHS C;  2L3J A;  1YYW A;  4B3T E;  2EQ0 A;  5LLQ A;  2A25 A;  2KON A;  4M0V A;  1A1K A;  5AAS A;  4OOG C;  4M30 A;  5AE2 A;  1ZBT A;  2NUE A;  1XMO E;  4ZYD A;  5A69 A;  2YU8 A;  2L2K B;  2DLK A;  2L2N A;  1J5E E;  5IWA E;  2FGG A;  2JYA A;  1SR9 A;  1YYO A;  1X6H A;  4F9C B;  2EN8 A;  4JI0 E;  5BR8 E;  2JY9 A;  2K4V A;  4F2J C;  3P1X A;  2EP3 A;  1IBK E;  1XNQ E;  2YZT A;  2YTG A;  3T1Y E;  1YYK A;  3LML A;  2EQ3 A;  2EM5 A;  2EZ6 A;  4R2R A;  1T4O A;  2YTD A;  2LT7 A;  2EPX A;  4LF8 E;  2YWQ A;  1IQS A;  3KZZ A;  1ZBQ A;  4WXC A;  2EN3 A;  2WZO A;  2EPR A;  2YRM A;  1ZAA C;  2LUP B;  2ENH A;  3HPS A;  2V83 A;  5KL2 A;  4R2P A;  2MDG A;  4F6M A;  4BBY A;  1XMQ E;  4X66 E;  1B69 A;  1IQO A;  4X62 E;  1SFE A;  2L2M A;  1O0W A;  2L6M A;  4X8W A;  1XNR E;  4DR5 E;  2CT1 A;  4DV2 E;  4M2Z A;  2EMY A;  5A6B D;  2N3G A;  5LL6 R;  1BBG A;  2EMG A;  2EML A;  2V8Q B;  1FJG E;  2EOE A;  2ENC A;  4GZN C;  3C4T A;  4JI1 E;  1KJK A;  4JI4 E;  3J81 C;  4LF6 E;  1PJT A;  2YT4 A;  1BB8 A;  1PJQ A;  5CFF E;  1WHQ A;  2CTD A;  2LVH A;  4YHH E;  2RSI A;  4L8N A;  3M99 B;  4HEI A;  3BF2 A;  2EM3 A;  2LE2 A;  2VE7 C;  2R76 A;  1RQ0 A;  2V88 A;  2EM8 A;  4WYQ B;  4RH8 A;  2ENA A;  4X9J A;  4GKJ E;  2EMF A;  2V87 A;  1A1G A;  2EOX A;  1NCS A;  2EM4 A;  4Q35 B;  1JK1 A;  1T4N A;  2EMK A;  1A1F A;  4HTG A;  4JI7 E;  4WFT A;  3RMP A;  2UUA E;  4I8O A;  2VQE E;  1N34 E;  2YSO A;  2LV2 A;  4WPY A;  4F54 A;  2ODR C;  2EOM A;  3VYX A;  2N3H A;  2F4V E;  3AUZ A;  4O43 A;  5IT9 C;  4DUZ E;  2EMB A;  1JK2 A;  1EH6 A;  2FV4 B;  1YZ9 A;  1PKP A;  1ZU1 A;  4O24 A;  3H09 A;  2I13 A;  2EJ4 A;  3J7Y p;  4BCA A;  2M9A A;  3THN A;  5KL6 A;  3KZY A;  4BC7 A;  4J8Z A;  2EOJ A;  3MSW A;  1AH5 A;  2UXB E;  1RC7 A;  2EPA A;  1WXR A;  2DMI A;  1NEI A;  1UBD C;  5DNY A;  3L00 A;  4R2A A;  1TF6 A;  2JWO A;  2L8T A;  2EPP A;  4YY3 E;  3UK3 C;  2DRP A;  4O5G A;  2E5L E;  1I94 E;  2CSH A;  4N4R B;  1N33 E;  4X65 E;  5KL4 A;  3HPZ A;  3J80 C;  1AAY A;  2VRD A;  3BGH A;  3F6G A;  1TN9 A;  1A1I A;  2EN2 A;  2DIX A;  3DJW A;  1YFH A;  1L4S A;  1A1L A;  3C6K A;  4R2S A;  3VYY A;  2LJU A;  3K6Q A;  2N8X A;  1TF3 A;  4DV1 E;  5ADZ A;  2EOO A;  4B3M E;  2EMX A;  1UIL A;  4JI2 E;  1GTK A;  1X6E A;  3MHH C;  4RHB B;  4LF4 E;  5A6B A;  3ZOQ B;  2RS7 A;  2EOI A;  1J26 A;  5KL7 A;  2UUC E;  2RPC A;  2CPN A;  4DV0 E;  4P7D A;  2B3T B;  3JAM C;  4BHB A;  4WX9 A;  2ODR D;  4LU9 A;  2NUF A;  4WSP A;  4ZYE A;  3ADI A;  2EMZ A;  4JI5 E;  4ZYH A;  1IBM E;  4LFB E;  2EPN A;  1A1J A;  2DGC A;  2VQF E;  4DV5 E;  3EQ1 A;  5LMU E;  4MLV A;  2M1S A;  4R8O A;  3HXL A;  4BS9 A;  2EE8 A;  1T38 A;  4JV5 E;  5T6J A;  4DV4 E;  1STU A;  4O4K A;  2F8B A;  2I9I A;  4R2E A;  4FK5 C;  4WXD A;  4BC9 A;  1WHN A;  2LTS A;  2L33 A;  2EOF A;  5AC5 A;  2ELY A;  4LFC E;  2YPN A;  4ZYG A;  4DR1 E;  5KL5 A;  5AE1 A;  1FKA E;  2EOQ A;  2EMI A;  4AQY E;  1WRJ A;  3JTZ A;  4JYA E;  2EM7 A;  2EPO A;  2NAB A;  3IWC A;  2BB8 A;  1YUI A;  2Q8U A;  2EL5 A;  4KZS A;  5IXM B;  2EPK X;  2EPL X;  2EN7 A;  2EN1 A;  2E1M A;  1N32 E;  4F6N A;  1Z1B A;  1T39 A;  4DR6 E;  1DI2 A;  4NXM E;  3OML A;  5IV8 B;  1DGC A;  2ZM6 E;  2ELZ A;  2RQL A;  2EOZ A;  2YTQ A;  2EM9 A;  2H36 X;  2UU9 E;  3EPK A;  2DLQ A;  4IS1 C;  2YRK A;  1PDA A;  3BBG A;  2EWL A;  2LJH A;  3DF6 A;  2PRT A;  4R03 A;  5FLX C;  2YTJ A;  5F3W A;  1EH7 A;  5LMN E;  4Q28 A;  1P47 A;  3C4B A;  2M7Q A;  3EPJ A;  2EOY A;  2EOR A;  5KL3 A;  2L92 A;  4TUI A;  3T1H E;  4LFA E;  2EM0 A;  1GZ6 A;  4MLQ A;  2ADR A;  2LRS A;  4LF9 E;  2HC5 A;  5AC4 A;  2V89 A;  4DV7 E;  1EKZ A;  1A1H A;  4GEQ B;  3LLH A;  2WBT A;  4DR2 E;  3F6H A;  2EPZ A;  2LCE A;  2HJJ A;  1N36 E;  2UUB E;  3IWB A;  4NXN E;  1UN6 B;  1X3C A;  1MEY C;  2JR1 A;  4F9A B;  2JXP A;  3FIG A;  2NA2 A;  2KHX A;  2WBU A;  4DR3 E;  2EPC A;  1YSA C;  2B7T A;  2BBG A;  4NHR A;  4M9V C;  4LF7 E;  3VHT B;  1N3G A;  1F2I G;  2JP9 A;  2DSY A;  2L3C A;  1X5W A;  3THO B;  1KYQ A;  1X47 A;  2JPA A;  5A2Q C;  1BBO A;  2EPU A;  2RS6 A;  4WSG A;  1QNT A;  1QU6 A;  2NUG A;  1WJP A;  2UXC E;  2K7I A;  4DKK A;  1RMD A;  4JI3 E;  3ADG A;  1X6F A;  2DB2 A;  1HNX E;  2EL4 A;  4K0K E;  3AV0 A;  2B9D A;  3EPL A;  2MDR A;  4OX9 E;  5TSE A;  3HTX A;  2RTX A;  2EL6 A;  2WBS A;  3ADL A;  1LLM C;  1T4L B;  4DR4 E;  2MKD A;  3ADJ A;  4JI6 E;  1EH8 A;  1ZR9 A;  2FTX B;  2G7H A;  1DQ3 A;  4LTY A;  2LUQ A;  2YRH A;  2YTP A;  2LMZ A;  2YTI A;  2MC5 A;  2V85 A;  3TQM A;  2R1F A;  4DUY E;  5AE3 A;  5A6J A;  2EN4 A;  2JOB A;  2YU5 A;  2M4I A;  2EOH A;  2EOS A;  1YUJ A;  1MGT A;  2EM2 A;  2EMW A;  2IHR 1;  2V86 A;  2MKN A;  4BMJ A;  4F9B B;  2EM6 A;  3QG5 C;  1HNW E;  2JVA A;  1UHZ A;  1PJS A;  4KWY A;  3IWD A;  2EQ1 A;  2UXD E;  2YTN A;  4DMI A;  1G2D C;  2LBS B;  2RSM A;  2YSP A;  2HHH E;  4BHC A;  3J7A G;  4TUG A;  3VK6 A;  4IJD A;  5A6A A;  1YPN A;  2GLI A;  2LO3 A;  1HNZ E;  2HGH A;  3C6M A;  2LTR A;  4R2D A;  4B3R E;  2KOU A; 
#chains in the Genus database with same CATH homology
 1G2F C;  2YTF A;  2WCC 3;  1BB8 A;  1A1J A;  3EPH A;  2WBU A;  2EPC A;  2DGC A;  2CTD A;  2LVH A;  2RSI A;  3M99 B;  1YSA C;  1KJK A;  2EMH A;  2EM3 A;  2YTE A;  4M9V C;  2EE8 A;  3VHT B;  2JP9 A;  1F2I G;  2EM8 A;  2EMC A;  2ENA A;  1X5W A;  4X9J A;  4R2C A;  2EMF A;  1A1G A;  2EOX A;  1NCS A;  2EM4 A;  1JK1 A;  2EMA A;  4R2E A;  2EMK A;  4FK5 C;  1A1F A;  2JPA A;  1BBO A;  2EN6 A;  2EPU A;  2YTO A;  2E72 A;  4WSG A;  2EOF A;  2YSO A;  2ELY A;  1WJP A;  2LV2 A;  2EOM A;  4R2Q A;  2D9H A;  1RMD A;  5KL5 A;  2J7J A;  1X6F A;  2EOQ A;  2EMB A;  2GHF A;  3MHS C;  2EL4 A;  1JK2 A;  2EMI A;  3EPL A;  2EM7 A;  2NAB A;  2EQ0 A;  1ZU1 A;  2EL6 A;  2WBS A;  2BB8 A;  1LLM C;  1YUI A;  2A25 A;  2EJ4 A;  2EL5 A;  2MKD A;  1A1K A;  2I13 A;  2M9A A;  2EN7 A;  1ZR9 A;  5KL6 A;  2EN1 A;  2EOJ A;  2YRH A;  2YTP A;  2YU8 A;  2DLK A;  2EPA A;  4F6N A;  2YTI A;  1Z1B A;  2DMI A;  2R1F A;  1UBD C;  2EN4 A;  1X6H A;  4R2A A;  2EN8 A;  1DGC A;  1TF6 A;  2YU5 A;  2EPP A;  2ELZ A;  2EOH A;  4F2J C;  2EOZ A;  2YTQ A;  2EOS A;  2EP3 A;  3UK3 C;  2DRP A;  2EM9 A;  1YUJ A;  2EM2 A;  2EMW A;  2YTG A;  2MKN A;  3EPK A;  2DLQ A;  4IS1 C;  2EQ3 A;  2EM6 A;  2EM5 A;  2YRK A;  2CSH A;  4R2R A;  5KL4 A;  2LT7 A;  2YTD A;  1AAY A;  2EPX A;  2VRD A;  2PRT A;  1TN9 A;  2YTJ A;  1A1I A;  2EQ1 A;  2EN2 A;  1A1L A;  2YTN A;  4R2S A;  1P47 A;  1UN6 B;  1TF3 A;  2EN3 A;  2EOY A;  3EPJ A;  1G2D C;  2EOO A;  2EMX A;  2EPR A;  2EOR A;  2YSP A;  2YRM A;  1X6E A;  3MHH C;  5KL3 A;  2ENH A;  5KL2 A;  4R2P A;  4F6M A;  1ZAA C;  2MDG A;  4IJD A;  1B69 A;  2EM0 A;  2ADR A;  2EOI A;  2GLI A;  2LO3 A;  5KL7 A;  2RPC A;  2HGH A;  1A1H A;  2CT1 A;  2EMY A;  2WBT A;  2EPZ A;  2LCE A;  2EMG A;  2EML A;  4R2D A;  2EOE A;  2ENC A;  4GZN C;  2EMZ A;  1X3C A;  1MEY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...