1P47A

Crystal structure of tandem zif268 molecules complexed to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Constraints for Zinc Finger Linker Design as Inferred from X-ray Crystal Structure of Tandem Zif268-DNA Complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*TP*GP*GP*CP*GP*TP*GP*GP*GP*CP*GP*GP*CP*GP*TP*GP*GP*
total genus 26
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A03
1G2FC 2MKDA 2EOOA 1BBOA 2E72A 2EOSA 2DLQA 4R2PA 2EMBA 1A1JA 5KL2A 2EN8A 2EMWA 3M99B 3MHSC 2DGCA 2EPPA 2EPAA 2LT7A 1NCSA 2WBUA 4R2QA 3MHHC 2ENCA 1RMDA 2EP3A 4R2CA 4X9JA 2DRPA 1ZU1A 1X3CA 2JP9A 2YTFA 2EL6A 3EPLA 2YU5A 1A1GA 1A1KA 2EN3A 1YUJA 1YUIA 2EPRA 1A1IA 2EE8A 2EMYA 2NABA 2EMLA 2EOEA 2EL5A 1KJKA 2ENAA 2EN4A 2BB8A 2CTDA 2EMZA 2WBTA 1A1LA 2YTJA 2GLIA 1X6EA 2EORA 2RSIA 2YTGA 2ELZA 4WSGA 1A1FA 1X5WA 2YSPA 2EMXA 4IJDA 4R2EA 1TF3A 2DLKA 2EM3A 2LO3A 2EM6A 2MDGA 2EM0A 1P47A 2EMKA 2EOZA 2YTQA 2EPZA 1X6FA 5KL3A 2EL4A 2J7JA 2YTNA 1WJPA 4F6MA 1TN9A 3VHTB 1ZAAC 4R2RA 1UBDC 4M9VC 2A25A 2EN1A 2EQ1A 2R1FA 2YRKA 4R2SA 1G2DC 3UK3C 1TF6A 2EOYA 2DMIA 1X6HA 4F6NA 2EOQA 4IS1C 2CT1A 3EPJA 2EN2A 1UN6B 1A1HA 2EMHA 2EPXA 2EPUA 4R2DA 2EMAA 2YTEA 2EJ4A 2EM7A 2EOMA 2WCC3 1BB8A 4F2JC 2RPCA 2LCEA 2EM8A 2EOIA 2EPCA 2M9AA 1MEYC 2YRHA 5KL7A 2EQ0A 2HGHA 2ENHA 2D9HA 2CSHA 1F2IG 2EMIA 2EOFA 4GZNC 2EOJA 2LVHA 2EOHA 2EMCA 2YRMA 5KL5A 1JK2A 2EM2A 3EPHA 2ADRA 2EM9A 2YTOA 2EM5A 2EM4A 2EOXA 1JK1A 2ELYA 2EMGA 1Z1BA 3EPKA 2YSOA 2EN7A 1YSAC 2YTPA 2YU8A 5KL4A 1B69A 2LV2A 2WBSA 1DGCA 2YTDA 2YTIA 2MKNA 1LLMC 2EQ3A 2EN6A 4R2AA 5KL6A 2I13A 2EMFA 4FK5C 2VRDA 1ZR9A 2PRTA 2JPAA 2GHFA 1AAYA
chains in the Genus database with same CATH superfamily
1NEIA 4WXDA 2MKDA 3MHSC 2EPPA 3J7Yp 2ODRC 1NCSA 4DV6E 4DR2E 1STUA 4JI8E 3ZOQB 5FLXC 2ENCA 3HQ1A 4R2CA 2RQLA 1X3CA 2L33A 2YTFA 2KHXA 1A1GA 1A1IA 3IWCA 1DQ3A 2V8QB 2ENAA 4LFBE 2BB8A 4O5GA 3BBGA 1T4OA 2RSIA 2YTGA 4MLVA 4KZSA 3RMPA 3AUZA 2EM3A 2JVAA 5AC4A 4LF8E 2HHHE 4P78A 2YTNA 1PJTA 2J7JA 4F6MA 2IHR1 5A6BD 1ZAAC 2M7QA 4R2RA 2DSYA 1UBDC 4M9VC 2EN1A 1G2DC 2DMIA 5A6JA 1X6HA 4F6NA 2L6MA 2CPNA 2N3GA 4IS1C 4BC7A 4X62E 2N8XA 2EMHA 3HXLA 2EPUA 5LMNE 3QG5C 2I9IA 4N4RB 1BB8A 2EM7A 4BC9A 1RC7A 2L92A 2LCEA 2V83A 4WPYA 3JU0A 5A69A 5A2QC 4LF7E 2EPCA 5IV8B 4DV2E 5AE2A 5TSEA 2Q8UA 3C4TA 2ODRD 4O4KA 2ENHA 4DV5E 2D9HA 5IWAE 4JI1E 1F2IG 2MDRA 4GZNC 1AH5A 5LMUE 4O24A 2EMCA 2NUEA 3T1HE 5KL5A 4LU9A 1JK2A 2UUAE 5AC5A 2L2NA 2V86A 2EM9A 1T4LB 4GKKE 4NXNE 2V85A 1JK1A 1KYQA 5BR8E 1YZ9A 4JI0E 5ADZA 2YSOA 2EN7A 1ZBQA 5CFFE 5KL4A 1B69A 3H09A 1I94E 1DGCA 1EKZA 4RH8A 1SFEA 4BBYA 2YTIA 4DR4E 4RHBB 1YFHA 2EN6A 3VYYA 5KL6A 1YYOA 2I13A 2EMFA 2EPNA 1XMOE 4BMJA 4ZYDA 2E5LE 2JYAA 1BBOA 2E72A 2EOSA 2DLQA 1J26A 3BGHA 4F9AB 4R2PA 1A1JA 5KL2A 3IWBA 2EN8A 2EMWA 2MC6A 4O43A 4WXCA 2WBUA 4I8OA 4BS9A 4X9JA 4WFTA 2EL6A 3LLHA 2YU5A 4ZYHA 1A1KA 2UU9E 2EPOA 3L00A 1IQOA 2NUGA 2EMYA 1J5EE 2UUBE 1KJKA 3IWDA 2CTDA 2EMZA 4LF9E 4DR5E 2GLIA 2EORA 3ECRA 1A1FA 1X5WA 4JI7E 2F8BA 1HNWE 4R2EA 2EM0A 2M1SA 2MC5A 1FKAE 4M2ZA 2JWOA 2R76A 1TN9A 4ZYGA 2VQFE 4B3ME 4R2SA 3TQMA 2ZM6E 2EZ6A 4K0KE 1UN6B 3VYXA 2EPXA 1N33E 2LBSB 2YTEA 3EQ1A 3C6MA 2RPCA 2FV4B 2LUQA 4P7DA 1GQEA 1X47A 2EM8A 1MEYC 4LF5E 3F6HA 2EQ0A 2GPIA 2RTXA 2CSHA 2EOFA 2H36X 4NHRA 3AV0A 3KZZA 2LVHA 1O0WA 2YRMA 2EM2A 4OX9E 1GTKA 4BHCA 2EM4A 1PDAA 1Z1BA 3EPKA 1WRJA 1PJQA 4BHBA 4DUYE 1YPNA 1YSAC 1L4SA 2YU8A 4DV3E 4LTYA 4Q35B 1RQ0A 2LJHA 2WBSA 2DMYA 1T39A 4NXME 2YTDA 4HTGA 1LLMC 4JI4E 1HNXE 2V87A 5A6KA 4YY3E 2VRDA 1ZR9A 2EP3A 1G2FC 1N36E 3K6QA 5A6AA 2EMBA 1IQSA 3J80C 3M99B 2BBGA 1T4NA 2M4IA 4AQYE 4JI5E 2EPAA 2V89A 4F54A 1UHZA 4DV7E 4R2QA 2YZTA 4WSPA 1XNRE 1RMDA 1MGTA 1ZU1A 2JP9A 3EPLA 1UILA 1GZ6A 2EN3A 4L8NA 1YUJA 2LMZA 4F9CB 2EE8A 4M0VA 2EMLA 1EH7A 2EL5A 1IBLE 4GKJE 3THOB 1WHNA 2EN4A 1HNZE 2E1MA 2LUPB 2YT4A 2WBTA 2LTSA 1WHQA 3DF6A 4M30A 2WZOA 2JR1A 1X6EA 2ELZA 2L3JA 1YYKA 2EMXA 4LF6E 3P1XA 1TF3A 4LFAE 2LO3A 2MDGA 1SR9A 1P47A 2EMKA 3J81C 2EOZA 2EPZA 1X6FA 2L8TA 2EL4A 5KL3A 3VHTB 5F3WA 4MLQA 2A25A 2EQ1A 4LFCE 2EOYA 1EH6A 2L2MA 4J8ZA 4B3RE 3F6GA 3BIDA 2LTRA 2JOBA 2CT1A 2JY9A 2EPLX 5AE3A 4OOGC 4DUZE 3DJWA 4JI3E 2EOIA 4X65E 5IT9C 4JI6E 2HC5A 5KL7A 2VF1A 2HGHA 2EMIA 1N34E 4X8WA 4X66E 2EOJA 4JI2E 4JV5E 4R8OA 2ADRA 2N3HA 2K7IA 1YYWA 2YTOA 2EOXA 4BCAA 2ELYA 3C6KA 2EMGA 3FIGA 3OMLA 4ZYEA 2B3TB 4F9BB 4B3TE 2FGGA 2YTPA 2RSMA 1PKPA 2B7TA 1QU6A 1IMUA 2YWQA 4B3SE 2B9DA 1ZBTA 1PJSA 3MSWA 4YHHE 2DB2A 2PRTA 3LMLA 2GHFA 1N32E 1AAYA 1X48A 2EOOA 5IXMB 5DNYA 3C4BA 4DV4E 2K4VA 2DGCA 5AASA 2KONA 2LT7A 2RS6A 3MHHC 3ADJA 3ADIA 2DRPA 1IBKE 4DR7E 1YUIA 2EPRA 2VE7C 1N3GA 2NABA 4TUGA 4HEIA 2EOEA 4L5NC 2EPKX 3KWRA 2L3CA 2L2KB 1A1LA 2YTJA 3JAMC 4X64E 3HPSA 4WSGA 5T6JA 2YSPA 2NUFA 3BF2A 2F4VE 4IJDA 2YPNA 2DLKA 2EM6A 3HPZA 3THNA 2YTQA 4TUIA 4JYAE 1DI2A 1WJPA 4NZVA 3OTOE 5A6BA 5LL6R 2UXCE 2R1FA 1FJGE 1TF6A 2JOXA 2YRKA 3KZYA 3UK3C 4DKKA 2UXDE 2FTXB 4R03A 2B7VA 2EOQA 2RS7A 2UXBE 3EPJA 3ADGA 2EN2A 1A1HA 4LF4E 4R2DA 3J7AG 3ADLA 2KOUA 2EMAA 2EJ4A 2EOMA 2WCC3 4F2JC 2VQEE 5AE1A 3VK6A 4DR3E 2M9AA 2YRHA 4DV1E 1HR0E 3HTXA 3T1YE 4DV0E 2NA2A 2EWLA 2LRSA 5LLQA 4DR6E 1EH8A 2EOHA 4Q28A 1XNQE 4KHPE 4DR1E 1IBME 3EPHA 2HJJA 2EM5A 1QNTA 1BBGA 2UUCE 3JTZA 1T38A 2DIXA 4WYQB 4WX9A 1WXRA 2V88A 2LJUA 2LV2A 4GEQB 2EPMX 4DMIA 2MKNA 2LE2A 2EQ3A 4R2AA 1XMQE 2G7HA 4FK5C 4KWYA 1X49A 2JPAA 2JXPA
chains in the Genus database with same CATH topology
1G2FC 2MKDA 2EOOA 1BBOA 2E72A 2EOSA 2DLQA 4R2PA 2EMBA 1A1JA 5KL2A 2EN8A 2EMWA 3M99B 3MHSC 2DGCA 2EPPA 2EPAA 2LT7A 1NCSA 2WBUA 4R2QA 3MHHC 2ENCA 1RMDA 2EP3A 4R2CA 4X9JA 2DRPA 1ZU1A 1X3CA 2JP9A 2YTFA 2EL6A 3EPLA 2YU5A 1A1GA 1A1KA 2EN3A 1YUJA 1YUIA 2EPRA 1A1IA 2EE8A 2EMYA 2NABA 2EMLA 2EOEA 2EL5A 1KJKA 2ENAA 2EN4A 2BB8A 2CTDA 2EMZA 2WBTA 1A1LA 2YTJA 2GLIA 1X6EA 2EORA 2RSIA 2YTGA 2ELZA 4WSGA 1A1FA 1X5WA 2YSPA 2EMXA 4IJDA 4R2EA 1TF3A 2DLKA 2EM3A 2LO3A 2EM6A 2MDGA 2EM0A 1P47A 2EMKA 2EOZA 2YTQA 2EPZA 1X6FA 5KL3A 2EL4A 2J7JA 2YTNA 1WJPA 4F6MA 1TN9A 3VHTB 1ZAAC 4R2RA 1UBDC 4M9VC 2A25A 2EN1A 2EQ1A 2R1FA 2YRKA 4R2SA 1G2DC 3UK3C 1TF6A 2EOYA 2DMIA 1X6HA 4F6NA 2EOQA 4IS1C 2CT1A 3EPJA 2EN2A 1UN6B 1A1HA 2EMHA 2EPXA 2EPUA 4R2DA 2EMAA 2YTEA 2EJ4A 2EM7A 2EOMA 2WCC3 1BB8A 4F2JC 2RPCA 2LCEA 2EM8A 2EOIA 2EPCA 2M9AA 1MEYC 2YRHA 5KL7A 2EQ0A 2HGHA 2ENHA 2D9HA 2CSHA 1F2IG 2EMIA 2EOFA 4GZNC 2EOJA 2LVHA 2EOHA 2EMCA 2YRMA 5KL5A 1JK2A 2EM2A 3EPHA 2ADRA 2EM9A 2YTOA 2EM5A 2EM4A 2EOXA 1JK1A 2ELYA 2EMGA 1Z1BA 3EPKA 2YSOA 2EN7A 1YSAC 2YTPA 2YU8A 5KL4A 1B69A 2LV2A 2WBSA 1DGCA 2YTDA 2YTIA 2MKNA 1LLMC 2EQ3A 2EN6A 4R2AA 5KL6A 2I13A 2EMFA 4FK5C 2VRDA 1ZR9A 2PRTA 2JPAA 2GHFA 1AAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2F C;  2MKD A;  2EOO A;  1BBO A;  2E72 A;  2EOS A;  2DLQ A;  4R2P A;  2EMB A;  1A1J A;  5KL2 A;  2EN8 A;  2EMW A;  3M99 B;  3MHS C;  2DGC A;  2EPP A;  2EPA A;  2LT7 A;  1NCS A;  2WBU A;  4R2Q A;  3MHH C;  2ENC A;  1RMD A;  2EP3 A;  4R2C A;  4X9J A;  2DRP A;  1ZU1 A;  1X3C A;  2JP9 A;  2YTF A;  2EL6 A;  3EPL A;  2YU5 A;  1A1G A;  1A1K A;  2EN3 A;  1YUJ A;  1YUI A;  2EPR A;  1A1I A;  2EE8 A;  2EMY A;  2NAB A;  2EML A;  2EOE A;  2EL5 A;  1KJK A;  2ENA A;  2EN4 A;  2BB8 A;  2CTD A;  2EMZ A;  2WBT A;  1A1L A;  2YTJ A;  2GLI A;  1X6E A;  2EOR A;  2RSI A;  2YTG A;  2ELZ A;  4WSG A;  1A1F A;  1X5W A;  2YSP A;  2EMX A;  4IJD A;  4R2E A;  1TF3 A;  2DLK A;  2EM3 A;  2LO3 A;  2EM6 A;  2MDG A;  2EM0 A;  1P47 A;  2EMK A;  2EOZ A;  2YTQ A;  2EPZ A;  1X6F A;  5KL3 A;  2EL4 A;  2J7J A;  2YTN A;  1WJP A;  4F6M A;  1TN9 A;  3VHT B;  1ZAA C;  4R2R A;  1UBD C;  4M9V C;  2A25 A;  2EN1 A;  2EQ1 A;  2R1F A;  2YRK A;  4R2S A;  1G2D C;  3UK3 C;  1TF6 A;  2EOY A;  2DMI A;  1X6H A;  4F6N A;  2EOQ A;  4IS1 C;  2CT1 A;  3EPJ A;  2EN2 A;  1UN6 B;  1A1H A;  2EMH A;  2EPX A;  2EPU A;  4R2D A;  2EMA A;  2YTE A;  2EJ4 A;  2EM7 A;  2EOM A;  2WCC 3;  1BB8 A;  4F2J C;  2RPC A;  2LCE A;  2EM8 A;  2EOI A;  2EPC A;  2M9A A;  1MEY C;  2YRH A;  5KL7 A;  2EQ0 A;  2HGH A;  2ENH A;  2D9H A;  2CSH A;  1F2I G;  2EMI A;  2EOF A;  4GZN C;  2EOJ A;  2LVH A;  2EOH A;  2EMC A;  2YRM A;  5KL5 A;  1JK2 A;  2EM2 A;  3EPH A;  2ADR A;  2EM9 A;  2YTO A;  2EM5 A;  2EM4 A;  2EOX A;  1JK1 A;  2ELY A;  2EMG A;  1Z1B A;  3EPK A;  2YSO A;  2EN7 A;  1YSA C;  2YTP A;  2YU8 A;  5KL4 A;  1B69 A;  2LV2 A;  2WBS A;  1DGC A;  2YTD A;  2YTI A;  2MKN A;  1LLM C;  2EQ3 A;  2EN6 A;  4R2A A;  5KL6 A;  2I13 A;  2EMF A;  4FK5 C;  2VRD A;  1ZR9 A;  2PRT A;  2JPA A;  2GHF A;  1AAY A; 
#chains in the Genus database with same CATH topology
 1NEI A;  4WXD A;  2MKD A;  3MHS C;  2EPP A;  3J7Y p;  2ODR C;  1NCS A;  4DV6 E;  4DR2 E;  1STU A;  4JI8 E;  3ZOQ B;  5FLX C;  2ENC A;  3HQ1 A;  4R2C A;  2RQL A;  1X3C A;  2L33 A;  2YTF A;  2KHX A;  1A1G A;  1A1I A;  3IWC A;  1DQ3 A;  2V8Q B;  2ENA A;  4LFB E;  2BB8 A;  4O5G A;  3BBG A;  1T4O A;  2RSI A;  2YTG A;  4MLV A;  4KZS A;  3RMP A;  3AUZ A;  2EM3 A;  2JVA A;  5AC4 A;  4LF8 E;  2HHH E;  4P78 A;  2YTN A;  1PJT A;  2J7J A;  4F6M A;  2IHR 1;  5A6B D;  1ZAA C;  2M7Q A;  4R2R A;  2DSY A;  1UBD C;  4M9V C;  2EN1 A;  1G2D C;  2DMI A;  5A6J A;  1X6H A;  4F6N A;  2L6M A;  2CPN A;  2N3G A;  4IS1 C;  4BC7 A;  4X62 E;  2N8X A;  2EMH A;  3HXL A;  2EPU A;  5LMN E;  3QG5 C;  2I9I A;  4N4R B;  1BB8 A;  2EM7 A;  4BC9 A;  1RC7 A;  2L92 A;  2LCE A;  2V83 A;  4WPY A;  3JU0 A;  5A69 A;  5A2Q C;  4LF7 E;  2EPC A;  5IV8 B;  4DV2 E;  5AE2 A;  5TSE A;  2Q8U A;  3C4T A;  2ODR D;  4O4K A;  2ENH A;  4DV5 E;  2D9H A;  5IWA E;  4JI1 E;  1F2I G;  2MDR A;  4GZN C;  1AH5 A;  5LMU E;  4O24 A;  2EMC A;  2NUE A;  3T1H E;  5KL5 A;  4LU9 A;  1JK2 A;  2UUA E;  5AC5 A;  2L2N A;  2V86 A;  2EM9 A;  1T4L B;  4GKK E;  4NXN E;  2V85 A;  1JK1 A;  1KYQ A;  5BR8 E;  1YZ9 A;  4JI0 E;  5ADZ A;  2YSO A;  2EN7 A;  1ZBQ A;  5CFF E;  5KL4 A;  1B69 A;  3H09 A;  1I94 E;  1DGC A;  1EKZ A;  4RH8 A;  1SFE A;  4BBY A;  2YTI A;  4DR4 E;  4RHB B;  1YFH A;  2EN6 A;  3VYY A;  5KL6 A;  1YYO A;  2I13 A;  2EMF A;  2EPN A;  1XMO E;  4BMJ A;  4ZYD A;  2E5L E;  2JYA A;  1BBO A;  2E72 A;  2EOS A;  2DLQ A;  1J26 A;  3BGH A;  4F9A B;  4R2P A;  1A1J A;  5KL2 A;  3IWB A;  2EN8 A;  2EMW A;  2MC6 A;  4O43 A;  4WXC A;  2WBU A;  4I8O A;  4BS9 A;  4X9J A;  4WFT A;  2EL6 A;  3LLH A;  2YU5 A;  4ZYH A;  1A1K A;  2UU9 E;  2EPO A;  3L00 A;  1IQO A;  2NUG A;  2EMY A;  1J5E E;  2UUB E;  1KJK A;  3IWD A;  2CTD A;  2EMZ A;  4LF9 E;  4DR5 E;  2GLI A;  2EOR A;  3ECR A;  1A1F A;  1X5W A;  4JI7 E;  2F8B A;  1HNW E;  4R2E A;  2EM0 A;  2M1S A;  2MC5 A;  1FKA E;  4M2Z A;  2JWO A;  2R76 A;  1TN9 A;  4ZYG A;  2VQF E;  4B3M E;  4R2S A;  3TQM A;  2ZM6 E;  2EZ6 A;  4K0K E;  1UN6 B;  3VYX A;  2EPX A;  1N33 E;  2LBS B;  2YTE A;  3EQ1 A;  3C6M A;  2RPC A;  2FV4 B;  2LUQ A;  4P7D A;  1GQE A;  1X47 A;  2EM8 A;  1MEY C;  4LF5 E;  3F6H A;  2EQ0 A;  2GPI A;  2RTX A;  2CSH A;  2EOF A;  2H36 X;  4NHR A;  3AV0 A;  3KZZ A;  2LVH A;  1O0W A;  2YRM A;  2EM2 A;  4OX9 E;  1GTK A;  4BHC A;  2EM4 A;  1PDA A;  1Z1B A;  3EPK A;  1WRJ A;  1PJQ A;  4BHB A;  4DUY E;  1YPN A;  1YSA C;  1L4S A;  2YU8 A;  4DV3 E;  4LTY A;  4Q35 B;  1RQ0 A;  2LJH A;  2WBS A;  2DMY A;  1T39 A;  4NXM E;  2YTD A;  4HTG A;  1LLM C;  4JI4 E;  1HNX E;  2V87 A;  5A6K A;  4YY3 E;  2VRD A;  1ZR9 A;  2EP3 A;  1G2F C;  1N36 E;  3K6Q A;  5A6A A;  2EMB A;  1IQS A;  3J80 C;  3M99 B;  2BBG A;  1T4N A;  2M4I A;  4AQY E;  4JI5 E;  2EPA A;  2V89 A;  4F54 A;  1UHZ A;  4DV7 E;  4R2Q A;  2YZT A;  4WSP A;  1XNR E;  1RMD A;  1MGT A;  1ZU1 A;  2JP9 A;  3EPL A;  1UIL A;  1GZ6 A;  2EN3 A;  4L8N A;  1YUJ A;  2LMZ A;  4F9C B;  2EE8 A;  4M0V A;  2EML A;  1EH7 A;  2EL5 A;  1IBL E;  4GKJ E;  3THO B;  1WHN A;  2EN4 A;  1HNZ E;  2E1M A;  2LUP B;  2YT4 A;  2WBT A;  2LTS A;  1WHQ A;  3DF6 A;  4M30 A;  2WZO A;  2JR1 A;  1X6E A;  2ELZ A;  2L3J A;  1YYK A;  2EMX A;  4LF6 E;  3P1X A;  1TF3 A;  4LFA E;  2LO3 A;  2MDG A;  1SR9 A;  1P47 A;  2EMK A;  3J81 C;  2EOZ A;  2EPZ A;  1X6F A;  2L8T A;  2EL4 A;  5KL3 A;  3VHT B;  5F3W A;  4MLQ A;  2A25 A;  2EQ1 A;  4LFC E;  2EOY A;  1EH6 A;  2L2M A;  4J8Z A;  4B3R E;  3F6G A;  3BID A;  2LTR A;  2JOB A;  2CT1 A;  2JY9 A;  2EPL X;  5AE3 A;  4OOG C;  4DUZ E;  3DJW A;  4JI3 E;  2EOI A;  4X65 E;  5IT9 C;  4JI6 E;  2HC5 A;  5KL7 A;  2VF1 A;  2HGH A;  2EMI A;  1N34 E;  4X8W A;  4X66 E;  2EOJ A;  4JI2 E;  4JV5 E;  4R8O A;  2ADR A;  2N3H A;  2K7I A;  1YYW A;  2YTO A;  2EOX A;  4BCA A;  2ELY A;  3C6K A;  2EMG A;  3FIG A;  3OML A;  4ZYE A;  2B3T B;  4F9B B;  4B3T E;  2FGG A;  2YTP A;  2RSM A;  1PKP A;  2B7T A;  1QU6 A;  1IMU A;  2YWQ A;  4B3S E;  2B9D A;  1ZBT A;  1PJS A;  3MSW A;  4YHH E;  2DB2 A;  2PRT A;  3LML A;  2GHF A;  1N32 E;  1AAY A;  1X48 A;  2EOO A;  5IXM B;  5DNY A;  3C4B A;  4DV4 E;  2K4V A;  2DGC A;  5AAS A;  2KON A;  2LT7 A;  2RS6 A;  3MHH C;  3ADJ A;  3ADI A;  2DRP A;  1IBK E;  4DR7 E;  1YUI A;  2EPR A;  2VE7 C;  1N3G A;  2NAB A;  4TUG A;  4HEI A;  2EOE A;  4L5N C;  2EPK X;  3KWR A;  2L3C A;  2L2K B;  1A1L A;  2YTJ A;  3JAM C;  4X64 E;  3HPS A;  4WSG A;  5T6J A;  2YSP A;  2NUF A;  3BF2 A;  2F4V E;  4IJD A;  2YPN A;  2DLK A;  2EM6 A;  3HPZ A;  3THN A;  2YTQ A;  4TUI A;  4JYA E;  1DI2 A;  1WJP A;  4NZV A;  3OTO E;  5A6B A;  5LL6 R;  2UXC E;  2R1F A;  1FJG E;  1TF6 A;  2JOX A;  2YRK A;  3KZY A;  3UK3 C;  4DKK A;  2UXD E;  2FTX B;  4R03 A;  2B7V A;  2EOQ A;  2RS7 A;  2UXB E;  3EPJ A;  3ADG A;  2EN2 A;  1A1H A;  4LF4 E;  4R2D A;  3J7A G;  3ADL A;  2KOU A;  2EMA A;  2EJ4 A;  2EOM A;  2WCC 3;  4F2J C;  2VQE E;  5AE1 A;  3VK6 A;  4DR3 E;  2M9A A;  2YRH A;  4DV1 E;  1HR0 E;  3HTX A;  3T1Y E;  4DV0 E;  2NA2 A;  2EWL A;  2LRS A;  5LLQ A;  4DR6 E;  1EH8 A;  2EOH A;  4Q28 A;  1XNQ E;  4KHP E;  4DR1 E;  1IBM E;  3EPH A;  2HJJ A;  2EM5 A;  1QNT A;  1BBG A;  2UUC E;  3JTZ A;  1T38 A;  2DIX A;  4WYQ B;  4WX9 A;  1WXR A;  2V88 A;  2LJU A;  2LV2 A;  4GEQ B;  2EPM X;  4DMI A;  2MKN A;  2LE2 A;  2EQ3 A;  4R2A A;  1XMQ E;  2G7H A;  4FK5 C;  4KWY A;  1X49 A;  2JPA A;  2JXP A; 
#chains in the Genus database with same CATH homology
 1G2F C;  2MKD A;  2EOO A;  1BBO A;  2E72 A;  2EOS A;  2DLQ A;  4R2P A;  2EMB A;  1A1J A;  5KL2 A;  2EN8 A;  2EMW A;  3M99 B;  3MHS C;  2DGC A;  2EPP A;  2EPA A;  2LT7 A;  1NCS A;  2WBU A;  4R2Q A;  3MHH C;  2ENC A;  1RMD A;  2EP3 A;  4R2C A;  4X9J A;  2DRP A;  1ZU1 A;  1X3C A;  2JP9 A;  2YTF A;  2EL6 A;  3EPL A;  2YU5 A;  1A1G A;  1A1K A;  2EN3 A;  1YUJ A;  1YUI A;  2EPR A;  1A1I A;  2EE8 A;  2EMY A;  2NAB A;  2EML A;  2EOE A;  2EL5 A;  1KJK A;  2ENA A;  2EN4 A;  2BB8 A;  2CTD A;  2EMZ A;  2WBT A;  1A1L A;  2YTJ A;  2GLI A;  1X6E A;  2EOR A;  2RSI A;  2YTG A;  2ELZ A;  4WSG A;  1A1F A;  1X5W A;  2YSP A;  2EMX A;  4IJD A;  4R2E A;  1TF3 A;  2DLK A;  2EM3 A;  2LO3 A;  2EM6 A;  2MDG A;  2EM0 A;  1P47 A;  2EMK A;  2EOZ A;  2YTQ A;  2EPZ A;  1X6F A;  5KL3 A;  2EL4 A;  2J7J A;  2YTN A;  1WJP A;  4F6M A;  1TN9 A;  3VHT B;  1ZAA C;  4R2R A;  1UBD C;  4M9V C;  2A25 A;  2EN1 A;  2EQ1 A;  2R1F A;  2YRK A;  4R2S A;  1G2D C;  3UK3 C;  1TF6 A;  2EOY A;  2DMI A;  1X6H A;  4F6N A;  2EOQ A;  4IS1 C;  2CT1 A;  3EPJ A;  2EN2 A;  1UN6 B;  1A1H A;  2EMH A;  2EPX A;  2EPU A;  4R2D A;  2EMA A;  2YTE A;  2EJ4 A;  2EM7 A;  2EOM A;  2WCC 3;  1BB8 A;  4F2J C;  2RPC A;  2LCE A;  2EM8 A;  2EOI A;  2EPC A;  2M9A A;  1MEY C;  2YRH A;  5KL7 A;  2EQ0 A;  2HGH A;  2ENH A;  2D9H A;  2CSH A;  1F2I G;  2EMI A;  2EOF A;  4GZN C;  2EOJ A;  2LVH A;  2EOH A;  2EMC A;  2YRM A;  5KL5 A;  1JK2 A;  2EM2 A;  3EPH A;  2ADR A;  2EM9 A;  2YTO A;  2EM5 A;  2EM4 A;  2EOX A;  1JK1 A;  2ELY A;  2EMG A;  1Z1B A;  3EPK A;  2YSO A;  2EN7 A;  1YSA C;  2YTP A;  2YU8 A;  5KL4 A;  1B69 A;  2LV2 A;  2WBS A;  1DGC A;  2YTD A;  2YTI A;  2MKN A;  1LLM C;  2EQ3 A;  2EN6 A;  4R2A A;  5KL6 A;  2I13 A;  2EMF A;  4FK5 C;  2VRD A;  1ZR9 A;  2PRT A;  2JPA A;  2GHF A;  1AAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...