2YTIA

Solution structure of the c2h2 type zinc finger (region 564-596) of human zinc finger protein 347
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCNECGKVFTQNSHLARHRGIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 564-596) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytiA01
2EOQA 2EPAA 2EMZA 5KL6A 1YUIA 2EORA 5KL5A 4R2AA 1JK1A 2DMIA 1A1HA 2EL5A 1F2IG 1TN9A 2EN8A 4M9VC 2EMXA 2LCEA 2YTIA 2CSHA 2J7JA 2YTNA 2EM4A 1A1LA 4X9JA 2EM2A 2EMAA 2EPXA 2M9AA 5KL2A 2MKDA 2EPRA 1BB8A 2EOIA 2NABA 2LT7A 1NCSA 2EM8A 1ZR9A 2EOMA 1UBDC 3EPJA 1AAYA 2D9HA 2WCC3 3UK3C 1TF3A 1X6EA 2E72A 2JP9A 2ENCA 2EL6A 2YSOA 2EN4A 2EOOA 2JPAA 1DGCA 2EM0A 2EPUA 3EPLA 1JK2A 2YTJA 2YSPA 2LVHA 1A1FA 2MKNA 2ADRA 2EPCA 2GHFA 1BBOA 4WSGA 2A25A 2EM5A 2EE8A 2BB8A 4R2EA 4R2SA 2EL4A 2EMGA 2DLKA 2CTDA 2YTPA 1A1GA 3MHSC 2EMFA 4R2RA 1LLMC 2LO3A 1TF6A 4FK5C 3EPHA 1Z1BA 2YRMA 2ELZA 1ZAAC 2EMBA 4R2CA 2EMIA 2YRHA 3MHHC 1ZU1A 2EPZA 1YUJA 1RMDA 4IJDA 2YTEA 1X3CA 2EN2A 2EN1A 2EOHA 2RSIA 2WBTA 2EMKA 1UN6B 2EOXA 2YU8A 5KL4A 2EMWA 2EOSA 2GLIA 1G2FC 4R2QA 2EMYA 1KJKA 2LV2A 3VHTB 1A1KA 2DGCA 2YU5A 1YSAC 1MEYC 2RPCA 2YTDA 2EN7A 4F6NA 2PRTA 2VRDA 2EOFA 2EM9A 2YTFA 4R2DA 1P47A 2EQ1A 2EMCA 2EQ3A 2YTGA 2DLQA 2YTOA 3EPKA 1A1IA 2EN6A 1X5WA 2ENAA 5KL3A 1X6HA 2DRPA 4R2PA 2YTQA 1X6FA 1G2DC 2ENHA 2EN3A 4IS1C 4GZNC 2YRKA 2EPPA 2CT1A 5KL7A 2EMHA 2I13A 1WJPA 4F6MA 1B69A 2EJ4A 2R1FA 2ELYA 2EM3A 2EOJA 2EQ0A 2WBUA 2EOEA 2EOYA 2EP3A 1A1JA 2EM6A 3M99B 2HGHA 2WBSA 2EOZA 2EM7A 2EMLA 4F2JC 2MDGA
chains in the Genus database with same CATH superfamily
2L2MA 2G7HA 1T4NA 1YUIA 2M1SA 5KL5A 1X49A 4NZVA 1A1HA 3J7Yp 4X65E 4DR5E 2EN8A 4LF9E 4JI5E 4Q28A 2CSHA 4X9JA 2EMAA 2EPXA 2EOIA 1HR0E 1UBDC 4X62E 1AAYA 4F54A 4B3ME 1X6EA 3MSWA 1XNRE 5A69A 1ZBQA 3BIDA 4KWYA 3L00A 1WXRA 1J26A 1N33E 1N3GA 2YSPA 5AASA 1A1FA 2ADRA 4KHPE 2JYAA 2EM5A 4LF7E 2BB8A 3C4TA 1ZBTA 4R2SA 5IT9C 4DV1E 4WX9A 3MHSC 2K7IA 1LLMC 3JTZA 5DNYA 3IWCA 2B3TB 2UXBE 3VYXA 1EH6A 2EMIA 2N3HA 1YUJA 2UXDE 4WXDA 2JXPA 4JI3E 2EN2A 2RSIA 2NUEA 3VK6A 2EOXA 2YU8A 3FIGA 2EMYA 3F6HA 2LV2A 4WSPA 3C4BA 1T4LB 1IQOA 1MEYC 4GKJE 2EOFA 1YYKA 1P47A 1J5EE 1N34E 4BBYA 1GTKA 3EPKA 2ENAA 5AC4A 1SR9A 4O5GA 4O4KA 2ENHA 5A6AA 2CT1A 2LTRA 2I13A 2KHXA 2M7QA 2EM3A 2VQEE 2EOEA 2RQLA 1HNZE 1A1JA 2VE7C 2EM6A 2UU9E 1WRJA 2EOZA 1QNTA 4DR6E 4F2JC 1KJKA 2EOQA 4M30A 3T1HE 2EORA 2DIXA 2DMIA 1F2IG 1T38A 2V8QB 2DMYA 2L8TA 2YTIA 2YWQA 3C6KA 2EM2A 4JI0E 2MKDA 2EPRA 1BB8A 2NABA 2EM8A 5F3WA 1PDAA 2EOMA 4LF6E 2JOXA 3KZZA 3EPJA 2D9HA 3UK3C 1TF3A 2GPIA 2EL6A 2B7TA 3BBGA 4GEQB 5FLXC 2EM0A 3BF2A 2EPUA 1JK2A 1IBLE 1YPNA 3OMLA 2LVHA 4Q35B 2EPOA 5IXMB 4LTYA 2L2KB 2EPCA 1BBOA 3THOB 1BBGA 4ZYEA 1NEIA 4DR1E 1DQ3A 2MDRA 4DUYE 2EL4A 2LJHA 3HQ1A 2K4VA 4YY3E 2L3JA 4R2RA 1IMUA 5A6BD 1ZAAC 4F9CB 5IV8B 4RHBB 3MHHC 2LJUA 5A6BA 1XMOE 1RMDA 2YPNA 2YTEA 2UUBE 1X3CA 2EOHA 1HNXE 2FGGA 5LLQA 2FV4B 4LFAE 2HJJA 4ZYDA 2HHHE 2VF1A 2YT4A 2GLIA 5LL6R 4R2QA 3KWRA 1HNWE 3ADIA 3IWBA 4ZYGA 2YZTA 3HPSA 2PRTA 2VRDA 4N4RB 4NXME 2RSMA 5BR8E 4DR3E 3VYYA 2YTFA 4R2DA 4DKKA 2Q8UA 4LFBE 2EQ1A 4DR2E 3HPZA 2EQ3A 2V85A 2DLQA 4BHCA 4DR4E 5TSEA 2YTOA 2JY9A 4DV3E 4JI2E 1X6FA 3LMLA 1FJGE 3EQ1A 4B3RE 4IS1C 1XMQE 2V87A 1GQEA 3HTXA 2EMHA 1DI2A 3KZYA 4F6MA 1YFHA 4LF4E 2ELYA 2EOJA 1WHQA 4P7DA 2EMLA 1IBME 4NXNE 2FTXB 4TUIA 4LF5E 4R8OA 1MGTA 2EMZA 5KL6A 4WYQB 2L2NA 4R2AA 1JK1A 1L4SA 4P78A 2EL5A 1TN9A 2IHR1 2E5LE 1EH7A 2LUPB 1EKZA 2EMXA 4AQYE 2LCEA 1PJTA 2J7JA 2YTNA 2L33A 4MLVA 4BS9A 5KL2A 4DV0E 4ZYHA 4X64E 1NCSA 1ZR9A 1RQ0A 2EPKX 2WCC3 1STUA 4X8WA 2E72A 2JP9A 2UXCE 2B9DA 1UILA 2YSOA 2EN4A 2EOOA 4J8ZA 1PJSA 1DGCA 2RS6A 3EPLA 2HC5A 1EH8A 1YZ9A 2NA2A 5LMUE 1XNQE 2VQFE 3OTOE 2GHFA 4WSGA 5IWAE 3AV0A 2BBGA 4L8NA 2L6MA 1X47A 4DUZE 4DV4E 2YTPA 1A1GA 4F9AB 5A6JA 5CFFE 5T6JA 2LO3A 4B3TE 1PJQA 4FK5C 3EPHA 1SFEA 2YRMA 4B3SE 3TQMA 2EPNA 2EMBA 4O43A 4R2CA 2EPZA 5ADZA 4OOGC 4BHBA 4KZSA 2EN1A 2WBTA 4BCAA 4RH8A 2EMWA 2EOSA 5AE3A 1G2FC 3AUZA 4LU9A 4DV6E 1A1KA 2LRSA 2YU5A 3ECRA 2RPCA 2V83A 2EN7A 2YTDA 3H09A 4I8OA 5AE1A 2EPMX 4HTGA 4F6NA 1UHZA 1FKAE 4JV5E 2LE2A 4R03A 3THNA 2EWLA 2YTGA 3J7AG 3C6MA 2EN6A 4X66E 1X5WA 5KL3A 1KYQA 2UUCE 2JVAA 4WFTA 4GZNC 2YRKA 2EPPA 2V88A 4WXCA 1WJPA 2MC5A 2F4VE 1B69A 2M4IA 1IQSA 3M99B 1N32E 2EM7A 4K0KE 2MDGA 2EPAA 4M2ZA 4GKKE 2RS7A 2V89A 3ADJA 4MLQA 3DF6A 3ZOQB 1T4OA 2RTXA 2B7VA 5AE2A 3HXLA 4M9VC 2LUQA 4HEIA 1A1LA 2EM4A 4YHHE 2MC6A 2M9AA 1GZ6A 1WHNA 2N3GA 4JI7E 4JI8E 5A6KA 4DV7E 3T1YE 2LT7A 4DMIA 2WZOA 4WPYA 3ADGA 4DV5E 1YYOA 2ENCA 4BC7A 3RMPA 2LBSB 2EZ6A 2JPAA 1AH5A 2YTJA 2I9IA 2NUGA 2KOUA 3ADLA 4O24A 2L3CA 2MKNA 2JOBA 4NHRA 2N8XA 2V86A 3JU0A 2A25A 3P1XA 1O0WA 2EE8A 4OX9E 4R2EA 1X48A 5A2QC 2EMGA 2DLKA 2CTDA 2E1MA 1PKPA 3DJWA 3J80C 2EMFA 5AC5A 2EPLX 1Z1BA 2LTSA 2F8BA 2ELZA 3J81C 4M0VA 4JI1E 2YRHA 3IWDA 2NUFA 2DB2A 1ZU1A 4JYAE 1YYWA 4BC9A 2R76A 1IBKE 4IJDA 4F9BB 5LMNE 2EMKA 2H36X 2KONA 3F6GA 1UN6B 2LMZA 5KL4A 2JR1A 1I94E 4TUGA 4JI6E 2ODRC 4DV2E 4JI4E 3VHTB 2DGCA 1YSAC 3BGHA 4DR7E 2EM9A 2JWOA 4L5NC 2EMCA 3QG5C 1RC7A 2DSYA 1A1IA 1T39A 1X6HA 2DRPA 3LLHA 4R2PA 2YTQA 1G2DC 2ZM6E 2L92A 2EN3A 5KL7A 1N36E 4BMJA 3JAMC 2EJ4A 2R1FA 4LFCE 2EQ0A 2WBUA 2EOYA 4LF8E 2CPNA 2EP3A 3K6QA 2UUAE 2HGHA 1QU6A 2ODRD 2WBSA 1TF6A
chains in the Genus database with same CATH topology
2EOQA 2EPAA 2EMZA 5KL6A 1YUIA 2EORA 5KL5A 4R2AA 1JK1A 2DMIA 1A1HA 2EL5A 1F2IG 1TN9A 2EN8A 4M9VC 2EMXA 2LCEA 2YTIA 2CSHA 2J7JA 2YTNA 2EM4A 1A1LA 4X9JA 2EM2A 2EMAA 2EPXA 2M9AA 5KL2A 2MKDA 2EPRA 1BB8A 2EOIA 2NABA 2LT7A 1NCSA 2EM8A 1ZR9A 2EOMA 1UBDC 3EPJA 1AAYA 2D9HA 2WCC3 3UK3C 1TF3A 1X6EA 2E72A 2JP9A 2ENCA 2EL6A 2YSOA 2EN4A 2EOOA 2JPAA 1DGCA 2EM0A 2EPUA 3EPLA 1JK2A 2YTJA 2YSPA 2LVHA 1A1FA 2MKNA 2ADRA 2EPCA 2GHFA 1BBOA 4WSGA 2A25A 2EM5A 2EE8A 2BB8A 4R2EA 4R2SA 2EL4A 2EMGA 2DLKA 2CTDA 2YTPA 1A1GA 3MHSC 2EMFA 4R2RA 1LLMC 2LO3A 1TF6A 4FK5C 3EPHA 1Z1BA 2YRMA 2ELZA 1ZAAC 2EMBA 4R2CA 2EMIA 2YRHA 3MHHC 1ZU1A 2EPZA 1YUJA 1RMDA 4IJDA 2YTEA 1X3CA 2EN2A 2EN1A 2EOHA 2RSIA 2WBTA 2EMKA 1UN6B 2EOXA 2YU8A 5KL4A 2EMWA 2EOSA 2GLIA 1G2FC 4R2QA 2EMYA 1KJKA 2LV2A 3VHTB 1A1KA 2DGCA 2YU5A 1YSAC 1MEYC 2RPCA 2YTDA 2EN7A 4F6NA 2PRTA 2VRDA 2EOFA 2EM9A 2YTFA 4R2DA 1P47A 2EQ1A 2EMCA 2EQ3A 2YTGA 2DLQA 2YTOA 3EPKA 1A1IA 2EN6A 1X5WA 2ENAA 5KL3A 1X6HA 2DRPA 4R2PA 2YTQA 1X6FA 1G2DC 2ENHA 2EN3A 4IS1C 4GZNC 2YRKA 2EPPA 2CT1A 5KL7A 2EMHA 2I13A 1WJPA 4F6MA 1B69A 2EJ4A 2R1FA 2ELYA 2EM3A 2EOJA 2EQ0A 2WBUA 2EOEA 2EOYA 2EP3A 1A1JA 2EM6A 3M99B 2HGHA 2WBSA 2EOZA 2EM7A 2EMLA 4F2JC 2MDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOQ A;  2EPA A;  2EMZ A;  5KL6 A;  1YUI A;  2EOR A;  5KL5 A;  4R2A A;  1JK1 A;  2DMI A;  1A1H A;  2EL5 A;  1F2I G;  1TN9 A;  2EN8 A;  4M9V C;  2EMX A;  2LCE A;  2YTI A;  2CSH A;  2J7J A;  2YTN A;  2EM4 A;  1A1L A;  4X9J A;  2EM2 A;  2EMA A;  2EPX A;  2M9A A;  5KL2 A;  2MKD A;  2EPR A;  1BB8 A;  2EOI A;  2NAB A;  2LT7 A;  1NCS A;  2EM8 A;  1ZR9 A;  2EOM A;  1UBD C;  3EPJ A;  1AAY A;  2D9H A;  2WCC 3;  3UK3 C;  1TF3 A;  1X6E A;  2E72 A;  2JP9 A;  2ENC A;  2EL6 A;  2YSO A;  2EN4 A;  2EOO A;  2JPA A;  1DGC A;  2EM0 A;  2EPU A;  3EPL A;  1JK2 A;  2YTJ A;  2YSP A;  2LVH A;  1A1F A;  2MKN A;  2ADR A;  2EPC A;  2GHF A;  1BBO A;  4WSG A;  2A25 A;  2EM5 A;  2EE8 A;  2BB8 A;  4R2E A;  4R2S A;  2EL4 A;  2EMG A;  2DLK A;  2CTD A;  2YTP A;  1A1G A;  3MHS C;  2EMF A;  4R2R A;  1LLM C;  2LO3 A;  1TF6 A;  4FK5 C;  3EPH A;  1Z1B A;  2YRM A;  2ELZ A;  1ZAA C;  2EMB A;  4R2C A;  2EMI A;  2YRH A;  3MHH C;  1ZU1 A;  2EPZ A;  1YUJ A;  1RMD A;  4IJD A;  2YTE A;  1X3C A;  2EN2 A;  2EN1 A;  2EOH A;  2RSI A;  2WBT A;  2EMK A;  1UN6 B;  2EOX A;  2YU8 A;  5KL4 A;  2EMW A;  2EOS A;  2GLI A;  1G2F C;  4R2Q A;  2EMY A;  1KJK A;  2LV2 A;  3VHT B;  1A1K A;  2DGC A;  2YU5 A;  1YSA C;  1MEY C;  2RPC A;  2YTD A;  2EN7 A;  4F6N A;  2PRT A;  2VRD A;  2EOF A;  2EM9 A;  2YTF A;  4R2D A;  1P47 A;  2EQ1 A;  2EMC A;  2EQ3 A;  2YTG A;  2DLQ A;  2YTO A;  3EPK A;  1A1I A;  2EN6 A;  1X5W A;  2ENA A;  5KL3 A;  1X6H A;  2DRP A;  4R2P A;  2YTQ A;  1X6F A;  1G2D C;  2ENH A;  2EN3 A;  4IS1 C;  4GZN C;  2YRK A;  2EPP A;  2CT1 A;  5KL7 A;  2EMH A;  2I13 A;  1WJP A;  4F6M A;  1B69 A;  2EJ4 A;  2R1F A;  2ELY A;  2EM3 A;  2EOJ A;  2EQ0 A;  2WBU A;  2EOE A;  2EOY A;  2EP3 A;  1A1J A;  2EM6 A;  3M99 B;  2HGH A;  2WBS A;  2EOZ A;  2EM7 A;  2EML A;  4F2J C;  2MDG A; 
#chains in the Genus database with same CATH topology
 2L2M A;  2G7H A;  1T4N A;  1YUI A;  2M1S A;  5KL5 A;  1X49 A;  4NZV A;  1A1H A;  3J7Y p;  4X65 E;  4DR5 E;  2EN8 A;  4LF9 E;  4JI5 E;  4Q28 A;  2CSH A;  4X9J A;  2EMA A;  2EPX A;  2EOI A;  1HR0 E;  1UBD C;  4X62 E;  1AAY A;  4F54 A;  4B3M E;  1X6E A;  3MSW A;  1XNR E;  5A69 A;  1ZBQ A;  3BID A;  4KWY A;  3L00 A;  1WXR A;  1J26 A;  1N33 E;  1N3G A;  2YSP A;  5AAS A;  1A1F A;  2ADR A;  4KHP E;  2JYA A;  2EM5 A;  4LF7 E;  2BB8 A;  3C4T A;  1ZBT A;  4R2S A;  5IT9 C;  4DV1 E;  4WX9 A;  3MHS C;  2K7I A;  1LLM C;  3JTZ A;  5DNY A;  3IWC A;  2B3T B;  2UXB E;  3VYX A;  1EH6 A;  2EMI A;  2N3H A;  1YUJ A;  2UXD E;  4WXD A;  2JXP A;  4JI3 E;  2EN2 A;  2RSI A;  2NUE A;  3VK6 A;  2EOX A;  2YU8 A;  3FIG A;  2EMY A;  3F6H A;  2LV2 A;  4WSP A;  3C4B A;  1T4L B;  1IQO A;  1MEY C;  4GKJ E;  2EOF A;  1YYK A;  1P47 A;  1J5E E;  1N34 E;  4BBY A;  1GTK A;  3EPK A;  2ENA A;  5AC4 A;  1SR9 A;  4O5G A;  4O4K A;  2ENH A;  5A6A A;  2CT1 A;  2LTR A;  2I13 A;  2KHX A;  2M7Q A;  2EM3 A;  2VQE E;  2EOE A;  2RQL A;  1HNZ E;  1A1J A;  2VE7 C;  2EM6 A;  2UU9 E;  1WRJ A;  2EOZ A;  1QNT A;  4DR6 E;  4F2J C;  1KJK A;  2EOQ A;  4M30 A;  3T1H E;  2EOR A;  2DIX A;  2DMI A;  1F2I G;  1T38 A;  2V8Q B;  2DMY A;  2L8T A;  2YTI A;  2YWQ A;  3C6K A;  2EM2 A;  4JI0 E;  2MKD A;  2EPR A;  1BB8 A;  2NAB A;  2EM8 A;  5F3W A;  1PDA A;  2EOM A;  4LF6 E;  2JOX A;  3KZZ A;  3EPJ A;  2D9H A;  3UK3 C;  1TF3 A;  2GPI A;  2EL6 A;  2B7T A;  3BBG A;  4GEQ B;  5FLX C;  2EM0 A;  3BF2 A;  2EPU A;  1JK2 A;  1IBL E;  1YPN A;  3OML A;  2LVH A;  4Q35 B;  2EPO A;  5IXM B;  4LTY A;  2L2K B;  2EPC A;  1BBO A;  3THO B;  1BBG A;  4ZYE A;  1NEI A;  4DR1 E;  1DQ3 A;  2MDR A;  4DUY E;  2EL4 A;  2LJH A;  3HQ1 A;  2K4V A;  4YY3 E;  2L3J A;  4R2R A;  1IMU A;  5A6B D;  1ZAA C;  4F9C B;  5IV8 B;  4RHB B;  3MHH C;  2LJU A;  5A6B A;  1XMO E;  1RMD A;  2YPN A;  2YTE A;  2UUB E;  1X3C A;  2EOH A;  1HNX E;  2FGG A;  5LLQ A;  2FV4 B;  4LFA E;  2HJJ A;  4ZYD A;  2HHH E;  2VF1 A;  2YT4 A;  2GLI A;  5LL6 R;  4R2Q A;  3KWR A;  1HNW E;  3ADI A;  3IWB A;  4ZYG A;  2YZT A;  3HPS A;  2PRT A;  2VRD A;  4N4R B;  4NXM E;  2RSM A;  5BR8 E;  4DR3 E;  3VYY A;  2YTF A;  4R2D A;  4DKK A;  2Q8U A;  4LFB E;  2EQ1 A;  4DR2 E;  3HPZ A;  2EQ3 A;  2V85 A;  2DLQ A;  4BHC A;  4DR4 E;  5TSE A;  2YTO A;  2JY9 A;  4DV3 E;  4JI2 E;  1X6F A;  3LML A;  1FJG E;  3EQ1 A;  4B3R E;  4IS1 C;  1XMQ E;  2V87 A;  1GQE A;  3HTX A;  2EMH A;  1DI2 A;  3KZY A;  4F6M A;  1YFH A;  4LF4 E;  2ELY A;  2EOJ A;  1WHQ A;  4P7D A;  2EML A;  1IBM E;  4NXN E;  2FTX B;  4TUI A;  4LF5 E;  4R8O A;  1MGT A;  2EMZ A;  5KL6 A;  4WYQ B;  2L2N A;  4R2A A;  1JK1 A;  1L4S A;  4P78 A;  2EL5 A;  1TN9 A;  2IHR 1;  2E5L E;  1EH7 A;  2LUP B;  1EKZ A;  2EMX A;  4AQY E;  2LCE A;  1PJT A;  2J7J A;  2YTN A;  2L33 A;  4MLV A;  4BS9 A;  5KL2 A;  4DV0 E;  4ZYH A;  4X64 E;  1NCS A;  1ZR9 A;  1RQ0 A;  2EPK X;  2WCC 3;  1STU A;  4X8W A;  2E72 A;  2JP9 A;  2UXC E;  2B9D A;  1UIL A;  2YSO A;  2EN4 A;  2EOO A;  4J8Z A;  1PJS A;  1DGC A;  2RS6 A;  3EPL A;  2HC5 A;  1EH8 A;  1YZ9 A;  2NA2 A;  5LMU E;  1XNQ E;  2VQF E;  3OTO E;  2GHF A;  4WSG A;  5IWA E;  3AV0 A;  2BBG A;  4L8N A;  2L6M A;  1X47 A;  4DUZ E;  4DV4 E;  2YTP A;  1A1G A;  4F9A B;  5A6J A;  5CFF E;  5T6J A;  2LO3 A;  4B3T E;  1PJQ A;  4FK5 C;  3EPH A;  1SFE A;  2YRM A;  4B3S E;  3TQM A;  2EPN A;  2EMB A;  4O43 A;  4R2C A;  2EPZ A;  5ADZ A;  4OOG C;  4BHB A;  4KZS A;  2EN1 A;  2WBT A;  4BCA A;  4RH8 A;  2EMW A;  2EOS A;  5AE3 A;  1G2F C;  3AUZ A;  4LU9 A;  4DV6 E;  1A1K A;  2LRS A;  2YU5 A;  3ECR A;  2RPC A;  2V83 A;  2EN7 A;  2YTD A;  3H09 A;  4I8O A;  5AE1 A;  2EPM X;  4HTG A;  4F6N A;  1UHZ A;  1FKA E;  4JV5 E;  2LE2 A;  4R03 A;  3THN A;  2EWL A;  2YTG A;  3J7A G;  3C6M A;  2EN6 A;  4X66 E;  1X5W A;  5KL3 A;  1KYQ A;  2UUC E;  2JVA A;  4WFT A;  4GZN C;  2YRK A;  2EPP A;  2V88 A;  4WXC A;  1WJP A;  2MC5 A;  2F4V E;  1B69 A;  2M4I A;  1IQS A;  3M99 B;  1N32 E;  2EM7 A;  4K0K E;  2MDG A;  2EPA A;  4M2Z A;  4GKK E;  2RS7 A;  2V89 A;  3ADJ A;  4MLQ A;  3DF6 A;  3ZOQ B;  1T4O A;  2RTX A;  2B7V A;  5AE2 A;  3HXL A;  4M9V C;  2LUQ A;  4HEI A;  1A1L A;  2EM4 A;  4YHH E;  2MC6 A;  2M9A A;  1GZ6 A;  1WHN A;  2N3G A;  4JI7 E;  4JI8 E;  5A6K A;  4DV7 E;  3T1Y E;  2LT7 A;  4DMI A;  2WZO A;  4WPY A;  3ADG A;  4DV5 E;  1YYO A;  2ENC A;  4BC7 A;  3RMP A;  2LBS B;  2EZ6 A;  2JPA A;  1AH5 A;  2YTJ A;  2I9I A;  2NUG A;  2KOU A;  3ADL A;  4O24 A;  2L3C A;  2MKN A;  2JOB A;  4NHR A;  2N8X A;  2V86 A;  3JU0 A;  2A25 A;  3P1X A;  1O0W A;  2EE8 A;  4OX9 E;  4R2E A;  1X48 A;  5A2Q C;  2EMG A;  2DLK A;  2CTD A;  2E1M A;  1PKP A;  3DJW A;  3J80 C;  2EMF A;  5AC5 A;  2EPL X;  1Z1B A;  2LTS A;  2F8B A;  2ELZ A;  3J81 C;  4M0V A;  4JI1 E;  2YRH A;  3IWD A;  2NUF A;  2DB2 A;  1ZU1 A;  4JYA E;  1YYW A;  4BC9 A;  2R76 A;  1IBK E;  4IJD A;  4F9B B;  5LMN E;  2EMK A;  2H36 X;  2KON A;  3F6G A;  1UN6 B;  2LMZ A;  5KL4 A;  2JR1 A;  1I94 E;  4TUG A;  4JI6 E;  2ODR C;  4DV2 E;  4JI4 E;  3VHT B;  2DGC A;  1YSA C;  3BGH A;  4DR7 E;  2EM9 A;  2JWO A;  4L5N C;  2EMC A;  3QG5 C;  1RC7 A;  2DSY A;  1A1I A;  1T39 A;  1X6H A;  2DRP A;  3LLH A;  4R2P A;  2YTQ A;  1G2D C;  2ZM6 E;  2L92 A;  2EN3 A;  5KL7 A;  1N36 E;  4BMJ A;  3JAM C;  2EJ4 A;  2R1F A;  4LFC E;  2EQ0 A;  2WBU A;  2EOY A;  4LF8 E;  2CPN A;  2EP3 A;  3K6Q A;  2UUA E;  2HGH A;  1QU6 A;  2ODR D;  2WBS A;  1TF6 A; 
#chains in the Genus database with same CATH homology
 2EOQ A;  2EPA A;  2EMZ A;  5KL6 A;  1YUI A;  2EOR A;  5KL5 A;  4R2A A;  1JK1 A;  2DMI A;  1A1H A;  2EL5 A;  1F2I G;  1TN9 A;  2EN8 A;  4M9V C;  2EMX A;  2LCE A;  2YTI A;  2CSH A;  2J7J A;  2YTN A;  2EM4 A;  1A1L A;  4X9J A;  2EM2 A;  2EMA A;  2EPX A;  2M9A A;  5KL2 A;  2MKD A;  2EPR A;  1BB8 A;  2EOI A;  2NAB A;  2LT7 A;  1NCS A;  2EM8 A;  1ZR9 A;  2EOM A;  1UBD C;  3EPJ A;  1AAY A;  2D9H A;  2WCC 3;  3UK3 C;  1TF3 A;  1X6E A;  2E72 A;  2JP9 A;  2ENC A;  2EL6 A;  2YSO A;  2EN4 A;  2EOO A;  2JPA A;  1DGC A;  2EM0 A;  2EPU A;  3EPL A;  1JK2 A;  2YTJ A;  2YSP A;  2LVH A;  1A1F A;  2MKN A;  2ADR A;  2EPC A;  2GHF A;  1BBO A;  4WSG A;  2A25 A;  2EM5 A;  2EE8 A;  2BB8 A;  4R2E A;  4R2S A;  2EL4 A;  2EMG A;  2DLK A;  2CTD A;  2YTP A;  1A1G A;  3MHS C;  2EMF A;  4R2R A;  1LLM C;  2LO3 A;  1TF6 A;  4FK5 C;  3EPH A;  1Z1B A;  2YRM A;  2ELZ A;  1ZAA C;  2EMB A;  4R2C A;  2EMI A;  2YRH A;  3MHH C;  1ZU1 A;  2EPZ A;  1YUJ A;  1RMD A;  4IJD A;  2YTE A;  1X3C A;  2EN2 A;  2EN1 A;  2EOH A;  2RSI A;  2WBT A;  2EMK A;  1UN6 B;  2EOX A;  2YU8 A;  5KL4 A;  2EMW A;  2EOS A;  2GLI A;  1G2F C;  4R2Q A;  2EMY A;  1KJK A;  2LV2 A;  3VHT B;  1A1K A;  2DGC A;  2YU5 A;  1YSA C;  1MEY C;  2RPC A;  2YTD A;  2EN7 A;  4F6N A;  2PRT A;  2VRD A;  2EOF A;  2EM9 A;  2YTF A;  4R2D A;  1P47 A;  2EQ1 A;  2EMC A;  2EQ3 A;  2YTG A;  2DLQ A;  2YTO A;  3EPK A;  1A1I A;  2EN6 A;  1X5W A;  2ENA A;  5KL3 A;  1X6H A;  2DRP A;  4R2P A;  2YTQ A;  1X6F A;  1G2D C;  2ENH A;  2EN3 A;  4IS1 C;  4GZN C;  2YRK A;  2EPP A;  2CT1 A;  5KL7 A;  2EMH A;  2I13 A;  1WJP A;  4F6M A;  1B69 A;  2EJ4 A;  2R1F A;  2ELY A;  2EM3 A;  2EOJ A;  2EQ0 A;  2WBU A;  2EOE A;  2EOY A;  2EP3 A;  1A1J A;  2EM6 A;  3M99 B;  2HGH A;  2WBS A;  2EOZ A;  2EM7 A;  2EML A;  4F2J C;  2MDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...