2YTIA

Solution structure of the c2h2 type zinc finger (region 564-596) of human zinc finger protein 347
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYKCNECGKVFTQNSHLARHRGIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 564-596) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytiA01
2WBSA 4WSGA 2YTJA 4F6NA 2CTDA 2EOEA 2EMKA 2YSOA 1TN9A 2EQ0A 4R2AA 2YTNA 4R2RA 2EOJA 2EQ1A 2EL6A 2EMYA 2EL4A 2YTOA 1AAYA 2ENAA 1LLMC 3MHSC 1A1KA 1UN6B 2EM4A 2EJ4A 2EPXA 2GLIA 2DLQA 2EMCA 2VRDA 4IJDA 2CSHA 5KL5A 2NABA 2J7JA 4FK5C 1YUIA 2EOQA 2EN3A 2ENCA 2EPPA 1X6EA 1MEYC 2LV2A 1YSAC 2EN6A 2YTFA 5KL3A 1ZAAC 1BB8A 3EPJA 2YSPA 2ENHA 2EMIA 2RSIA 1DGCA 2YTIA 4F2JC 2RPCA 4R2QA 1Z1BA 2GHFA 2DGCA 2EN7A 2EOFA 2EPCA 4R2CA 2YTDA 2YTGA 4F6MA 2EMAA 1X5WA 4M9VC 1WJPA 2EM5A 2EPRA 2EPUA 2YTEA 2EOIA 2YU5A 2EMFA 2EOYA 2EM2A 2WBUA 1YUJA 1BBOA 2YRMA 2EP3A 2HGHA 2ELZA 1UBDC 2EM3A 1G2FC 2EMLA 1TF6A 2EORA 2EE8A 1NCSA 1F2IG 1P47A 2EMWA 3EPKA 2JP9A 2D9HA 1A1HA 2EQ3A 2MDGA 2EM6A 2EN2A 2R1FA 2YTQA 1G2DC 3UK3C 2EOSA 2DRPA 2EM9A 4R2PA 2LO3A 3EPHA 2YU8A 1JK1A 1RMDA 2EOZA 2JPAA 5KL2A 4IS1C 1A1JA 2WCC3 1A1GA 1X6HA 2EM0A 3EPLA 4GZNC 2CT1A 3VHTB 4X9JA 2LVHA 1TF3A 2E72A 2EL5A 2EPAA 2EMHA 2EMZA 2ADRA 1X6FA 4R2DA 2EM7A 1B69A 2EN4A 5KL7A 1KJKA 2EN1A 2ELYA 2MKDA 2DLKA 5KL4A 2LCEA 2EPZA 2LT7A 2YTPA 2BB8A 2EN8A 1A1FA 1A1LA 2EMXA 2WBTA 1X3CA 5KL6A 4R2EA 2EMBA 1JK2A 2M9AA 2YRHA 2EOOA 4R2SA 2A25A 2EOXA 1ZU1A 2MKNA 3MHHC 2PRTA 2EOHA 2EOMA 1A1IA 2YRKA 3M99B 1ZR9A 2DMIA 2EM8A 2EMGA 2I13A
chains in the Genus database with same CATH superfamily
4DV4E 4LF4E 5IXMB 1XMOE 5T6JA 4TUGA 2NUEA 2YTJA 4F6NA 2CTDA 2N3HA 1SFEA 3JTZA 1XNQE 1TN9A 2EQ0A 2EWLA 4R2AA 1T4OA 1UHZA 3AUZA 2YTNA 2EQ1A 2EL4A 2RS6A 4X65E 2KONA 2BBGA 1IBKE 2L2MA 4JI8E 4WX9A 2EMCA 2VRDA 3MSWA 2FGGA 2NA2A 2UUAE 2NABA 3IWCA 4LU9A 3DF6A 4P78A 1HNXE 2ENCA 3HTXA 2EPPA 4F9CB 2YTFA 4RHBB 5AE3A 2LUQA 3EPJA 2YSPA 5CFFE 2EMIA 4ZYDA 4DR4E 2YWQA 4NXME 3T1HE 4K0KE 1QNTA 4F2JC 4O4KA 2YTDA 1YZ9A 4JI0E 1WHNA 1WJPA 2V88A 4KZSA 5BR8E 2E1MA 2WBUA 4JI3E 2JVAA 4F9BB 5AE2A 2UUCE 2EMLA 2ODRC 1GTKA 5A6BA 1J26A 1F2IG 2L3JA 2FV4B 2EPMX 5A2QC 5LL6R 2EM6A 2YTQA 2V86A 3BBGA 1I94E 2EOSA 3C4BA 2DRPA 4R8OA 1EH7A 2JPAA 3QG5C 1A1JA 4X9JA 2EL5A 4P7DA 2M1SA 5KL7A 1KJKA 3H09A 3F6HA 2LCEA 1N32E 2UU9E 4DR3E 1QU6A 1L4SA 4DV7E 2EMBA 4DR1E 4DV3E 3JU0A 1T4NA 2A25A 3AV0A 1ZU1A 4AQYE 2MKNA 2EOHA 2EOMA 4RH8A 1ZR9A 4DKKA 3ADIA 2NUGA 4X64E 4WSGA 2EOEA 2LRSA 5LMUE 5AE1A 4LF9E 2EPNA 2L6MA 1T39A 4M2ZA 2YTOA 2K4VA 2ENAA 4F9AB 1LLMC 1A1KA 1UN6B 4LFAE 2EM4A 2EJ4A 2JY9A 1YYKA 2I9IA 2DLQA 3LLHA 2N3GA 4FK5C 2B3TB 1YUIA 2EN3A 1X6EA 2RS7A 2LV2A 4DV2E 1MEYC 1YSAC 4LFBE 4JI4E 2ENHA 2VE7C 2M4IA 2VF1A 2VQEE 1DGCA 3HPSA 2CPNA 2RPCA 1Z1BA 2EN7A 4WYQB 4R2CA 4M0VA 1J5EE 4M9VC 2UXCE 2EP3A 4I8OA 2HGHA 4GEQB 2EM3A 4JI7E 1G2FC 1X49A 1TF6A 1BBGA 2LUPB 2EORA 3C6KA 1NCSA 5FLXC 5A6BD 2ZM6E 4X66E 3EPKA 2JP9A 1A1HA 1PJQA 2FTXB 2MDGA 1N36E 4JI1E 4BMJA 2EM9A 3EPHA 2LO3A 2JOBA 4BC7A 2EPOA 2EOZA 5KL2A 4IS1C 3L00A 1A1GA 1HNZE 2EM0A 3VHTB 2LVHA 1TF3A 2V8QB 4KWYA 2M7QA 4LFCE 2YZTA 3IWBA 5A6JA 4BHBA 3J81C 2EMZA 2ADRA 2EPLX 2EM7A 2UXDE 2EN4A 2MKDA 5KL4A 3LMLA 4X62E 2YTPA 4DV1E 4HEIA 1ZBTA 2EMXA 3HPZA 1X3CA 3ADLA 4WSPA 2V89A 2WZOA 3BF2A 4R2EA 1MGTA 4JYAE 4B3RE 2EZ6A 2EOOA 4R2SA 1DI2A 4B3TE 2GPIA 1GZ6A 2V87A 4B3ME 2PRTA 2DMIA 3VYYA 2LBSB 2EMGA 2I13A 4DV0E 1FJGE 1KYQA 3J7Yp 1RC7A 2LJUA 4WXCA 1X48A 2JYAA 5IWAE 4LF7E 2YSOA 2RQLA 2EOJA 2V85A 2EL6A 2EMYA 1EKZA 2L2KB 2EPXA 2GLIA 4IJDA 4DR6E 2IHR1 2F4VE 4NHRA 5KL5A 4R03A 2LE2A 2EOQA 3J80C 2YT4A 4DR7E 1O0WA 1T38A 2EN6A 1DQ3A 5KL3A 1ZAAC 1BB8A 4LTYA 1HR0E 5A69A 1XMQE 3ADGA 4X8WA 1YPNA 5A6AA 2YTIA 4WPYA 3THNA 4R2QA 3EQ1A 2DGCA 4DV6E 2Q8UA 2EOFA 2EPCA 4BC9A 4F6MA 1N3GA 2JR1A 4GKJE 3DJWA 2YTEA 5DNYA 2DB2A 3RMPA 1PKPA 2EOYA 1YUJA 2EM2A 1BBOA 4B3SE 4DUYE 2ELZA 2B9DA 1PJTA 4BCAA 2DIXA 4O24A 4JI5E 4L5NC 2YPNA 1EH8A 3OMLA 4WXDA 2D9HA 1XNRE 2EQ3A 2JXPA 3VK6A 1G2DC 3UK3C 1IBLE 1IMUA 4KHPE 2YU8A 1RMDA 4DUZE 1T4LB 4DV5E 2WCC3 5ADZA 1SR9A 4O43A 4GZNC 3JAMC 1IQOA 4LF6E 2L8TA 2B7TA 2EPAA 3F6GA 4NXNE 4M30A 1GQEA 2EPZA 4DR5E 5LLQA 2BB8A 4DR2E 1PJSA 3KWRA 2EN8A 3THOB 4BS9A 2RTXA 4YY3E 2L2NA 4JI2E 5AASA 2R76A 2HC5A 4F54A 2YRHA 1NEIA 3MHHC 2KOUA 1A1IA 2YRKA 3M99B 2EM8A 1WXRA 2WBSA 4LF8E 1N33E 2HJJA 4LF5E 2KHXA 3T1YE 4Q28A 4BBYA 4J8ZA 2EMKA 3K6QA 2DMYA 5IV8B 4R2RA 4JV5E 4Q35B 4OOGC 2V83A 1X47A 2RSMA 4TUIA 1AAYA 5A6KA 4ZYHA 3MHSC 3ECRA 1YYOA 3VYXA 4MLQA 2UXBE 2CSHA 4JI6E 2J7JA 1UILA 1YYWA 1PDAA 4DMIA 4WFTA 5TSEA 4YHHE 3HQ1A 2LMZA 2LJHA 3ADJA 3BIDA 2RSIA 1WHQA 2DSYA 3TQMA 2JOXA 2UUBE 2GHFA 3P1XA 2LTSA 1HNWE 2YTGA 2ODRD 2EMAA 2K7IA 1X5WA 3KZYA 2EM5A 2EPRA 2L33A 2EPUA 2EOIA 2YU5A 2EMFA 2YRMA 4MLVA 3ZOQB 1UBDC 4ZYGA 1RQ0A 3HXLA 4OX9E 2EE8A 2H36X 2MC5A 3IWDA 2N8XA 2L3CA 5LMNE 1P47A 2EMWA 5AC4A 2B7VA 2EN2A 2R1FA 5IT9C 4R2PA 1ZBQA 1YFHA 3KZZA 1JK1A 3C4TA 2F8BA 3OTOE 1X6HA 2JWOA 3EPLA 2EPKX 2CT1A 4L8NA 5AC5A 4N4RB 2MDRA 2HHHE 2E72A 2EMHA 1X6FA 1EH6A 4R2DA 1B69A 3C6MA 3FIGA 4NZVA 2NUFA 2EN1A 2ELYA 1STUA 2DLKA 2LTRA 2E5LE 2LT7A 1N34E 1IBME 1IQSA 1AH5A 3J7AG 1WRJA 3BGHA 1A1FA 1A1LA 4O5GA 2WBTA 5KL6A 1JK2A 1FKAE 4HTGA 2M9AA 4GKKE 2MC6A 4ZYEA 5F3WA 2EOXA 2G7HA 2VQFE 2L92A 4BHCA
chains in the Genus database with same CATH topology
2WBSA 4WSGA 2YTJA 4F6NA 2CTDA 2EOEA 2EMKA 2YSOA 1TN9A 2EQ0A 4R2AA 2YTNA 4R2RA 2EOJA 2EQ1A 2EL6A 2EMYA 2EL4A 2YTOA 1AAYA 2ENAA 1LLMC 3MHSC 1A1KA 1UN6B 2EM4A 2EJ4A 2EPXA 2GLIA 2DLQA 2EMCA 2VRDA 4IJDA 2CSHA 5KL5A 2NABA 2J7JA 4FK5C 1YUIA 2EOQA 2EN3A 2ENCA 2EPPA 1X6EA 1MEYC 2LV2A 1YSAC 2EN6A 2YTFA 5KL3A 1ZAAC 1BB8A 3EPJA 2YSPA 2ENHA 2EMIA 2RSIA 1DGCA 2YTIA 4F2JC 2RPCA 4R2QA 1Z1BA 2GHFA 2DGCA 2EN7A 2EOFA 2EPCA 4R2CA 2YTDA 2YTGA 4F6MA 2EMAA 1X5WA 4M9VC 1WJPA 2EM5A 2EPRA 2EPUA 2YTEA 2EOIA 2YU5A 2EMFA 2EOYA 2EM2A 2WBUA 1YUJA 1BBOA 2YRMA 2EP3A 2HGHA 2ELZA 1UBDC 2EM3A 1G2FC 2EMLA 1TF6A 2EORA 2EE8A 1NCSA 1F2IG 1P47A 2EMWA 3EPKA 2JP9A 2D9HA 1A1HA 2EQ3A 2MDGA 2EM6A 2EN2A 2R1FA 2YTQA 1G2DC 3UK3C 2EOSA 2DRPA 2EM9A 4R2PA 2LO3A 3EPHA 2YU8A 1JK1A 1RMDA 2EOZA 2JPAA 5KL2A 4IS1C 1A1JA 2WCC3 1A1GA 1X6HA 2EM0A 3EPLA 4GZNC 2CT1A 3VHTB 4X9JA 2LVHA 1TF3A 2E72A 2EL5A 2EPAA 2EMHA 2EMZA 2ADRA 1X6FA 4R2DA 2EM7A 1B69A 2EN4A 5KL7A 1KJKA 2EN1A 2ELYA 2MKDA 2DLKA 5KL4A 2LCEA 2EPZA 2LT7A 2YTPA 2BB8A 2EN8A 1A1FA 1A1LA 2EMXA 2WBTA 1X3CA 5KL6A 4R2EA 2EMBA 1JK2A 2M9AA 2YRHA 2EOOA 4R2SA 2A25A 2EOXA 1ZU1A 2MKNA 3MHHC 2PRTA 2EOHA 2EOMA 1A1IA 2YRKA 3M99B 1ZR9A 2DMIA 2EM8A 2EMGA 2I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBS A;  4WSG A;  2YTJ A;  4F6N A;  2CTD A;  2EOE A;  2EMK A;  2YSO A;  1TN9 A;  2EQ0 A;  4R2A A;  2YTN A;  4R2R A;  2EOJ A;  2EQ1 A;  2EL6 A;  2EMY A;  2EL4 A;  2YTO A;  1AAY A;  2ENA A;  1LLM C;  3MHS C;  1A1K A;  1UN6 B;  2EM4 A;  2EJ4 A;  2EPX A;  2GLI A;  2DLQ A;  2EMC A;  2VRD A;  4IJD A;  2CSH A;  5KL5 A;  2NAB A;  2J7J A;  4FK5 C;  1YUI A;  2EOQ A;  2EN3 A;  2ENC A;  2EPP A;  1X6E A;  1MEY C;  2LV2 A;  1YSA C;  2EN6 A;  2YTF A;  5KL3 A;  1ZAA C;  1BB8 A;  3EPJ A;  2YSP A;  2ENH A;  2EMI A;  2RSI A;  1DGC A;  2YTI A;  4F2J C;  2RPC A;  4R2Q A;  1Z1B A;  2GHF A;  2DGC A;  2EN7 A;  2EOF A;  2EPC A;  4R2C A;  2YTD A;  2YTG A;  4F6M A;  2EMA A;  1X5W A;  4M9V C;  1WJP A;  2EM5 A;  2EPR A;  2EPU A;  2YTE A;  2EOI A;  2YU5 A;  2EMF A;  2EOY A;  2EM2 A;  2WBU A;  1YUJ A;  1BBO A;  2YRM A;  2EP3 A;  2HGH A;  2ELZ A;  1UBD C;  2EM3 A;  1G2F C;  2EML A;  1TF6 A;  2EOR A;  2EE8 A;  1NCS A;  1F2I G;  1P47 A;  2EMW A;  3EPK A;  2JP9 A;  2D9H A;  1A1H A;  2EQ3 A;  2MDG A;  2EM6 A;  2EN2 A;  2R1F A;  2YTQ A;  1G2D C;  3UK3 C;  2EOS A;  2DRP A;  2EM9 A;  4R2P A;  2LO3 A;  3EPH A;  2YU8 A;  1JK1 A;  1RMD A;  2EOZ A;  2JPA A;  5KL2 A;  4IS1 C;  1A1J A;  2WCC 3;  1A1G A;  1X6H A;  2EM0 A;  3EPL A;  4GZN C;  2CT1 A;  3VHT B;  4X9J A;  2LVH A;  1TF3 A;  2E72 A;  2EL5 A;  2EPA A;  2EMH A;  2EMZ A;  2ADR A;  1X6F A;  4R2D A;  2EM7 A;  1B69 A;  2EN4 A;  5KL7 A;  1KJK A;  2EN1 A;  2ELY A;  2MKD A;  2DLK A;  5KL4 A;  2LCE A;  2EPZ A;  2LT7 A;  2YTP A;  2BB8 A;  2EN8 A;  1A1F A;  1A1L A;  2EMX A;  2WBT A;  1X3C A;  5KL6 A;  4R2E A;  2EMB A;  1JK2 A;  2M9A A;  2YRH A;  2EOO A;  4R2S A;  2A25 A;  2EOX A;  1ZU1 A;  2MKN A;  3MHH C;  2PRT A;  2EOH A;  2EOM A;  1A1I A;  2YRK A;  3M99 B;  1ZR9 A;  2DMI A;  2EM8 A;  2EMG A;  2I13 A; 
#chains in the Genus database with same CATH topology
 4DV4 E;  4LF4 E;  5IXM B;  1XMO E;  5T6J A;  4TUG A;  2NUE A;  2YTJ A;  4F6N A;  2CTD A;  2N3H A;  1SFE A;  3JTZ A;  1XNQ E;  1TN9 A;  2EQ0 A;  2EWL A;  4R2A A;  1T4O A;  1UHZ A;  3AUZ A;  2YTN A;  2EQ1 A;  2EL4 A;  2RS6 A;  4X65 E;  2KON A;  2BBG A;  1IBK E;  2L2M A;  4JI8 E;  4WX9 A;  2EMC A;  2VRD A;  3MSW A;  2FGG A;  2NA2 A;  2UUA E;  2NAB A;  3IWC A;  4LU9 A;  3DF6 A;  4P78 A;  1HNX E;  2ENC A;  3HTX A;  2EPP A;  4F9C B;  2YTF A;  4RHB B;  5AE3 A;  2LUQ A;  3EPJ A;  2YSP A;  5CFF E;  2EMI A;  4ZYD A;  4DR4 E;  2YWQ A;  4NXM E;  3T1H E;  4K0K E;  1QNT A;  4F2J C;  4O4K A;  2YTD A;  1YZ9 A;  4JI0 E;  1WHN A;  1WJP A;  2V88 A;  4KZS A;  5BR8 E;  2E1M A;  2WBU A;  4JI3 E;  2JVA A;  4F9B B;  5AE2 A;  2UUC E;  2EML A;  2ODR C;  1GTK A;  5A6B A;  1J26 A;  1F2I G;  2L3J A;  2FV4 B;  2EPM X;  5A2Q C;  5LL6 R;  2EM6 A;  2YTQ A;  2V86 A;  3BBG A;  1I94 E;  2EOS A;  3C4B A;  2DRP A;  4R8O A;  1EH7 A;  2JPA A;  3QG5 C;  1A1J A;  4X9J A;  2EL5 A;  4P7D A;  2M1S A;  5KL7 A;  1KJK A;  3H09 A;  3F6H A;  2LCE A;  1N32 E;  2UU9 E;  4DR3 E;  1QU6 A;  1L4S A;  4DV7 E;  2EMB A;  4DR1 E;  4DV3 E;  3JU0 A;  1T4N A;  2A25 A;  3AV0 A;  1ZU1 A;  4AQY E;  2MKN A;  2EOH A;  2EOM A;  4RH8 A;  1ZR9 A;  4DKK A;  3ADI A;  2NUG A;  4X64 E;  4WSG A;  2EOE A;  2LRS A;  5LMU E;  5AE1 A;  4LF9 E;  2EPN A;  2L6M A;  1T39 A;  4M2Z A;  2YTO A;  2K4V A;  2ENA A;  4F9A B;  1LLM C;  1A1K A;  1UN6 B;  4LFA E;  2EM4 A;  2EJ4 A;  2JY9 A;  1YYK A;  2I9I A;  2DLQ A;  3LLH A;  2N3G A;  4FK5 C;  2B3T B;  1YUI A;  2EN3 A;  1X6E A;  2RS7 A;  2LV2 A;  4DV2 E;  1MEY C;  1YSA C;  4LFB E;  4JI4 E;  2ENH A;  2VE7 C;  2M4I A;  2VF1 A;  2VQE E;  1DGC A;  3HPS A;  2CPN A;  2RPC A;  1Z1B A;  2EN7 A;  4WYQ B;  4R2C A;  4M0V A;  1J5E E;  4M9V C;  2UXC E;  2EP3 A;  4I8O A;  2HGH A;  4GEQ B;  2EM3 A;  4JI7 E;  1G2F C;  1X49 A;  1TF6 A;  1BBG A;  2LUP B;  2EOR A;  3C6K A;  1NCS A;  5FLX C;  5A6B D;  2ZM6 E;  4X66 E;  3EPK A;  2JP9 A;  1A1H A;  1PJQ A;  2FTX B;  2MDG A;  1N36 E;  4JI1 E;  4BMJ A;  2EM9 A;  3EPH A;  2LO3 A;  2JOB A;  4BC7 A;  2EPO A;  2EOZ A;  5KL2 A;  4IS1 C;  3L00 A;  1A1G A;  1HNZ E;  2EM0 A;  3VHT B;  2LVH A;  1TF3 A;  2V8Q B;  4KWY A;  2M7Q A;  4LFC E;  2YZT A;  3IWB A;  5A6J A;  4BHB A;  3J81 C;  2EMZ A;  2ADR A;  2EPL X;  2EM7 A;  2UXD E;  2EN4 A;  2MKD A;  5KL4 A;  3LML A;  4X62 E;  2YTP A;  4DV1 E;  4HEI A;  1ZBT A;  2EMX A;  3HPZ A;  1X3C A;  3ADL A;  4WSP A;  2V89 A;  2WZO A;  3BF2 A;  4R2E A;  1MGT A;  4JYA E;  4B3R E;  2EZ6 A;  2EOO A;  4R2S A;  1DI2 A;  4B3T E;  2GPI A;  1GZ6 A;  2V87 A;  4B3M E;  2PRT A;  2DMI A;  3VYY A;  2LBS B;  2EMG A;  2I13 A;  4DV0 E;  1FJG E;  1KYQ A;  3J7Y p;  1RC7 A;  2LJU A;  4WXC A;  1X48 A;  2JYA A;  5IWA E;  4LF7 E;  2YSO A;  2RQL A;  2EOJ A;  2V85 A;  2EL6 A;  2EMY A;  1EKZ A;  2L2K B;  2EPX A;  2GLI A;  4IJD A;  4DR6 E;  2IHR 1;  2F4V E;  4NHR A;  5KL5 A;  4R03 A;  2LE2 A;  2EOQ A;  3J80 C;  2YT4 A;  4DR7 E;  1O0W A;  1T38 A;  2EN6 A;  1DQ3 A;  5KL3 A;  1ZAA C;  1BB8 A;  4LTY A;  1HR0 E;  5A69 A;  1XMQ E;  3ADG A;  4X8W A;  1YPN A;  5A6A A;  2YTI A;  4WPY A;  3THN A;  4R2Q A;  3EQ1 A;  2DGC A;  4DV6 E;  2Q8U A;  2EOF A;  2EPC A;  4BC9 A;  4F6M A;  1N3G A;  2JR1 A;  4GKJ E;  3DJW A;  2YTE A;  5DNY A;  2DB2 A;  3RMP A;  1PKP A;  2EOY A;  1YUJ A;  2EM2 A;  1BBO A;  4B3S E;  4DUY E;  2ELZ A;  2B9D A;  1PJT A;  4BCA A;  2DIX A;  4O24 A;  4JI5 E;  4L5N C;  2YPN A;  1EH8 A;  3OML A;  4WXD A;  2D9H A;  1XNR E;  2EQ3 A;  2JXP A;  3VK6 A;  1G2D C;  3UK3 C;  1IBL E;  1IMU A;  4KHP E;  2YU8 A;  1RMD A;  4DUZ E;  1T4L B;  4DV5 E;  2WCC 3;  5ADZ A;  1SR9 A;  4O43 A;  4GZN C;  3JAM C;  1IQO A;  4LF6 E;  2L8T A;  2B7T A;  2EPA A;  3F6G A;  4NXN E;  4M30 A;  1GQE A;  2EPZ A;  4DR5 E;  5LLQ A;  2BB8 A;  4DR2 E;  1PJS A;  3KWR A;  2EN8 A;  3THO B;  4BS9 A;  2RTX A;  4YY3 E;  2L2N A;  4JI2 E;  5AAS A;  2R76 A;  2HC5 A;  4F54 A;  2YRH A;  1NEI A;  3MHH C;  2KOU A;  1A1I A;  2YRK A;  3M99 B;  2EM8 A;  1WXR A;  2WBS A;  4LF8 E;  1N33 E;  2HJJ A;  4LF5 E;  2KHX A;  3T1Y E;  4Q28 A;  4BBY A;  4J8Z A;  2EMK A;  3K6Q A;  2DMY A;  5IV8 B;  4R2R A;  4JV5 E;  4Q35 B;  4OOG C;  2V83 A;  1X47 A;  2RSM A;  4TUI A;  1AAY A;  5A6K A;  4ZYH A;  3MHS C;  3ECR A;  1YYO A;  3VYX A;  4MLQ A;  2UXB E;  2CSH A;  4JI6 E;  2J7J A;  1UIL A;  1YYW A;  1PDA A;  4DMI A;  4WFT A;  5TSE A;  4YHH E;  3HQ1 A;  2LMZ A;  2LJH A;  3ADJ A;  3BID A;  2RSI A;  1WHQ A;  2DSY A;  3TQM A;  2JOX A;  2UUB E;  2GHF A;  3P1X A;  2LTS A;  1HNW E;  2YTG A;  2ODR D;  2EMA A;  2K7I A;  1X5W A;  3KZY A;  2EM5 A;  2EPR A;  2L33 A;  2EPU A;  2EOI A;  2YU5 A;  2EMF A;  2YRM A;  4MLV A;  3ZOQ B;  1UBD C;  4ZYG A;  1RQ0 A;  3HXL A;  4OX9 E;  2EE8 A;  2H36 X;  2MC5 A;  3IWD A;  2N8X A;  2L3C A;  5LMN E;  1P47 A;  2EMW A;  5AC4 A;  2B7V A;  2EN2 A;  2R1F A;  5IT9 C;  4R2P A;  1ZBQ A;  1YFH A;  3KZZ A;  1JK1 A;  3C4T A;  2F8B A;  3OTO E;  1X6H A;  2JWO A;  3EPL A;  2EPK X;  2CT1 A;  4L8N A;  5AC5 A;  4N4R B;  2MDR A;  2HHH E;  2E72 A;  2EMH A;  1X6F A;  1EH6 A;  4R2D A;  1B69 A;  3C6M A;  3FIG A;  4NZV A;  2NUF A;  2EN1 A;  2ELY A;  1STU A;  2DLK A;  2LTR A;  2E5L E;  2LT7 A;  1N34 E;  1IBM E;  1IQS A;  1AH5 A;  3J7A G;  1WRJ A;  3BGH A;  1A1F A;  1A1L A;  4O5G A;  2WBT A;  5KL6 A;  1JK2 A;  1FKA E;  4HTG A;  2M9A A;  4GKK E;  2MC6 A;  4ZYE A;  5F3W A;  2EOX A;  2G7H A;  2VQF E;  2L92 A;  4BHC A; 
#chains in the Genus database with same CATH homology
 2WBS A;  4WSG A;  2YTJ A;  4F6N A;  2CTD A;  2EOE A;  2EMK A;  2YSO A;  1TN9 A;  2EQ0 A;  4R2A A;  2YTN A;  4R2R A;  2EOJ A;  2EQ1 A;  2EL6 A;  2EMY A;  2EL4 A;  2YTO A;  1AAY A;  2ENA A;  1LLM C;  3MHS C;  1A1K A;  1UN6 B;  2EM4 A;  2EJ4 A;  2EPX A;  2GLI A;  2DLQ A;  2EMC A;  2VRD A;  4IJD A;  2CSH A;  5KL5 A;  2NAB A;  2J7J A;  4FK5 C;  1YUI A;  2EOQ A;  2EN3 A;  2ENC A;  2EPP A;  1X6E A;  1MEY C;  2LV2 A;  1YSA C;  2EN6 A;  2YTF A;  5KL3 A;  1ZAA C;  1BB8 A;  3EPJ A;  2YSP A;  2ENH A;  2EMI A;  2RSI A;  1DGC A;  2YTI A;  4F2J C;  2RPC A;  4R2Q A;  1Z1B A;  2GHF A;  2DGC A;  2EN7 A;  2EOF A;  2EPC A;  4R2C A;  2YTD A;  2YTG A;  4F6M A;  2EMA A;  1X5W A;  4M9V C;  1WJP A;  2EM5 A;  2EPR A;  2EPU A;  2YTE A;  2EOI A;  2YU5 A;  2EMF A;  2EOY A;  2EM2 A;  2WBU A;  1YUJ A;  1BBO A;  2YRM A;  2EP3 A;  2HGH A;  2ELZ A;  1UBD C;  2EM3 A;  1G2F C;  2EML A;  1TF6 A;  2EOR A;  2EE8 A;  1NCS A;  1F2I G;  1P47 A;  2EMW A;  3EPK A;  2JP9 A;  2D9H A;  1A1H A;  2EQ3 A;  2MDG A;  2EM6 A;  2EN2 A;  2R1F A;  2YTQ A;  1G2D C;  3UK3 C;  2EOS A;  2DRP A;  2EM9 A;  4R2P A;  2LO3 A;  3EPH A;  2YU8 A;  1JK1 A;  1RMD A;  2EOZ A;  2JPA A;  5KL2 A;  4IS1 C;  1A1J A;  2WCC 3;  1A1G A;  1X6H A;  2EM0 A;  3EPL A;  4GZN C;  2CT1 A;  3VHT B;  4X9J A;  2LVH A;  1TF3 A;  2E72 A;  2EL5 A;  2EPA A;  2EMH A;  2EMZ A;  2ADR A;  1X6F A;  4R2D A;  2EM7 A;  1B69 A;  2EN4 A;  5KL7 A;  1KJK A;  2EN1 A;  2ELY A;  2MKD A;  2DLK A;  5KL4 A;  2LCE A;  2EPZ A;  2LT7 A;  2YTP A;  2BB8 A;  2EN8 A;  1A1F A;  1A1L A;  2EMX A;  2WBT A;  1X3C A;  5KL6 A;  4R2E A;  2EMB A;  1JK2 A;  2M9A A;  2YRH A;  2EOO A;  4R2S A;  2A25 A;  2EOX A;  1ZU1 A;  2MKN A;  3MHH C;  2PRT A;  2EOH A;  2EOM A;  1A1I A;  2YRK A;  3M99 B;  1ZR9 A;  2DMI A;  2EM8 A;  2EMG A;  2I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...