2RPCA

Solution structure of the tandem zf-c2h2 domains from the human zinc finger protein zic 3
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
155
structure length
155
Chain Sequence
GSSGSSGQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein ZIC 3
publication title Functional and structural basis of the nuclear localization signal in the ZIC3 zinc finger domain
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rpcA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rpcA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rpcA01
2EPPA 4IS1C 2DLQA 1A1FA 2DMIA 2EN8A 2A25A 4M9VC 2EQ1A 1ZU1A 2EMFA 4R2QA 1WJPA 2EN1A 5KL3A 1NCSA 2EMYA 2YTOA 2EM5A 2YTQA 2ADRA 2ENCA 2DRPA 2EOIA 2EOJA 2EMXA 2EM2A 2EL5A 4F6MA 1X5WA 2EOYA 2GHFA 2ENAA 2LV2A 1ZR9A 2YTPA 4R2CA 1ZAAC 2ENHA 1MEYC 1YUJA 2EM0A 2YRHA 1RMDA 2CSHA 2EOMA 2EMZA 3MHHC 1F2IG 2EN7A 2YTIA 2CTDA 2D9HA 2EMCA 4F2JC 4FK5C 2JP9A 2EOOA 2EPZA 4R2AA 2EPUA 3UK3C 1YSAC 2RSIA 2EPRA 2EPXA 2RPCA 2YTGA 2YTJA 3M99B 4R2EA 2EMHA 1UBDC 2LCEA 2EMBA 2WBTA 2M9AA 2WCC3 2EMGA 2EJ4A 2EE8A 2DGCA 1TF6A 3EPJA 3VHTB 1UN6B 2NABA 4X9JA 1JK1A 1A1LA 1AAYA 2I13A 2J7JA 1B69A 1G2DC 2EM6A 2PRTA 2EL6A 1X3CA 2EM3A 2MKDA 2EQ3A 2YU8A 2LT7A 1DGCA 2EN3A 4R2PA 2EMLA 2EOQA 1Z1BA 2WBSA 2BB8A 2EPCA 5KL2A 4R2RA 2MKNA 2EORA 4WSGA 1A1HA 2EOHA 2EOEA 1A1IA 2EM4A 1X6FA 2EQ0A 4GZNC 2EOZA 3EPKA 2EL4A 2E72A 2LVHA 3EPLA 1BBOA 4R2SA 2MDGA 2EN2A 2EMWA 2HGHA 1A1JA 2EMKA 1A1GA 2ELYA 5KL4A 5KL7A 2EM9A 2DLKA 2GLIA 1A1KA 2ELZA 1P47A 2R1FA 1BB8A 5KL6A 1TN9A 2EOXA 3MHSC 2YSPA 2YTEA 1JK2A 1X6EA 2LO3A 2EPAA 2YRMA 1KJKA 2EOSA 1X6HA 2EMIA 2WBUA 5KL5A 2YRKA 4IJDA 1LLMC 1YUIA 1G2FC 2EOFA 2YTDA 4R2DA 1TF3A 2EM7A 2JPAA 2YSOA 2YTNA 2EM8A 2CT1A 2EP3A 2YU5A 3EPHA 2EN6A 2YTFA 4F6NA 2VRDA 2EMAA 2EN4A
chains in the Genus database with same CATH superfamily
2LBSB 2DMIA 4X64E 2A25A 2EMFA 2K4VA 1WJPA 2R76A 4GKKE 4LU9A 4DMIA 2EM5A 1WHNA 1DI2A 2DRPA 4DR1E 4DR7E 2EM2A 2LUQA 4F6MA 1IBKE 2MC6A 2L8TA 1PJSA 4JI2E 2ENAA 5T6JA 1ZR9A 2EWLA 2UUBE 4N4RB 4KWYA 4AQYE 4R2CA 4JI5E 4GKJE 4OX9E 2EM0A 3MHHC 1F2IG 5A6BA 2CTDA 4FK5C 1YYOA 4R2AA 3UK3C 2EPUA 3M99B 1BBGA 2EPXA 2RS6A 4R2EA 2RSMA 4DV5E 4DV6E 5LMUE 2LCEA 2B3TB 3HTXA 2DGCA 1HNXE 2FGGA 2YT4A 3VHTB 1FKAE 2NABA 1UN6B 2DIXA 2UXBE 1ZBTA 1G2DC 5ADZA 3IWCA 2PRTA 1N32E 1X3CA 3ECRA 2MKDA 4DV2E 4DUYE 1HNWE 2DMYA 2YU8A 3ZOQB 1DGCA 4LF5E 2JR1A 2E5LE 2EOQA 1Z1BA 1N34E 2EPCA 5IT9C 4R2RA 3F6HA 4WSGA 1A1HA 2MKNA 2EOEA 1A1IA 3J81C 3OTOE 3FIGA 3EPKA 2N3HA 2RS7A 2WZOA 2LVHA 3OMLA 1XNRE 4P7DA 1QNTA 4YY3E 2MDGA 5AE1A 1YYWA 4LF4E 2LTSA 1PKPA 4BC9A 3ADGA 5IV8B 1PDAA 2IHR1 2EM9A 4DV3E 4F9CB 2ELZA 2R1FA 5LMNE 3KZYA 3MHSC 2EOXA 2KHXA 3HXLA 3J80C 3K6QA 2EPLX 2EMIA 5BR8E 2WBUA 4IJDA 4WX9A 3C6MA 4HTGA 3EQ1A 2EOFA 2EPMX 3LLHA 2EM7A 3HPZA 4M30A 2JPAA 2HHHE 4BHBA 3DF6A 1UHZA 1IQOA 2VRDA 4Q35B 2YU5A 2EN4A 3T1HE 4B3ME 1N36E 4RH8A 2M4IA 2L3JA 1QU6A 4R2QA 4X62E 2EN1A 5A2QC 2EMYA 2DB2A 2N3GA 2Q8UA 2YTQA 3THNA 2KONA 2EOIA 2EMXA 3IWBA 1J5EE 2UU9E 1X5WA 4BC7A 2GHFA 4LF7E 4LFCE 4X66E 5IWAE 2VE7C 3ADIA 4P78A 1N33E 4ZYGA 1YFHA 2YRHA 2EOMA 4LFAE 2EOOA 2EPZA 2RSIA 2VQEE 4RHBB 1EH7A 2KOUA 3BIDA 1PJQA 1TF6A 1RC7A 2B7TA 1JK1A 2I13A 2J7JA 1X48A 5IXMB 2HJJA 2EM6A 4O4KA 2MC5A 4LTYA 2EL6A 2HC5A 2LRSA 2EM3A 2YWQA 5A69A 3JTZA 2LT7A 2EN3A 2EMLA 1DQ3A 2WBSA 2NUFA 1WRJA 1T4OA 1I94E 2L92A 4L8NA 1X6FA 2EQ0A 4GEQB 4HEIA 4TUGA 4GZNC 4BBYA 3JU0A 2E72A 5DNYA 2B9DA 3TQMA 2YZTA 3JAMC 2UUAE 1L4SA 3IWDA 1EH8A 3H09A 2L2NA 1T38A 5KL4A 4WXDA 2GLIA 2JOBA 1A1KA 1P47A 4B3TE 2EPKX 5KL6A 2YSPA 1X6EA 3L00A 4O43A 4NXME 2G7HA 4LF9E 2V89A 1X6HA 5F3WA 4JI4E 5KL5A 1GQEA 2YRKA 4X8WA 2VF1A 1YZ9A 4F9AB 1G2FC 4MLVA 2JVAA 2E1MA 3ADLA 2NA2A 2UXCE 3QG5C 4O24A 2EN6A 4WSPA 4F6NA 2NUEA 1X47A 4DR6E 3VYYA 4NZVA 2DLQA 2FTXB 1A1FA 2EN8A 2ODRC 4DKKA 3VYXA 2LTRA 5KL3A 4NHRA 1GZ6A 5AE2A 4JI6E 2EOJA 4M0VA 4Q28A 3J7AG 2EOYA 2V83A 2LV2A 3T1YE 1GTKA 2MDRA 1ZAAC 2JY9A 3BGHA 1MEYC 4DV7E 1IQSA 5A6JA 2RTXA 1YUJA 1HR0E 2EMZA 2UXDE 2YTIA 2EMCA 2D9HA 2JYAA 4F2JC 2M7QA 1FJGE 2V86A 2RPCA 2EMHA 2FV4B 2V87A 5CFFE 1UBDC 5LLQA 2WCC3 2M9AA 4JI1E 2EJ4A 5LL6R 4DUZE 2EE8A 2K7IA 2EPNA 2N8XA 1XMOE 1XMQE 3BF2A 4BHCA 2F4VE 5AC5A 2YPNA 2L33A 2EQ3A 1X49A 4R2PA 1AH5A 2LUPB 5KL2A 2EOHA 4I8OA 4BCAA 1N3GA 2EOZA 2V8QB 2V85A 4WXCA 4NXNE 2LJUA 2EL4A 4X65E 4R8OA 3J7Yp 4R2SA 1MGTA 2EN2A 4L5NC 1A1JA 4KZSA 4LFBE 1A1GA 4TUIA 4WPYA 2DLKA 4DR4E 1IMUA 5TSEA 1TN9A 3KWRA 1JK2A 2LO3A 2YRMA 2EOSA 4KHPE 5AASA 4YHHE 1J26A 1LLMC 4WYQB 1NEIA 3THOB 2YTDA 4DR3E 3DJWA 1TF3A 2YSOA 2B7VA 4F9BB 1T39A 2EM8A 2CT1A 2LE2A 1SR9A 1T4NA 3EPHA 2EZ6A 3KZZA 2DSYA 2EMAA 1YPNA 2EPPA 4IS1C 3HQ1A 4B3RE 1XNQE 4M9VC 2EQ1A 1ZU1A 2I9IA 3AUZA 4ZYDA 5AC4A 1NCSA 1HNZE 4JI3E 5FLXC 2YTOA 3RMPA 2H36X 4BMJA 2ADRA 2ENCA 1EKZA 3BBGA 3C4TA 4ZYEA 2EL5A 2L6MA 1RQ0A 3C4BA 2YTPA 4J8ZA 3ADJA 2ENHA 1T4LB 4BS9A 1RMDA 3P1XA 2CSHA 2ZM6E 2EN7A 2V88A 4DR5E 2EPOA 1IBME 3VK6A 2JP9A 5AE3A 2VQFE 1YSAC 2EPRA 1UILA 2YTGA 2YTJA 4F54A 2UUCE 4DV1E 1SFEA 4DV4E 2EMBA 2WBTA 2EMGA 2LJHA 5A6KA 3EPJA 4R03A 4WFTA 4X9JA 4M2ZA 1EH6A 1A1LA 2GPIA 1AAYA 2JXPA 1B69A 2LMZA 2F8BA 4K0KE 4JI7E 4OOGC 5A6AA 1IBLE 2JOXA 4B3SE 1O0WA 1KYQA 2BB8A 1STUA 2EORA 4JI0E 2BBGA 2EM4A 4LF8E 2CPNA 3MSWA 3EPLA 1WXRA 1BBOA 2NUGA 3LMLA 2EMWA 2HGHA 2EMKA 4JYAE 3F6GA 4DR2E 2ELYA 1WHQA 3AV0A 5KL7A 2ODRD 4MLQA 1BB8A 4JV5E 4O5GA 4LF6E 5A6BD 2YTEA 2EPAA 1KJKA 1ZBQA 2L2MA 1PJTA 1YUIA 2M1SA 3C6KA 4DV0E 4R2DA 3HPSA 1YYKA 2YTNA 2EP3A 2RQLA 4JI8E 2L2KB 2YTFA 2JWOA 4ZYHA 2L3CA
chains in the Genus database with same CATH topology
2EPPA 4IS1C 2DLQA 1A1FA 2DMIA 2EN8A 2A25A 4M9VC 2EQ1A 1ZU1A 2EMFA 4R2QA 1WJPA 2EN1A 5KL3A 1NCSA 2EMYA 2YTOA 2EM5A 2YTQA 2ADRA 2ENCA 2DRPA 2EOIA 2EOJA 2EMXA 2EM2A 2EL5A 4F6MA 1X5WA 2EOYA 2GHFA 2ENAA 2LV2A 1ZR9A 2YTPA 4R2CA 1ZAAC 2ENHA 1MEYC 1YUJA 2EM0A 2YRHA 1RMDA 2CSHA 2EOMA 2EMZA 3MHHC 1F2IG 2EN7A 2YTIA 2CTDA 2D9HA 2EMCA 4F2JC 4FK5C 2JP9A 2EOOA 2EPZA 4R2AA 2EPUA 3UK3C 1YSAC 2RSIA 2EPRA 2EPXA 2RPCA 2YTGA 2YTJA 3M99B 4R2EA 2EMHA 1UBDC 2LCEA 2EMBA 2WBTA 2M9AA 2WCC3 2EMGA 2EJ4A 2EE8A 2DGCA 1TF6A 3EPJA 3VHTB 1UN6B 2NABA 4X9JA 1JK1A 1A1LA 1AAYA 2I13A 2J7JA 1B69A 1G2DC 2EM6A 2PRTA 2EL6A 1X3CA 2EM3A 2MKDA 2EQ3A 2YU8A 2LT7A 1DGCA 2EN3A 4R2PA 2EMLA 2EOQA 1Z1BA 2WBSA 2BB8A 2EPCA 5KL2A 4R2RA 2MKNA 2EORA 4WSGA 1A1HA 2EOHA 2EOEA 1A1IA 2EM4A 1X6FA 2EQ0A 4GZNC 2EOZA 3EPKA 2EL4A 2E72A 2LVHA 3EPLA 1BBOA 4R2SA 2MDGA 2EN2A 2EMWA 2HGHA 1A1JA 2EMKA 1A1GA 2ELYA 5KL4A 5KL7A 2EM9A 2DLKA 2GLIA 1A1KA 2ELZA 1P47A 2R1FA 1BB8A 5KL6A 1TN9A 2EOXA 3MHSC 2YSPA 2YTEA 1JK2A 1X6EA 2LO3A 2EPAA 2YRMA 1KJKA 2EOSA 1X6HA 2EMIA 2WBUA 5KL5A 2YRKA 4IJDA 1LLMC 1YUIA 1G2FC 2EOFA 2YTDA 4R2DA 1TF3A 2EM7A 2JPAA 2YSOA 2YTNA 2EM8A 2CT1A 2EP3A 2YU5A 3EPHA 2EN6A 2YTFA 4F6NA 2VRDA 2EMAA 2EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPP A;  4IS1 C;  2DLQ A;  1A1F A;  2DMI A;  2EN8 A;  2A25 A;  4M9V C;  2EQ1 A;  1ZU1 A;  2EMF A;  4R2Q A;  1WJP A;  2EN1 A;  5KL3 A;  1NCS A;  2EMY A;  2YTO A;  2EM5 A;  2YTQ A;  2ADR A;  2ENC A;  2DRP A;  2EOI A;  2EOJ A;  2EMX A;  2EM2 A;  2EL5 A;  4F6M A;  1X5W A;  2EOY A;  2GHF A;  2ENA A;  2LV2 A;  1ZR9 A;  2YTP A;  4R2C A;  1ZAA C;  2ENH A;  1MEY C;  1YUJ A;  2EM0 A;  2YRH A;  1RMD A;  2CSH A;  2EOM A;  2EMZ A;  3MHH C;  1F2I G;  2EN7 A;  2YTI A;  2CTD A;  2D9H A;  2EMC A;  4F2J C;  4FK5 C;  2JP9 A;  2EOO A;  2EPZ A;  4R2A A;  2EPU A;  3UK3 C;  1YSA C;  2RSI A;  2EPR A;  2EPX A;  2RPC A;  2YTG A;  2YTJ A;  3M99 B;  4R2E A;  2EMH A;  1UBD C;  2LCE A;  2EMB A;  2WBT A;  2M9A A;  2WCC 3;  2EMG A;  2EJ4 A;  2EE8 A;  2DGC A;  1TF6 A;  3EPJ A;  3VHT B;  1UN6 B;  2NAB A;  4X9J A;  1JK1 A;  1A1L A;  1AAY A;  2I13 A;  2J7J A;  1B69 A;  1G2D C;  2EM6 A;  2PRT A;  2EL6 A;  1X3C A;  2EM3 A;  2MKD A;  2EQ3 A;  2YU8 A;  2LT7 A;  1DGC A;  2EN3 A;  4R2P A;  2EML A;  2EOQ A;  1Z1B A;  2WBS A;  2BB8 A;  2EPC A;  5KL2 A;  4R2R A;  2MKN A;  2EOR A;  4WSG A;  1A1H A;  2EOH A;  2EOE A;  1A1I A;  2EM4 A;  1X6F A;  2EQ0 A;  4GZN C;  2EOZ A;  3EPK A;  2EL4 A;  2E72 A;  2LVH A;  3EPL A;  1BBO A;  4R2S A;  2MDG A;  2EN2 A;  2EMW A;  2HGH A;  1A1J A;  2EMK A;  1A1G A;  2ELY A;  5KL4 A;  5KL7 A;  2EM9 A;  2DLK A;  2GLI A;  1A1K A;  2ELZ A;  1P47 A;  2R1F A;  1BB8 A;  5KL6 A;  1TN9 A;  2EOX A;  3MHS C;  2YSP A;  2YTE A;  1JK2 A;  1X6E A;  2LO3 A;  2EPA A;  2YRM A;  1KJK A;  2EOS A;  1X6H A;  2EMI A;  2WBU A;  5KL5 A;  2YRK A;  4IJD A;  1LLM C;  1YUI A;  1G2F C;  2EOF A;  2YTD A;  4R2D A;  1TF3 A;  2EM7 A;  2JPA A;  2YSO A;  2YTN A;  2EM8 A;  2CT1 A;  2EP3 A;  2YU5 A;  3EPH A;  2EN6 A;  2YTF A;  4F6N A;  2VRD A;  2EMA A;  2EN4 A; 
#chains in the Genus database with same CATH topology
 2LBS B;  2DMI A;  4X64 E;  2A25 A;  2EMF A;  2K4V A;  1WJP A;  2R76 A;  4GKK E;  4LU9 A;  4DMI A;  2EM5 A;  1WHN A;  1DI2 A;  2DRP A;  4DR1 E;  4DR7 E;  2EM2 A;  2LUQ A;  4F6M A;  1IBK E;  2MC6 A;  2L8T A;  1PJS A;  4JI2 E;  2ENA A;  5T6J A;  1ZR9 A;  2EWL A;  2UUB E;  4N4R B;  4KWY A;  4AQY E;  4R2C A;  4JI5 E;  4GKJ E;  4OX9 E;  2EM0 A;  3MHH C;  1F2I G;  5A6B A;  2CTD A;  4FK5 C;  1YYO A;  4R2A A;  3UK3 C;  2EPU A;  3M99 B;  1BBG A;  2EPX A;  2RS6 A;  4R2E A;  2RSM A;  4DV5 E;  4DV6 E;  5LMU E;  2LCE A;  2B3T B;  3HTX A;  2DGC A;  1HNX E;  2FGG A;  2YT4 A;  3VHT B;  1FKA E;  2NAB A;  1UN6 B;  2DIX A;  2UXB E;  1ZBT A;  1G2D C;  5ADZ A;  3IWC A;  2PRT A;  1N32 E;  1X3C A;  3ECR A;  2MKD A;  4DV2 E;  4DUY E;  1HNW E;  2DMY A;  2YU8 A;  3ZOQ B;  1DGC A;  4LF5 E;  2JR1 A;  2E5L E;  2EOQ A;  1Z1B A;  1N34 E;  2EPC A;  5IT9 C;  4R2R A;  3F6H A;  4WSG A;  1A1H A;  2MKN A;  2EOE A;  1A1I A;  3J81 C;  3OTO E;  3FIG A;  3EPK A;  2N3H A;  2RS7 A;  2WZO A;  2LVH A;  3OML A;  1XNR E;  4P7D A;  1QNT A;  4YY3 E;  2MDG A;  5AE1 A;  1YYW A;  4LF4 E;  2LTS A;  1PKP A;  4BC9 A;  3ADG A;  5IV8 B;  1PDA A;  2IHR 1;  2EM9 A;  4DV3 E;  4F9C B;  2ELZ A;  2R1F A;  5LMN E;  3KZY A;  3MHS C;  2EOX A;  2KHX A;  3HXL A;  3J80 C;  3K6Q A;  2EPL X;  2EMI A;  5BR8 E;  2WBU A;  4IJD A;  4WX9 A;  3C6M A;  4HTG A;  3EQ1 A;  2EOF A;  2EPM X;  3LLH A;  2EM7 A;  3HPZ A;  4M30 A;  2JPA A;  2HHH E;  4BHB A;  3DF6 A;  1UHZ A;  1IQO A;  2VRD A;  4Q35 B;  2YU5 A;  2EN4 A;  3T1H E;  4B3M E;  1N36 E;  4RH8 A;  2M4I A;  2L3J A;  1QU6 A;  4R2Q A;  4X62 E;  2EN1 A;  5A2Q C;  2EMY A;  2DB2 A;  2N3G A;  2Q8U A;  2YTQ A;  3THN A;  2KON A;  2EOI A;  2EMX A;  3IWB A;  1J5E E;  2UU9 E;  1X5W A;  4BC7 A;  2GHF A;  4LF7 E;  4LFC E;  4X66 E;  5IWA E;  2VE7 C;  3ADI A;  4P78 A;  1N33 E;  4ZYG A;  1YFH A;  2YRH A;  2EOM A;  4LFA E;  2EOO A;  2EPZ A;  2RSI A;  2VQE E;  4RHB B;  1EH7 A;  2KOU A;  3BID A;  1PJQ A;  1TF6 A;  1RC7 A;  2B7T A;  1JK1 A;  2I13 A;  2J7J A;  1X48 A;  5IXM B;  2HJJ A;  2EM6 A;  4O4K A;  2MC5 A;  4LTY A;  2EL6 A;  2HC5 A;  2LRS A;  2EM3 A;  2YWQ A;  5A69 A;  3JTZ A;  2LT7 A;  2EN3 A;  2EML A;  1DQ3 A;  2WBS A;  2NUF A;  1WRJ A;  1T4O A;  1I94 E;  2L92 A;  4L8N A;  1X6F A;  2EQ0 A;  4GEQ B;  4HEI A;  4TUG A;  4GZN C;  4BBY A;  3JU0 A;  2E72 A;  5DNY A;  2B9D A;  3TQM A;  2YZT A;  3JAM C;  2UUA E;  1L4S A;  3IWD A;  1EH8 A;  3H09 A;  2L2N A;  1T38 A;  5KL4 A;  4WXD A;  2GLI A;  2JOB A;  1A1K A;  1P47 A;  4B3T E;  2EPK X;  5KL6 A;  2YSP A;  1X6E A;  3L00 A;  4O43 A;  4NXM E;  2G7H A;  4LF9 E;  2V89 A;  1X6H A;  5F3W A;  4JI4 E;  5KL5 A;  1GQE A;  2YRK A;  4X8W A;  2VF1 A;  1YZ9 A;  4F9A B;  1G2F C;  4MLV A;  2JVA A;  2E1M A;  3ADL A;  2NA2 A;  2UXC E;  3QG5 C;  4O24 A;  2EN6 A;  4WSP A;  4F6N A;  2NUE A;  1X47 A;  4DR6 E;  3VYY A;  4NZV A;  2DLQ A;  2FTX B;  1A1F A;  2EN8 A;  2ODR C;  4DKK A;  3VYX A;  2LTR A;  5KL3 A;  4NHR A;  1GZ6 A;  5AE2 A;  4JI6 E;  2EOJ A;  4M0V A;  4Q28 A;  3J7A G;  2EOY A;  2V83 A;  2LV2 A;  3T1Y E;  1GTK A;  2MDR A;  1ZAA C;  2JY9 A;  3BGH A;  1MEY C;  4DV7 E;  1IQS A;  5A6J A;  2RTX A;  1YUJ A;  1HR0 E;  2EMZ A;  2UXD E;  2YTI A;  2EMC A;  2D9H A;  2JYA A;  4F2J C;  2M7Q A;  1FJG E;  2V86 A;  2RPC A;  2EMH A;  2FV4 B;  2V87 A;  5CFF E;  1UBD C;  5LLQ A;  2WCC 3;  2M9A A;  4JI1 E;  2EJ4 A;  5LL6 R;  4DUZ E;  2EE8 A;  2K7I A;  2EPN A;  2N8X A;  1XMO E;  1XMQ E;  3BF2 A;  4BHC A;  2F4V E;  5AC5 A;  2YPN A;  2L33 A;  2EQ3 A;  1X49 A;  4R2P A;  1AH5 A;  2LUP B;  5KL2 A;  2EOH A;  4I8O A;  4BCA A;  1N3G A;  2EOZ A;  2V8Q B;  2V85 A;  4WXC A;  4NXN E;  2LJU A;  2EL4 A;  4X65 E;  4R8O A;  3J7Y p;  4R2S A;  1MGT A;  2EN2 A;  4L5N C;  1A1J A;  4KZS A;  4LFB E;  1A1G A;  4TUI A;  4WPY A;  2DLK A;  4DR4 E;  1IMU A;  5TSE A;  1TN9 A;  3KWR A;  1JK2 A;  2LO3 A;  2YRM A;  2EOS A;  4KHP E;  5AAS A;  4YHH E;  1J26 A;  1LLM C;  4WYQ B;  1NEI A;  3THO B;  2YTD A;  4DR3 E;  3DJW A;  1TF3 A;  2YSO A;  2B7V A;  4F9B B;  1T39 A;  2EM8 A;  2CT1 A;  2LE2 A;  1SR9 A;  1T4N A;  3EPH A;  2EZ6 A;  3KZZ A;  2DSY A;  2EMA A;  1YPN A;  2EPP A;  4IS1 C;  3HQ1 A;  4B3R E;  1XNQ E;  4M9V C;  2EQ1 A;  1ZU1 A;  2I9I A;  3AUZ A;  4ZYD A;  5AC4 A;  1NCS A;  1HNZ E;  4JI3 E;  5FLX C;  2YTO A;  3RMP A;  2H36 X;  4BMJ A;  2ADR A;  2ENC A;  1EKZ A;  3BBG A;  3C4T A;  4ZYE A;  2EL5 A;  2L6M A;  1RQ0 A;  3C4B A;  2YTP A;  4J8Z A;  3ADJ A;  2ENH A;  1T4L B;  4BS9 A;  1RMD A;  3P1X A;  2CSH A;  2ZM6 E;  2EN7 A;  2V88 A;  4DR5 E;  2EPO A;  1IBM E;  3VK6 A;  2JP9 A;  5AE3 A;  2VQF E;  1YSA C;  2EPR A;  1UIL A;  2YTG A;  2YTJ A;  4F54 A;  2UUC E;  4DV1 E;  1SFE A;  4DV4 E;  2EMB A;  2WBT A;  2EMG A;  2LJH A;  5A6K A;  3EPJ A;  4R03 A;  4WFT A;  4X9J A;  4M2Z A;  1EH6 A;  1A1L A;  2GPI A;  1AAY A;  2JXP A;  1B69 A;  2LMZ A;  2F8B A;  4K0K E;  4JI7 E;  4OOG C;  5A6A A;  1IBL E;  2JOX A;  4B3S E;  1O0W A;  1KYQ A;  2BB8 A;  1STU A;  2EOR A;  4JI0 E;  2BBG A;  2EM4 A;  4LF8 E;  2CPN A;  3MSW A;  3EPL A;  1WXR A;  1BBO A;  2NUG A;  3LML A;  2EMW A;  2HGH A;  2EMK A;  4JYA E;  3F6G A;  4DR2 E;  2ELY A;  1WHQ A;  3AV0 A;  5KL7 A;  2ODR D;  4MLQ A;  1BB8 A;  4JV5 E;  4O5G A;  4LF6 E;  5A6B D;  2YTE A;  2EPA A;  1KJK A;  1ZBQ A;  2L2M A;  1PJT A;  1YUI A;  2M1S A;  3C6K A;  4DV0 E;  4R2D A;  3HPS A;  1YYK A;  2YTN A;  2EP3 A;  2RQL A;  4JI8 E;  2L2K B;  2YTF A;  2JWO A;  4ZYH A;  2L3C A; 
#chains in the Genus database with same CATH homology
 2EPP A;  4IS1 C;  2DLQ A;  1A1F A;  2DMI A;  2EN8 A;  2A25 A;  4M9V C;  2EQ1 A;  1ZU1 A;  2EMF A;  4R2Q A;  1WJP A;  2EN1 A;  5KL3 A;  1NCS A;  2EMY A;  2YTO A;  2EM5 A;  2YTQ A;  2ADR A;  2ENC A;  2DRP A;  2EOI A;  2EOJ A;  2EMX A;  2EM2 A;  2EL5 A;  4F6M A;  1X5W A;  2EOY A;  2GHF A;  2ENA A;  2LV2 A;  1ZR9 A;  2YTP A;  4R2C A;  1ZAA C;  2ENH A;  1MEY C;  1YUJ A;  2EM0 A;  2YRH A;  1RMD A;  2CSH A;  2EOM A;  2EMZ A;  3MHH C;  1F2I G;  2EN7 A;  2YTI A;  2CTD A;  2D9H A;  2EMC A;  4F2J C;  4FK5 C;  2JP9 A;  2EOO A;  2EPZ A;  4R2A A;  2EPU A;  3UK3 C;  1YSA C;  2RSI A;  2EPR A;  2EPX A;  2RPC A;  2YTG A;  2YTJ A;  3M99 B;  4R2E A;  2EMH A;  1UBD C;  2LCE A;  2EMB A;  2WBT A;  2M9A A;  2WCC 3;  2EMG A;  2EJ4 A;  2EE8 A;  2DGC A;  1TF6 A;  3EPJ A;  3VHT B;  1UN6 B;  2NAB A;  4X9J A;  1JK1 A;  1A1L A;  1AAY A;  2I13 A;  2J7J A;  1B69 A;  1G2D C;  2EM6 A;  2PRT A;  2EL6 A;  1X3C A;  2EM3 A;  2MKD A;  2EQ3 A;  2YU8 A;  2LT7 A;  1DGC A;  2EN3 A;  4R2P A;  2EML A;  2EOQ A;  1Z1B A;  2WBS A;  2BB8 A;  2EPC A;  5KL2 A;  4R2R A;  2MKN A;  2EOR A;  4WSG A;  1A1H A;  2EOH A;  2EOE A;  1A1I A;  2EM4 A;  1X6F A;  2EQ0 A;  4GZN C;  2EOZ A;  3EPK A;  2EL4 A;  2E72 A;  2LVH A;  3EPL A;  1BBO A;  4R2S A;  2MDG A;  2EN2 A;  2EMW A;  2HGH A;  1A1J A;  2EMK A;  1A1G A;  2ELY A;  5KL4 A;  5KL7 A;  2EM9 A;  2DLK A;  2GLI A;  1A1K A;  2ELZ A;  1P47 A;  2R1F A;  1BB8 A;  5KL6 A;  1TN9 A;  2EOX A;  3MHS C;  2YSP A;  2YTE A;  1JK2 A;  1X6E A;  2LO3 A;  2EPA A;  2YRM A;  1KJK A;  2EOS A;  1X6H A;  2EMI A;  2WBU A;  5KL5 A;  2YRK A;  4IJD A;  1LLM C;  1YUI A;  1G2F C;  2EOF A;  2YTD A;  4R2D A;  1TF3 A;  2EM7 A;  2JPA A;  2YSO A;  2YTN A;  2EM8 A;  2CT1 A;  2EP3 A;  2YU5 A;  3EPH A;  2EN6 A;  2YTF A;  4F6N A;  2VRD A;  2EMA A;  2EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...