2RPCA

Solution structure of the tandem zf-c2h2 domains from the human zinc finger protein zic 3
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
155
structure length
155
Chain Sequence
b'GSSGSSGQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein ZIC 3
publication title Functional and structural basis of the nuclear localization signal in the ZIC3 zinc finger domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rpcA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rpcA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2rpcA01
1A1LA 2CTDA 2EN4A 2DLKA 2MKDA 2EM0A 2EMCA 4F6MA 1Z1BA 2YTIA 4R2CA 4R2QA 2EOEA 4IS1C 3EPJA 1G2DC 1TF3A 2EPAA 2DMIA 4X9JA 2EMYA 2EL4A 1A1FA 2WBUA 2EM6A 2EOXA 1TN9A 1RMDA 2EM3A 4M9VC 1UBDC 2D9HA 2R1FA 2YRHA 2EPZA 1F2IG 2ENAA 2EOIA 2EPPA 1YSAC 2GHFA 2LO3A 2WBTA 1KJKA 2VRDA 5KL5A 2MDGA 2EMFA 3EPHA 2LVHA 1UN6B 2EOYA 2PRTA 3MHHC 4R2AA 2EMXA 2EMGA 1DGCA 5KL6A 5KL4A 2I13A 2CSHA 2EOQA 2EN1A 2YSPA 2EPXA 2YSOA 2YTJA 1ZU1A 2YU8A 4R2SA 2EM7A 2YTOA 2ELZA 2EMKA 1X6EA 2BB8A 2EMBA 2LT7A 1AAYA 4R2RA 2ENHA 2EP3A 2LCEA 1WJPA 2EOFA 2M9AA 3MHSC 2CT1A 2EQ0A 2YRKA 2EOJA 1B69A 2HGHA 1TF6A 2EQ1A 2EMLA 2EL6A 2EOMA 2ELYA 2EM5A 2EE8A 1BB8A 2WBSA 1NCSA 1X6HA 2E72A 2EPUA 2EMHA 4R2PA 2WCC3 2EMWA 2YRMA 1YUJA 2EN2A 2NABA 2YTPA 2YU5A 2YTGA 2RPCA 2EOOA 2DLQA 4R2DA 3EPLA 1YUIA 5KL7A 2EM4A 1A1GA 2EL5A 2JP9A 2YTNA 2EOHA 1A1HA 3M99B 1JK2A 1A1KA 2J7JA 4GZNC 2EM8A 2EPRA 2RSIA 2EN6A 2EORA 4FK5C 4F2JC 2EQ3A 4F6NA 2ADRA 1X6FA 2DGCA 3UK3C 2EN8A 2EMAA 2A25A 3VHTB 1ZR9A 2EN7A 2EPCA 2YTEA 2MKNA 2ENCA 2EJ4A 5KL2A 1A1JA 2EMIA 4R2EA 2YTDA 4IJDA 3EPKA 2EOSA 1X3CA 2EM2A 1BBOA 1ZAAC 2GLIA 2YTFA 5KL3A 1JK1A 1G2FC 1P47A 1MEYC 2JPAA 2EMZA 1A1IA 1X5WA 2DRPA 2LV2A 2EM9A 2EOZA 2YTQA 2EN3A 1LLMC 4WSGA
chains in the Genus database with same CATH superfamily
1FJGE 1SFEA 4HTGA 2CTDA 2V87A 3AV0A 5TSEA 3VK6A 5A6JA 4DV3E 1EH6A 2YZTA 3F6GA 4ZYHA 3ECRA 2UUBE 2FTXB 1EH7A 4X64E 1HNZE 2DMIA 4OX9E 2EL4A 2DB2A 2WBUA 4O24A 1YZ9A 2E5LE 2LRSA 1N34E 4TUGA 2EPZA 2JYAA 2GHFA 5KL5A 2MDGA 1GTKA 4DKKA 2LVHA 1UN6B 4R2AA 2EMXA 1DGCA 5KL4A 4WYQB 2KONA 3JU0A 2EPXA 2YTJA 2YWQA 2ELZA 2LJHA 5CFFE 2ENHA 5IWAE 2KHXA 4B3RE 1NEIA 2M9AA 4GKJE 1J26A 2DIXA 3THOB 2ELYA 5A69A 2JOXA 2EE8A 2EPOA 1BB8A 5AC5A 4LF7E 4X62E 2EPUA 3L00A 2WCC3 2DMYA 2EMWA 2YRMA 1WXRA 2YTGA 4R2DA 2EOOA 2DLQA 2YPNA 4DMIA 3EPLA 2EL5A 1EKZA 3T1YE 1YFHA 4LFAE 2JY9A 2EOHA 3BBGA 1A1KA 2J7JA 4TUIA 4JI3E 3EQ1A 1WRJA 4WX9A 4F6NA 5A2QC 2ADRA 2IHR1 1GZ6A 1X6FA 3UK3C 2NUFA 3F6HA 4MLVA 2A25A 2B7TA 2LMZA 4F9CB 1IMUA 1ZR9A 2LUQA 2EN7A 4JI7E 2EPCA 2MKNA 3J7AG 2VQEE 3HTXA 4R2EA 1X3CA 4B3TE 4JV5E 3RMPA 1T38A 2YTFA 4WSPA 4X65E 2JPAA 2CPNA 1YYOA 1WHNA 4DR6E 1DQ3A 2RTXA 2EN3A 1LLMC 2L2MA 1XNQE 1A1LA 3ADJA 4DR5E 3BGHA 2NUEA 3ADIA 4DR3E 2NUGA 1Z1BA 2YTIA 4X9JA 4DR4E 4BBYA 4ZYDA 1RMDA 4F9BB 1X47A 4DV5E 2FGGA 2L8TA 3JTZA 1YPNA 2EOIA 2EPPA 2L3CA 2LUPB 1IBKE 1KJKA 1PJSA 5IV8B 2EMFA 4B3SE 3LMLA 3IWDA 2EOYA 3LLHA 2JOBA 5FLXC 2I9IA 2B7VA 1X48A 2JR1A 3KZZA 5KL6A 5IT9C 1MGTA 2I13A 2CSHA 4DR1E 2EOQA 2EN1A 4ZYGA 4JI0E 2L6MA 2V83A 4MLQA 3VYYA 4P7DA 2K4VA 2VE7C 1IQSA 2BB8A 3QG5C 4Q35B 1AAYA 2N8XA 2EP3A 2EOFA 2EOJA 5IXMB 2EMLA 2MC5A 2EL6A 4X8WA 2UUCE 4OOGC 1N36E 4BCAA 2LJUA 1NCSA 2B9DA 2VF1A 2E72A 1YUJA 2EN2A 2MDRA 2YU5A 5A6BD 1XMQE 1EH8A 1A1GA 4LTYA 2M1SA 1N32E 1ZBTA 2N3GA 3M99B 1JK2A 4DR7E 1IBLE 5A6BA 4O5GA 4F2JC 4ZYEA 2V85A 2GPIA 3ADLA 5AASA 4JI8E 4WFTA 4O43A 1ZBQA 2G7HA 1KYQA 3VHTB 4B3ME 4NZVA 4JI1E 1PKPA 2YTEA 1HNWE 2RS7A 3ZOQB 3OMLA 5KL2A 1A1JA 4LF8E 2YTDA 4Q28A 5LL6R 4DUZE 2RS6A 1ZAAC 5KL3A 1JK1A 4KHPE 1MEYC 2EMZA 3THNA 2DRPA 2ZM6E 2LV2A 4JYAE 2EM9A 3J81C 4WSGA 3JAMC 5AE1A 1X49A 1AH5A 3DF6A 4R2QA 2EOEA 1PDAA 2EPAA 5AC4A 2EMYA 4LFCE 2NA2A 4K0KE 4I8OA 2EM6A 1TN9A 2EWLA 4M9VC 1UBDC 4JI5E 4JI2E 1I94E 2D9HA 2R1FA 2YRHA 1F2IG 2LO3A 2LTRA 2WBTA 3C6KA 4DV1E 2M4IA 2EPNA 4F54A 4WXCA 2N3HA 2VQFE 2PRTA 2HJJA 2EMGA 4LF9E 2L92A 4DR2E 4L8NA 1O0WA 2UU9E 2YU8A 1IBME 5AE3A 1ZU1A 2EM7A 4DV7E 2LT7A 3HPSA 4LU9A 4R2RA 2LCEA 5F3WA 2CT1A 2EQ0A 1T4LB 1FKAE 1QU6A 3KWRA 2HHHE 2EOMA 1T39A 5LMNE 1XNRE 4NXNE 4BS9A 2JXPA 1PJQA 4AQYE 4R2PA 2YT4A 4L5NC 4DV0E 2F8BA 2NABA 2YTPA 4DV6E 2LBSB 2MC6A 2EM4A 2YTNA 3HPZA 4JI4E 4DV2E 1UILA 4P78A 2EM8A 4GZNC 2UUAE 2EPRA 2R76A 4FK5C 3FIGA 3T1HE 2EQ3A 2L2NA 4BC7A 2JWOA 1T4OA 4RHBB 3VYXA 4WPYA 4LFBE 2L3JA 2ODRD 4NHRA 4GEQB 2EMIA 2HC5A 3MSWA 4IJDA 3EPKA 1BBOA 2GLIA 1N3GA 4LF4E 2RQLA 1X5WA 5BR8E 4RH8A 2EOZA 2YTQA 1J5EE 4N4RB 2EPMX 2EN4A 2V88A 1IQOA 2DLKA 2MKDA 1WHQA 2EPKX 5LLQA 4M0VA 2EM0A 2UXCE 2EMCA 4F6MA 4R2CA 3ADGA 2B3TB 4IS1C 4NXME 4GKKE 4BC9A 1BBGA 3EPJA 1G2DC 3KZYA 1TF3A 4JI6E 1RQ0A 3HXLA 2V89A 1A1FA 2EOXA 5A6AA 2EM3A 3IWBA 1UHZA 2V8QB 3OTOE 4YHHE 4DV4E 2ENAA 1PJTA 2DSYA 1YSAC 4KZSA 2LE2A 2VRDA 5DNYA 4J8ZA 1HNXE 1N33E 2UXBE 3EPHA 2FV4B 3MHHC 2KOUA 5AE2A 3H09A 4O4KA 3C4TA 2JVAA 4LF6E 2YSPA 2YSOA 5LMUE 4R2SA 2EZ6A 2YTOA 3J7Yp 1HR0E 2EMKA 1X6EA 2EMBA 3P1XA 4YY3E 4R8OA 1WJPA 3MHSC 2YRKA 2Q8UA 1B69A 2HGHA 1TF6A 2EQ1A 4BMJA 3J80C 3BIDA 1DI2A 2EM5A 5ADZA 4WXDA 2WBSA 2EPLX 1X6HA 2L33A 2EMHA 4LF5E 2V86A 3AUZA 3C6MA 2BBGA 2RSMA 1YYWA 1YUIA 2RPCA 2UXDE 3BF2A 5KL7A 4KWYA 4M30A 1SR9A 1XMOE 2JP9A 1RC7A 1A1HA 4R03A 1QNTA 2WZOA 2ODRC 3DJWA 5A6KA 2M7QA 2RSIA 2EN6A 2EORA 3K6QA 4DUYE 2L2KB 1STUA 3C4BA 2DGCA 2EN8A 5T6JA 2E1MA 2EMAA 3IWCA 4BHCA 3HQ1A 1GQEA 4X66E 2ENCA 2EJ4A 4BHBA 1L4SA 2EOSA 2LTSA 2EM2A 1T4NA 3TQMA 2F4VE 1G2FC 1P47A 1A1IA 2K7IA 2H36X 4M2ZA 4F9AB 1YYKA 4HEIA
chains in the Genus database with same CATH topology
1A1LA 2CTDA 2EN4A 2DLKA 2MKDA 2EM0A 2EMCA 4F6MA 1Z1BA 2YTIA 4R2CA 4R2QA 2EOEA 4IS1C 3EPJA 1G2DC 1TF3A 2EPAA 2DMIA 4X9JA 2EMYA 2EL4A 1A1FA 2WBUA 2EM6A 2EOXA 1TN9A 1RMDA 2EM3A 4M9VC 1UBDC 2D9HA 2R1FA 2YRHA 2EPZA 1F2IG 2ENAA 2EOIA 2EPPA 1YSAC 2GHFA 2LO3A 2WBTA 1KJKA 2VRDA 5KL5A 2MDGA 2EMFA 3EPHA 2LVHA 1UN6B 2EOYA 2PRTA 3MHHC 4R2AA 2EMXA 2EMGA 1DGCA 5KL6A 5KL4A 2I13A 2CSHA 2EOQA 2EN1A 2YSPA 2EPXA 2YSOA 2YTJA 1ZU1A 2YU8A 4R2SA 2EM7A 2YTOA 2ELZA 2EMKA 1X6EA 2BB8A 2EMBA 2LT7A 1AAYA 4R2RA 2ENHA 2EP3A 2LCEA 1WJPA 2EOFA 2M9AA 3MHSC 2CT1A 2EQ0A 2YRKA 2EOJA 1B69A 2HGHA 1TF6A 2EQ1A 2EMLA 2EL6A 2EOMA 2ELYA 2EM5A 2EE8A 1BB8A 2WBSA 1NCSA 1X6HA 2E72A 2EPUA 2EMHA 4R2PA 2WCC3 2EMWA 2YRMA 1YUJA 2EN2A 2NABA 2YTPA 2YU5A 2YTGA 2RPCA 2EOOA 2DLQA 4R2DA 3EPLA 1YUIA 5KL7A 2EM4A 1A1GA 2EL5A 2JP9A 2YTNA 2EOHA 1A1HA 3M99B 1JK2A 1A1KA 2J7JA 4GZNC 2EM8A 2EPRA 2RSIA 2EN6A 2EORA 4FK5C 4F2JC 2EQ3A 4F6NA 2ADRA 1X6FA 2DGCA 3UK3C 2EN8A 2EMAA 2A25A 3VHTB 1ZR9A 2EN7A 2EPCA 2YTEA 2MKNA 2ENCA 2EJ4A 5KL2A 1A1JA 2EMIA 4R2EA 2YTDA 4IJDA 3EPKA 2EOSA 1X3CA 2EM2A 1BBOA 1ZAAC 2GLIA 2YTFA 5KL3A 1JK1A 1G2FC 1P47A 1MEYC 2JPAA 2EMZA 1A1IA 1X5WA 2DRPA 2LV2A 2EM9A 2EOZA 2YTQA 2EN3A 1LLMC 4WSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1L A;  2CTD A;  2EN4 A;  2DLK A;  2MKD A;  2EM0 A;  2EMC A;  4F6M A;  1Z1B A;  2YTI A;  4R2C A;  4R2Q A;  2EOE A;  4IS1 C;  3EPJ A;  1G2D C;  1TF3 A;  2EPA A;  2DMI A;  4X9J A;  2EMY A;  2EL4 A;  1A1F A;  2WBU A;  2EM6 A;  2EOX A;  1TN9 A;  1RMD A;  2EM3 A;  4M9V C;  1UBD C;  2D9H A;  2R1F A;  2YRH A;  2EPZ A;  1F2I G;  2ENA A;  2EOI A;  2EPP A;  1YSA C;  2GHF A;  2LO3 A;  2WBT A;  1KJK A;  2VRD A;  5KL5 A;  2MDG A;  2EMF A;  3EPH A;  2LVH A;  1UN6 B;  2EOY A;  2PRT A;  3MHH C;  4R2A A;  2EMX A;  2EMG A;  1DGC A;  5KL6 A;  5KL4 A;  2I13 A;  2CSH A;  2EOQ A;  2EN1 A;  2YSP A;  2EPX A;  2YSO A;  2YTJ A;  1ZU1 A;  2YU8 A;  4R2S A;  2EM7 A;  2YTO A;  2ELZ A;  2EMK A;  1X6E A;  2BB8 A;  2EMB A;  2LT7 A;  1AAY A;  4R2R A;  2ENH A;  2EP3 A;  2LCE A;  1WJP A;  2EOF A;  2M9A A;  3MHS C;  2CT1 A;  2EQ0 A;  2YRK A;  2EOJ A;  1B69 A;  2HGH A;  1TF6 A;  2EQ1 A;  2EML A;  2EL6 A;  2EOM A;  2ELY A;  2EM5 A;  2EE8 A;  1BB8 A;  2WBS A;  1NCS A;  1X6H A;  2E72 A;  2EPU A;  2EMH A;  4R2P A;  2WCC 3;  2EMW A;  2YRM A;  1YUJ A;  2EN2 A;  2NAB A;  2YTP A;  2YU5 A;  2YTG A;  2RPC A;  2EOO A;  2DLQ A;  4R2D A;  3EPL A;  1YUI A;  5KL7 A;  2EM4 A;  1A1G A;  2EL5 A;  2JP9 A;  2YTN A;  2EOH A;  1A1H A;  3M99 B;  1JK2 A;  1A1K A;  2J7J A;  4GZN C;  2EM8 A;  2EPR A;  2RSI A;  2EN6 A;  2EOR A;  4FK5 C;  4F2J C;  2EQ3 A;  4F6N A;  2ADR A;  1X6F A;  2DGC A;  3UK3 C;  2EN8 A;  2EMA A;  2A25 A;  3VHT B;  1ZR9 A;  2EN7 A;  2EPC A;  2YTE A;  2MKN A;  2ENC A;  2EJ4 A;  5KL2 A;  1A1J A;  2EMI A;  4R2E A;  2YTD A;  4IJD A;  3EPK A;  2EOS A;  1X3C A;  2EM2 A;  1BBO A;  1ZAA C;  2GLI A;  2YTF A;  5KL3 A;  1JK1 A;  1G2F C;  1P47 A;  1MEY C;  2JPA A;  2EMZ A;  1A1I A;  1X5W A;  2DRP A;  2LV2 A;  2EM9 A;  2EOZ A;  2YTQ A;  2EN3 A;  1LLM C;  4WSG A; 
#chains in the Genus database with same CATH topology
 1FJG E;  1SFE A;  4HTG A;  2CTD A;  2V87 A;  3AV0 A;  5TSE A;  3VK6 A;  5A6J A;  4DV3 E;  1EH6 A;  2YZT A;  3F6G A;  4ZYH A;  3ECR A;  2UUB E;  2FTX B;  1EH7 A;  4X64 E;  1HNZ E;  2DMI A;  4OX9 E;  2EL4 A;  2DB2 A;  2WBU A;  4O24 A;  1YZ9 A;  2E5L E;  2LRS A;  1N34 E;  4TUG A;  2EPZ A;  2JYA A;  2GHF A;  5KL5 A;  2MDG A;  1GTK A;  4DKK A;  2LVH A;  1UN6 B;  4R2A A;  2EMX A;  1DGC A;  5KL4 A;  4WYQ B;  2KON A;  3JU0 A;  2EPX A;  2YTJ A;  2YWQ A;  2ELZ A;  2LJH A;  5CFF E;  2ENH A;  5IWA E;  2KHX A;  4B3R E;  1NEI A;  2M9A A;  4GKJ E;  1J26 A;  2DIX A;  3THO B;  2ELY A;  5A69 A;  2JOX A;  2EE8 A;  2EPO A;  1BB8 A;  5AC5 A;  4LF7 E;  4X62 E;  2EPU A;  3L00 A;  2WCC 3;  2DMY A;  2EMW A;  2YRM A;  1WXR A;  2YTG A;  4R2D A;  2EOO A;  2DLQ A;  2YPN A;  4DMI A;  3EPL A;  2EL5 A;  1EKZ A;  3T1Y E;  1YFH A;  4LFA E;  2JY9 A;  2EOH A;  3BBG A;  1A1K A;  2J7J A;  4TUI A;  4JI3 E;  3EQ1 A;  1WRJ A;  4WX9 A;  4F6N A;  5A2Q C;  2ADR A;  2IHR 1;  1GZ6 A;  1X6F A;  3UK3 C;  2NUF A;  3F6H A;  4MLV A;  2A25 A;  2B7T A;  2LMZ A;  4F9C B;  1IMU A;  1ZR9 A;  2LUQ A;  2EN7 A;  4JI7 E;  2EPC A;  2MKN A;  3J7A G;  2VQE E;  3HTX A;  4R2E A;  1X3C A;  4B3T E;  4JV5 E;  3RMP A;  1T38 A;  2YTF A;  4WSP A;  4X65 E;  2JPA A;  2CPN A;  1YYO A;  1WHN A;  4DR6 E;  1DQ3 A;  2RTX A;  2EN3 A;  1LLM C;  2L2M A;  1XNQ E;  1A1L A;  3ADJ A;  4DR5 E;  3BGH A;  2NUE A;  3ADI A;  4DR3 E;  2NUG A;  1Z1B A;  2YTI A;  4X9J A;  4DR4 E;  4BBY A;  4ZYD A;  1RMD A;  4F9B B;  1X47 A;  4DV5 E;  2FGG A;  2L8T A;  3JTZ A;  1YPN A;  2EOI A;  2EPP A;  2L3C A;  2LUP B;  1IBK E;  1KJK A;  1PJS A;  5IV8 B;  2EMF A;  4B3S E;  3LML A;  3IWD A;  2EOY A;  3LLH A;  2JOB A;  5FLX C;  2I9I A;  2B7V A;  1X48 A;  2JR1 A;  3KZZ A;  5KL6 A;  5IT9 C;  1MGT A;  2I13 A;  2CSH A;  4DR1 E;  2EOQ A;  2EN1 A;  4ZYG A;  4JI0 E;  2L6M A;  2V83 A;  4MLQ A;  3VYY A;  4P7D A;  2K4V A;  2VE7 C;  1IQS A;  2BB8 A;  3QG5 C;  4Q35 B;  1AAY A;  2N8X A;  2EP3 A;  2EOF A;  2EOJ A;  5IXM B;  2EML A;  2MC5 A;  2EL6 A;  4X8W A;  2UUC E;  4OOG C;  1N36 E;  4BCA A;  2LJU A;  1NCS A;  2B9D A;  2VF1 A;  2E72 A;  1YUJ A;  2EN2 A;  2MDR A;  2YU5 A;  5A6B D;  1XMQ E;  1EH8 A;  1A1G A;  4LTY A;  2M1S A;  1N32 E;  1ZBT A;  2N3G A;  3M99 B;  1JK2 A;  4DR7 E;  1IBL E;  5A6B A;  4O5G A;  4F2J C;  4ZYE A;  2V85 A;  2GPI A;  3ADL A;  5AAS A;  4JI8 E;  4WFT A;  4O43 A;  1ZBQ A;  2G7H A;  1KYQ A;  3VHT B;  4B3M E;  4NZV A;  4JI1 E;  1PKP A;  2YTE A;  1HNW E;  2RS7 A;  3ZOQ B;  3OML A;  5KL2 A;  1A1J A;  4LF8 E;  2YTD A;  4Q28 A;  5LL6 R;  4DUZ E;  2RS6 A;  1ZAA C;  5KL3 A;  1JK1 A;  4KHP E;  1MEY C;  2EMZ A;  3THN A;  2DRP A;  2ZM6 E;  2LV2 A;  4JYA E;  2EM9 A;  3J81 C;  4WSG A;  3JAM C;  5AE1 A;  1X49 A;  1AH5 A;  3DF6 A;  4R2Q A;  2EOE A;  1PDA A;  2EPA A;  5AC4 A;  2EMY A;  4LFC E;  2NA2 A;  4K0K E;  4I8O A;  2EM6 A;  1TN9 A;  2EWL A;  4M9V C;  1UBD C;  4JI5 E;  4JI2 E;  1I94 E;  2D9H A;  2R1F A;  2YRH A;  1F2I G;  2LO3 A;  2LTR A;  2WBT A;  3C6K A;  4DV1 E;  2M4I A;  2EPN A;  4F54 A;  4WXC A;  2N3H A;  2VQF E;  2PRT A;  2HJJ A;  2EMG A;  4LF9 E;  2L92 A;  4DR2 E;  4L8N A;  1O0W A;  2UU9 E;  2YU8 A;  1IBM E;  5AE3 A;  1ZU1 A;  2EM7 A;  4DV7 E;  2LT7 A;  3HPS A;  4LU9 A;  4R2R A;  2LCE A;  5F3W A;  2CT1 A;  2EQ0 A;  1T4L B;  1FKA E;  1QU6 A;  3KWR A;  2HHH E;  2EOM A;  1T39 A;  5LMN E;  1XNR E;  4NXN E;  4BS9 A;  2JXP A;  1PJQ A;  4AQY E;  4R2P A;  2YT4 A;  4L5N C;  4DV0 E;  2F8B A;  2NAB A;  2YTP A;  4DV6 E;  2LBS B;  2MC6 A;  2EM4 A;  2YTN A;  3HPZ A;  4JI4 E;  4DV2 E;  1UIL A;  4P78 A;  2EM8 A;  4GZN C;  2UUA E;  2EPR A;  2R76 A;  4FK5 C;  3FIG A;  3T1H E;  2EQ3 A;  2L2N A;  4BC7 A;  2JWO A;  1T4O A;  4RHB B;  3VYX A;  4WPY A;  4LFB E;  2L3J A;  2ODR D;  4NHR A;  4GEQ B;  2EMI A;  2HC5 A;  3MSW A;  4IJD A;  3EPK A;  1BBO A;  2GLI A;  1N3G A;  4LF4 E;  2RQL A;  1X5W A;  5BR8 E;  4RH8 A;  2EOZ A;  2YTQ A;  1J5E E;  4N4R B;  2EPM X;  2EN4 A;  2V88 A;  1IQO A;  2DLK A;  2MKD A;  1WHQ A;  2EPK X;  5LLQ A;  4M0V A;  2EM0 A;  2UXC E;  2EMC A;  4F6M A;  4R2C A;  3ADG A;  2B3T B;  4IS1 C;  4NXM E;  4GKK E;  4BC9 A;  1BBG A;  3EPJ A;  1G2D C;  3KZY A;  1TF3 A;  4JI6 E;  1RQ0 A;  3HXL A;  2V89 A;  1A1F A;  2EOX A;  5A6A A;  2EM3 A;  3IWB A;  1UHZ A;  2V8Q B;  3OTO E;  4YHH E;  4DV4 E;  2ENA A;  1PJT A;  2DSY A;  1YSA C;  4KZS A;  2LE2 A;  2VRD A;  5DNY A;  4J8Z A;  1HNX E;  1N33 E;  2UXB E;  3EPH A;  2FV4 B;  3MHH C;  2KOU A;  5AE2 A;  3H09 A;  4O4K A;  3C4T A;  2JVA A;  4LF6 E;  2YSP A;  2YSO A;  5LMU E;  4R2S A;  2EZ6 A;  2YTO A;  3J7Y p;  1HR0 E;  2EMK A;  1X6E A;  2EMB A;  3P1X A;  4YY3 E;  4R8O A;  1WJP A;  3MHS C;  2YRK A;  2Q8U A;  1B69 A;  2HGH A;  1TF6 A;  2EQ1 A;  4BMJ A;  3J80 C;  3BID A;  1DI2 A;  2EM5 A;  5ADZ A;  4WXD A;  2WBS A;  2EPL X;  1X6H A;  2L33 A;  2EMH A;  4LF5 E;  2V86 A;  3AUZ A;  3C6M A;  2BBG A;  2RSM A;  1YYW A;  1YUI A;  2RPC A;  2UXD E;  3BF2 A;  5KL7 A;  4KWY A;  4M30 A;  1SR9 A;  1XMO E;  2JP9 A;  1RC7 A;  1A1H A;  4R03 A;  1QNT A;  2WZO A;  2ODR C;  3DJW A;  5A6K A;  2M7Q A;  2RSI A;  2EN6 A;  2EOR A;  3K6Q A;  4DUY E;  2L2K B;  1STU A;  3C4B A;  2DGC A;  2EN8 A;  5T6J A;  2E1M A;  2EMA A;  3IWC A;  4BHC A;  3HQ1 A;  1GQE A;  4X66 E;  2ENC A;  2EJ4 A;  4BHB A;  1L4S A;  2EOS A;  2LTS A;  2EM2 A;  1T4N A;  3TQM A;  2F4V E;  1G2F C;  1P47 A;  1A1I A;  2K7I A;  2H36 X;  4M2Z A;  4F9A B;  1YYK A;  4HEI A; 
#chains in the Genus database with same CATH homology
 1A1L A;  2CTD A;  2EN4 A;  2DLK A;  2MKD A;  2EM0 A;  2EMC A;  4F6M A;  1Z1B A;  2YTI A;  4R2C A;  4R2Q A;  2EOE A;  4IS1 C;  3EPJ A;  1G2D C;  1TF3 A;  2EPA A;  2DMI A;  4X9J A;  2EMY A;  2EL4 A;  1A1F A;  2WBU A;  2EM6 A;  2EOX A;  1TN9 A;  1RMD A;  2EM3 A;  4M9V C;  1UBD C;  2D9H A;  2R1F A;  2YRH A;  2EPZ A;  1F2I G;  2ENA A;  2EOI A;  2EPP A;  1YSA C;  2GHF A;  2LO3 A;  2WBT A;  1KJK A;  2VRD A;  5KL5 A;  2MDG A;  2EMF A;  3EPH A;  2LVH A;  1UN6 B;  2EOY A;  2PRT A;  3MHH C;  4R2A A;  2EMX A;  2EMG A;  1DGC A;  5KL6 A;  5KL4 A;  2I13 A;  2CSH A;  2EOQ A;  2EN1 A;  2YSP A;  2EPX A;  2YSO A;  2YTJ A;  1ZU1 A;  2YU8 A;  4R2S A;  2EM7 A;  2YTO A;  2ELZ A;  2EMK A;  1X6E A;  2BB8 A;  2EMB A;  2LT7 A;  1AAY A;  4R2R A;  2ENH A;  2EP3 A;  2LCE A;  1WJP A;  2EOF A;  2M9A A;  3MHS C;  2CT1 A;  2EQ0 A;  2YRK A;  2EOJ A;  1B69 A;  2HGH A;  1TF6 A;  2EQ1 A;  2EML A;  2EL6 A;  2EOM A;  2ELY A;  2EM5 A;  2EE8 A;  1BB8 A;  2WBS A;  1NCS A;  1X6H A;  2E72 A;  2EPU A;  2EMH A;  4R2P A;  2WCC 3;  2EMW A;  2YRM A;  1YUJ A;  2EN2 A;  2NAB A;  2YTP A;  2YU5 A;  2YTG A;  2RPC A;  2EOO A;  2DLQ A;  4R2D A;  3EPL A;  1YUI A;  5KL7 A;  2EM4 A;  1A1G A;  2EL5 A;  2JP9 A;  2YTN A;  2EOH A;  1A1H A;  3M99 B;  1JK2 A;  1A1K A;  2J7J A;  4GZN C;  2EM8 A;  2EPR A;  2RSI A;  2EN6 A;  2EOR A;  4FK5 C;  4F2J C;  2EQ3 A;  4F6N A;  2ADR A;  1X6F A;  2DGC A;  3UK3 C;  2EN8 A;  2EMA A;  2A25 A;  3VHT B;  1ZR9 A;  2EN7 A;  2EPC A;  2YTE A;  2MKN A;  2ENC A;  2EJ4 A;  5KL2 A;  1A1J A;  2EMI A;  4R2E A;  2YTD A;  4IJD A;  3EPK A;  2EOS A;  1X3C A;  2EM2 A;  1BBO A;  1ZAA C;  2GLI A;  2YTF A;  5KL3 A;  1JK1 A;  1G2F C;  1P47 A;  1MEY C;  2JPA A;  2EMZ A;  1A1I A;  1X5W A;  2DRP A;  2LV2 A;  2EM9 A;  2EOZ A;  2YTQ A;  2EN3 A;  1LLM C;  4WSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...