1P47A

Crystal structure of tandem zif268 molecules complexed to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*GP*TP*GP*GP*CP*GP*TP*GP*GP*GP*CP*GP*GP*CP*GP*TP*GP*GP*
publication title Constraints for Zinc Finger Linker Design as Inferred from X-ray Crystal Structure of Tandem Zif268-DNA Complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 26
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A03
2EOFA 4F6MA 2EPCA 2EMCA 2EN1A 2EOJA 1DGCA 1JK2A 2YTNA 2CTDA 2ENAA 2EOSA 2EN2A 2YRMA 1BB8A 2EN6A 2YTQA 2EPZA 4M9VC 1G2FC 1ZAAC 1F2IG 4WSGA 2YTJA 2EQ0A 2EL4A 1Z1BA 1B69A 2M9AA 3UK3C 4F6NA 1UN6B 2HGHA 2EMYA 3M99B 2EL6A 4R2CA 1A1KA 2ADRA 1UBDC 2EJ4A 5KL3A 2MDGA 2LO3A 2EPPA 4X9JA 2EOQA 2ENHA 2EP3A 4FK5C 5KL2A 2CSHA 2DMIA 1X5WA 1X6FA 4F2JC 2BB8A 2EM7A 2EQ1A 2GHFA 2EPXA 2YTOA 2YTEA 2YTDA 2EOXA 2I13A 3EPJA 2EMXA 2YTGA 2EMLA 2WBTA 2YSPA 3EPKA 4R2EA 3EPLA 4GZNC 2DLKA 1WJPA 1X6EA 2CT1A 2YSOA 4R2PA 2EOHA 2EL5A 4IJDA 2EOOA 2EQ3A 2EORA 4R2SA 1KJKA 2EN8A 2YRKA 2YU8A 2EPRA 2ENCA 2EM2A 2WBSA 2EN4A 1LLMC 2EN3A 2J7JA 2EOMA 2EOZA 4R2QA 2PRTA 2EPAA 2DGCA 2EMBA 2LVHA 2EM5A 1A1HA 2EOYA 2JP9A 1A1FA 5KL7A 2WCC3 1G2DC 1JK1A 1A1LA 2YTPA 1A1IA 2GLIA 2EM9A 2MKNA 2VRDA 2EMIA 1ZR9A 2EOEA 1X6HA 1TF6A 2EPUA 4R2DA 2EMHA 2EOIA 2EMAA 2EMFA 2RSIA 1TF3A 1YUIA 2EM4A 2LCEA 1P47A 2ELYA 2EMZA 1MEYC 2ELZA 2LV2A 5KL6A 5KL4A 2YTIA 3VHTB 1YSAC 1BBOA 2EMKA 4IS1C 1RMDA 2WBUA 2DRPA 2DLQA 1AAYA 2A25A 2EM0A 2YRHA 1A1JA 3MHHC 2NABA 2EM3A 2YU5A 2EM8A 1A1GA 1NCSA 2LT7A 2EM6A 2JPAA 2EMGA 1YUJA 2EN7A 3MHSC 4R2AA 2E72A 2EE8A 2MKDA 2R1FA 1ZU1A 1TN9A 1X3CA 2EMWA 5KL5A 4R2RA 2D9HA 3EPHA 2RPCA 2YTFA
chains in the Genus database with same CATH superfamily
3THOB 4RH8A 4X66E 3ADIA 3DJWA 2EPCA 3T1HE 1FJGE 5ADZA 3KZZA 2LJUA 2KONA 5LL6R 4K0KE 2UXCE 1KYQA 1JK2A 1AH5A 1WHQA 1F2IG 4JI5E 1UN6B 2V86A 3UK3C 3EQ1A 2EL6A 2KHXA 4X65E 3BF2A 2MDGA 2RS7A 4X9JA 2JY9A 2EP3A 5KL2A 4F2JC 4ZYDA 4LFAE 4NXME 2L92A 2YTEA 2V88A 4DKKA 2WBTA 4DR3E 4Q28A 4L5NC 2DLKA 1EKZA 2EZ6A 4BBYA 4DR4E 2B7TA 1X49A 2EL5A 4IJDA 4HTGA 4BHCA 4JI4E 2EOOA 4GKKE 2FGGA 2YU8A 2ENCA 3F6HA 4ZYHA 2YPNA 4R8OA 1LLMC 3F6GA 3ZOQB 2PRTA 5A6AA 4DV1E 2DGCA 4DV0E 1O0WA 3BGHA 4DR2E 1A1FA 3J7Yp 5KL7A 4B3RE 4LFCE 2CPNA 3C6MA 1IBME 2YTPA 2UUBE 2B3TB 5A69A 5AE3A 4BCAA 2LTRA 1NEIA 2EPUA 2JR1A 4R2DA 2DMYA 2RSIA 1TF3A 3HPSA 2LCEA 2VQEE 2NUFA 4B3ME 2UXDE 2ELZA 2LV2A 2K7IA 5IXMB 3VHTB 2H36X 1T4OA 4MLVA 2DRPA 2DLQA 1AAYA 1YZ9A 2A25A 2MC5A 2YRHA 5AE1A 1A1JA 1FKAE 2EM3A 2YU5A 2F4VE 2LT7A 4BC7A 1N33E 1T39A 4P78A 2MKDA 1WXRA 4BS9A 1YFHA 3JU0A 4WPYA 3EPHA 2LUQA 3MSWA 4DV2E 2EOFA 2I9IA 4LTYA 2JVAA 2LUPB 1J5EE 1SFEA 2EOJA 1DGCA 2CTDA 2ENAA 2YRMA 5A6JA 4I8OA 4M9VC 4JI1E 1PJTA 4WSGA 4YHHE 2EL4A 1Z1BA 2M9AA 3LMLA 4F6NA 2HGHA 2EMYA 4AQYE 2LTSA 2L33A 5IV8B 4GKJE 3K6QA 2V85A 5KL3A 2LBSB 2L8TA 3C4BA 2EOQA 5A2QC 2RQLA 2CSHA 1XMOE 4JV5E 2EM7A 2HC5A 3J81C 2LJHA 1SR9A 4WFTA 1MGTA 4DV3E 3EPJA 2EMXA 3EPKA 2N8XA 2YSPA 4OOGC 4R2EA 5AE2A 4JI6E 2EWLA 2ODRC 5F3WA 4B3TE 1N3GA 2YSOA 5IT9C 4LF7E 2EN8A 4DR6E 2JOBA 1IQSA 2L3CA 4O43A 3C6KA 1HNXE 2BBGA 1T38A 4DV6E 1HR0E 3BBGA 2LRSA 4O5GA 2EMBA 4DUZE 2DSYA 2EM5A 2E5LE 2EOYA 4GEQB 1G2DC 1A1LA 4M2ZA 3KWRA 1A1IA 5CFFE 2VRDA 2EPMX 3RMPA 1DI2A 4X62E 1ZR9A 3ADJA 3OMLA 1RQ0A 1ZBQA 2DIXA 4BC9A 2M7QA 1PDAA 2K4VA 2EMHA 1YYWA 2ODRD 1J26A 1PJQA 2ELYA 1IQOA 4MLQA 5FLXC 1I94E 5KL6A 2YTIA 1BBOA 4IS1C 4JI7E 4P7DA 1RC7A 3THNA 1UILA 1EH8A 2DB2A 4X64E 1A1GA 1QNTA 2WZOA 4DR7E 2MC6A 2EM6A 4KHPE 2EMGA 4JYAE 2EN7A 2E72A 4NZVA 4NXNE 1ZU1A 1TN9A 3C4TA 2YT4A 2VF1A 2RPCA 4BMJA 4F6MA 2NA2A 2L2NA 2NUEA 4BHBA 4N4RB 2V89A 2EPLX 1WHNA 2EOSA 4WX9A 4WYQB 1BB8A 2EN6A 1N34E 3L00A 4O4KA 2UUCE 2E1MA 3HXLA 4LF6E 2FTXB 2L3JA 2YTJA 1WRJA 2EQ0A 1IBLE 1N36E 2YZTA 3M99B 4R2CA 1A1KA 4J8ZA 2JOXA 4DUYE 1GTKA 1IBKE 2F8BA 1X47A 3LLHA 4JI8E 4TUIA 2EPPA 2V83A 4HEIA 2ENHA 4B3SE 2B7VA 2DMIA 1X5WA 1X6FA 2BB8A 2EQ1A 1ZBTA 4L8NA 4F54A 2EPXA 2YTOA 1YYOA 2V8QB 3P1XA 2YTDA 2EOXA 2I13A 2JXPA 2YTGA 3JAMC 4DMIA 2EMLA 3IWCA 3KZYA 2EPRA 3HQ1A 1N32E 4LF8E 1UHZA 2EN3A 3J80C 2J7JA 5AASA 2JYAA 5TSEA 2EPAA 2LVHA 2M1SA 1A1HA 2JP9A 2WCC3 5AC5A 5IWAE 1JK1A 5DNYA 2JWOA 3IWDA 2GLIA 5LLQA 4ZYEA 2MDRA 2EMIA 4YY3E 5LMUE 3IWBA 5A6BD 1X6HA 4X8WA 3BIDA 4DV5E 2EOIA 2EMFA 1YUIA 2EM4A 3T1YE 1P47A 2LE2A 4ZYGA 2EMZA 2L2KB 1GQEA 1STUA 1T4NA 1HNZE 3AV0A 5KL4A 1YPNA 2EMKA 1RMDA 4LF4E 1PJSA 4KZSA 1EH7A 2EM0A 3FIGA 2N3HA 1NCSA 4NHRA 2JPAA 1YUJA 4M0VA 4RHBB 3MHSC 2L2MA 2R1FA 4WXCA 1IMUA 4DR1E 3J7AG 3ADGA 4DR5E 3ADLA 5A6KA 2HJJA 3VYXA 3HTXA 2M4IA 2EMCA 2EN1A 2GPIA 2LMZA 4LF9E 2VE7C 2YTNA 2EN2A 2YTQA 3H09A 2EPZA 2ZM6E 1G2FC 1ZAAC 2HHHE 1B69A 4LFBE 4WXDA 4F9CB 4R03A 3TQMA 2ADRA 1X48A 1UBDC 2EJ4A 2LO3A 4FK5C 4LU9A 5AC4A 2GHFA 2RTXA 2NUGA 5BR8E 1XNQE 1GZ6A 2YWQA 3EPLA 4GZNC 2Q8UA 4WSPA 1WJPA 1X6EA 2IHR1 2CT1A 4R2PA 2EOHA 2L6MA 3ECRA 2EQ3A 2EORA 4R2SA 1KJKA 2YRKA 1T4LB 2EM2A 2WBSA 2VQFE 2EN4A 5LMNE 2EOMA 2EOZA 4R2QA 2UXBE 2N3GA 2RS6A 4JI0E 2V87A 2EPOA 1HNWE 1PKPA 2EM9A 4KWYA 2MKNA 2KOUA 4JI2E 2R76A 4F9BB 4DV4E 4OX9E 2EOEA 3QG5C 1TF6A 3JTZA 4Q35B 2EPNA 2EMAA 3HPZA 4O24A 4JI3E 1YYKA 2RSMA 2G7HA 1MEYC 2UU9E 1DQ3A 1EH6A 1YSAC 1BBGA 1L4SA 2WBUA 1XNRE 3OTOE 1QU6A 3AUZA 4DV7E 3MHHC 2EPKX 2NABA 3VYYA 2B9DA 2EM8A 2UUAE 4M30A 2FV4B 4LF5E 3DF6A 4F9AB 4TUGA 4R2AA 2EE8A 1XMQE 3VK6A 5A6BA 1X3CA 2EMWA 5KL5A 4R2RA 2D9HA 5T6JA 2YTFA
chains in the Genus database with same CATH topology
2EOFA 4F6MA 2EPCA 2EMCA 2EN1A 2EOJA 1DGCA 1JK2A 2YTNA 2CTDA 2ENAA 2EOSA 2EN2A 2YRMA 1BB8A 2EN6A 2YTQA 2EPZA 4M9VC 1G2FC 1ZAAC 1F2IG 4WSGA 2YTJA 2EQ0A 2EL4A 1Z1BA 1B69A 2M9AA 3UK3C 4F6NA 1UN6B 2HGHA 2EMYA 3M99B 2EL6A 4R2CA 1A1KA 2ADRA 1UBDC 2EJ4A 5KL3A 2MDGA 2LO3A 2EPPA 4X9JA 2EOQA 2ENHA 2EP3A 4FK5C 5KL2A 2CSHA 2DMIA 1X5WA 1X6FA 4F2JC 2BB8A 2EM7A 2EQ1A 2GHFA 2EPXA 2YTOA 2YTEA 2YTDA 2EOXA 2I13A 3EPJA 2EMXA 2YTGA 2EMLA 2WBTA 2YSPA 3EPKA 4R2EA 3EPLA 4GZNC 2DLKA 1WJPA 1X6EA 2CT1A 2YSOA 4R2PA 2EOHA 2EL5A 4IJDA 2EOOA 2EQ3A 2EORA 4R2SA 1KJKA 2EN8A 2YRKA 2YU8A 2EPRA 2ENCA 2EM2A 2WBSA 2EN4A 1LLMC 2EN3A 2J7JA 2EOMA 2EOZA 4R2QA 2PRTA 2EPAA 2DGCA 2EMBA 2LVHA 2EM5A 1A1HA 2EOYA 2JP9A 1A1FA 5KL7A 2WCC3 1G2DC 1JK1A 1A1LA 2YTPA 1A1IA 2GLIA 2EM9A 2MKNA 2VRDA 2EMIA 1ZR9A 2EOEA 1X6HA 1TF6A 2EPUA 4R2DA 2EMHA 2EOIA 2EMAA 2EMFA 2RSIA 1TF3A 1YUIA 2EM4A 2LCEA 1P47A 2ELYA 2EMZA 1MEYC 2ELZA 2LV2A 5KL6A 5KL4A 2YTIA 3VHTB 1YSAC 1BBOA 2EMKA 4IS1C 1RMDA 2WBUA 2DRPA 2DLQA 1AAYA 2A25A 2EM0A 2YRHA 1A1JA 3MHHC 2NABA 2EM3A 2YU5A 2EM8A 1A1GA 1NCSA 2LT7A 2EM6A 2JPAA 2EMGA 1YUJA 2EN7A 3MHSC 4R2AA 2E72A 2EE8A 2MKDA 2R1FA 1ZU1A 1TN9A 1X3CA 2EMWA 5KL5A 4R2RA 2D9HA 3EPHA 2RPCA 2YTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOF A;  4F6M A;  2EPC A;  2EMC A;  2EN1 A;  2EOJ A;  1DGC A;  1JK2 A;  2YTN A;  2CTD A;  2ENA A;  2EOS A;  2EN2 A;  2YRM A;  1BB8 A;  2EN6 A;  2YTQ A;  2EPZ A;  4M9V C;  1G2F C;  1ZAA C;  1F2I G;  4WSG A;  2YTJ A;  2EQ0 A;  2EL4 A;  1Z1B A;  1B69 A;  2M9A A;  3UK3 C;  4F6N A;  1UN6 B;  2HGH A;  2EMY A;  3M99 B;  2EL6 A;  4R2C A;  1A1K A;  2ADR A;  1UBD C;  2EJ4 A;  5KL3 A;  2MDG A;  2LO3 A;  2EPP A;  4X9J A;  2EOQ A;  2ENH A;  2EP3 A;  4FK5 C;  5KL2 A;  2CSH A;  2DMI A;  1X5W A;  1X6F A;  4F2J C;  2BB8 A;  2EM7 A;  2EQ1 A;  2GHF A;  2EPX A;  2YTO A;  2YTE A;  2YTD A;  2EOX A;  2I13 A;  3EPJ A;  2EMX A;  2YTG A;  2EML A;  2WBT A;  2YSP A;  3EPK A;  4R2E A;  3EPL A;  4GZN C;  2DLK A;  1WJP A;  1X6E A;  2CT1 A;  2YSO A;  4R2P A;  2EOH A;  2EL5 A;  4IJD A;  2EOO A;  2EQ3 A;  2EOR A;  4R2S A;  1KJK A;  2EN8 A;  2YRK A;  2YU8 A;  2EPR A;  2ENC A;  2EM2 A;  2WBS A;  2EN4 A;  1LLM C;  2EN3 A;  2J7J A;  2EOM A;  2EOZ A;  4R2Q A;  2PRT A;  2EPA A;  2DGC A;  2EMB A;  2LVH A;  2EM5 A;  1A1H A;  2EOY A;  2JP9 A;  1A1F A;  5KL7 A;  2WCC 3;  1G2D C;  1JK1 A;  1A1L A;  2YTP A;  1A1I A;  2GLI A;  2EM9 A;  2MKN A;  2VRD A;  2EMI A;  1ZR9 A;  2EOE A;  1X6H A;  1TF6 A;  2EPU A;  4R2D A;  2EMH A;  2EOI A;  2EMA A;  2EMF A;  2RSI A;  1TF3 A;  1YUI A;  2EM4 A;  2LCE A;  1P47 A;  2ELY A;  2EMZ A;  1MEY C;  2ELZ A;  2LV2 A;  5KL6 A;  5KL4 A;  2YTI A;  3VHT B;  1YSA C;  1BBO A;  2EMK A;  4IS1 C;  1RMD A;  2WBU A;  2DRP A;  2DLQ A;  1AAY A;  2A25 A;  2EM0 A;  2YRH A;  1A1J A;  3MHH C;  2NAB A;  2EM3 A;  2YU5 A;  2EM8 A;  1A1G A;  1NCS A;  2LT7 A;  2EM6 A;  2JPA A;  2EMG A;  1YUJ A;  2EN7 A;  3MHS C;  4R2A A;  2E72 A;  2EE8 A;  2MKD A;  2R1F A;  1ZU1 A;  1TN9 A;  1X3C A;  2EMW A;  5KL5 A;  4R2R A;  2D9H A;  3EPH A;  2RPC A;  2YTF A; 
#chains in the Genus database with same CATH topology
 3THO B;  4RH8 A;  4X66 E;  3ADI A;  3DJW A;  2EPC A;  3T1H E;  1FJG E;  5ADZ A;  3KZZ A;  2LJU A;  2KON A;  5LL6 R;  4K0K E;  2UXC E;  1KYQ A;  1JK2 A;  1AH5 A;  1WHQ A;  1F2I G;  4JI5 E;  1UN6 B;  2V86 A;  3UK3 C;  3EQ1 A;  2EL6 A;  2KHX A;  4X65 E;  3BF2 A;  2MDG A;  2RS7 A;  4X9J A;  2JY9 A;  2EP3 A;  5KL2 A;  4F2J C;  4ZYD A;  4LFA E;  4NXM E;  2L92 A;  2YTE A;  2V88 A;  4DKK A;  2WBT A;  4DR3 E;  4Q28 A;  4L5N C;  2DLK A;  1EKZ A;  2EZ6 A;  4BBY A;  4DR4 E;  2B7T A;  1X49 A;  2EL5 A;  4IJD A;  4HTG A;  4BHC A;  4JI4 E;  2EOO A;  4GKK E;  2FGG A;  2YU8 A;  2ENC A;  3F6H A;  4ZYH A;  2YPN A;  4R8O A;  1LLM C;  3F6G A;  3ZOQ B;  2PRT A;  5A6A A;  4DV1 E;  2DGC A;  4DV0 E;  1O0W A;  3BGH A;  4DR2 E;  1A1F A;  3J7Y p;  5KL7 A;  4B3R E;  4LFC E;  2CPN A;  3C6M A;  1IBM E;  2YTP A;  2UUB E;  2B3T B;  5A69 A;  5AE3 A;  4BCA A;  2LTR A;  1NEI A;  2EPU A;  2JR1 A;  4R2D A;  2DMY A;  2RSI A;  1TF3 A;  3HPS A;  2LCE A;  2VQE E;  2NUF A;  4B3M E;  2UXD E;  2ELZ A;  2LV2 A;  2K7I A;  5IXM B;  3VHT B;  2H36 X;  1T4O A;  4MLV A;  2DRP A;  2DLQ A;  1AAY A;  1YZ9 A;  2A25 A;  2MC5 A;  2YRH A;  5AE1 A;  1A1J A;  1FKA E;  2EM3 A;  2YU5 A;  2F4V E;  2LT7 A;  4BC7 A;  1N33 E;  1T39 A;  4P78 A;  2MKD A;  1WXR A;  4BS9 A;  1YFH A;  3JU0 A;  4WPY A;  3EPH A;  2LUQ A;  3MSW A;  4DV2 E;  2EOF A;  2I9I A;  4LTY A;  2JVA A;  2LUP B;  1J5E E;  1SFE A;  2EOJ A;  1DGC A;  2CTD A;  2ENA A;  2YRM A;  5A6J A;  4I8O A;  4M9V C;  4JI1 E;  1PJT A;  4WSG A;  4YHH E;  2EL4 A;  1Z1B A;  2M9A A;  3LML A;  4F6N A;  2HGH A;  2EMY A;  4AQY E;  2LTS A;  2L33 A;  5IV8 B;  4GKJ E;  3K6Q A;  2V85 A;  5KL3 A;  2LBS B;  2L8T A;  3C4B A;  2EOQ A;  5A2Q C;  2RQL A;  2CSH A;  1XMO E;  4JV5 E;  2EM7 A;  2HC5 A;  3J81 C;  2LJH A;  1SR9 A;  4WFT A;  1MGT A;  4DV3 E;  3EPJ A;  2EMX A;  3EPK A;  2N8X A;  2YSP A;  4OOG C;  4R2E A;  5AE2 A;  4JI6 E;  2EWL A;  2ODR C;  5F3W A;  4B3T E;  1N3G A;  2YSO A;  5IT9 C;  4LF7 E;  2EN8 A;  4DR6 E;  2JOB A;  1IQS A;  2L3C A;  4O43 A;  3C6K A;  1HNX E;  2BBG A;  1T38 A;  4DV6 E;  1HR0 E;  3BBG A;  2LRS A;  4O5G A;  2EMB A;  4DUZ E;  2DSY A;  2EM5 A;  2E5L E;  2EOY A;  4GEQ B;  1G2D C;  1A1L A;  4M2Z A;  3KWR A;  1A1I A;  5CFF E;  2VRD A;  2EPM X;  3RMP A;  1DI2 A;  4X62 E;  1ZR9 A;  3ADJ A;  3OML A;  1RQ0 A;  1ZBQ A;  2DIX A;  4BC9 A;  2M7Q A;  1PDA A;  2K4V A;  2EMH A;  1YYW A;  2ODR D;  1J26 A;  1PJQ A;  2ELY A;  1IQO A;  4MLQ A;  5FLX C;  1I94 E;  5KL6 A;  2YTI A;  1BBO A;  4IS1 C;  4JI7 E;  4P7D A;  1RC7 A;  3THN A;  1UIL A;  1EH8 A;  2DB2 A;  4X64 E;  1A1G A;  1QNT A;  2WZO A;  4DR7 E;  2MC6 A;  2EM6 A;  4KHP E;  2EMG A;  4JYA E;  2EN7 A;  2E72 A;  4NZV A;  4NXN E;  1ZU1 A;  1TN9 A;  3C4T A;  2YT4 A;  2VF1 A;  2RPC A;  4BMJ A;  4F6M A;  2NA2 A;  2L2N A;  2NUE A;  4BHB A;  4N4R B;  2V89 A;  2EPL X;  1WHN A;  2EOS A;  4WX9 A;  4WYQ B;  1BB8 A;  2EN6 A;  1N34 E;  3L00 A;  4O4K A;  2UUC E;  2E1M A;  3HXL A;  4LF6 E;  2FTX B;  2L3J A;  2YTJ A;  1WRJ A;  2EQ0 A;  1IBL E;  1N36 E;  2YZT A;  3M99 B;  4R2C A;  1A1K A;  4J8Z A;  2JOX A;  4DUY E;  1GTK A;  1IBK E;  2F8B A;  1X47 A;  3LLH A;  4JI8 E;  4TUI A;  2EPP A;  2V83 A;  4HEI A;  2ENH A;  4B3S E;  2B7V A;  2DMI A;  1X5W A;  1X6F A;  2BB8 A;  2EQ1 A;  1ZBT A;  4L8N A;  4F54 A;  2EPX A;  2YTO A;  1YYO A;  2V8Q B;  3P1X A;  2YTD A;  2EOX A;  2I13 A;  2JXP A;  2YTG A;  3JAM C;  4DMI A;  2EML A;  3IWC A;  3KZY A;  2EPR A;  3HQ1 A;  1N32 E;  4LF8 E;  1UHZ A;  2EN3 A;  3J80 C;  2J7J A;  5AAS A;  2JYA A;  5TSE A;  2EPA A;  2LVH A;  2M1S A;  1A1H A;  2JP9 A;  2WCC 3;  5AC5 A;  5IWA E;  1JK1 A;  5DNY A;  2JWO A;  3IWD A;  2GLI A;  5LLQ A;  4ZYE A;  2MDR A;  2EMI A;  4YY3 E;  5LMU E;  3IWB A;  5A6B D;  1X6H A;  4X8W A;  3BID A;  4DV5 E;  2EOI A;  2EMF A;  1YUI A;  2EM4 A;  3T1Y E;  1P47 A;  2LE2 A;  4ZYG A;  2EMZ A;  2L2K B;  1GQE A;  1STU A;  1T4N A;  1HNZ E;  3AV0 A;  5KL4 A;  1YPN A;  2EMK A;  1RMD A;  4LF4 E;  1PJS A;  4KZS A;  1EH7 A;  2EM0 A;  3FIG A;  2N3H A;  1NCS A;  4NHR A;  2JPA A;  1YUJ A;  4M0V A;  4RHB B;  3MHS C;  2L2M A;  2R1F A;  4WXC A;  1IMU A;  4DR1 E;  3J7A G;  3ADG A;  4DR5 E;  3ADL A;  5A6K A;  2HJJ A;  3VYX A;  3HTX A;  2M4I A;  2EMC A;  2EN1 A;  2GPI A;  2LMZ A;  4LF9 E;  2VE7 C;  2YTN A;  2EN2 A;  2YTQ A;  3H09 A;  2EPZ A;  2ZM6 E;  1G2F C;  1ZAA C;  2HHH E;  1B69 A;  4LFB E;  4WXD A;  4F9C B;  4R03 A;  3TQM A;  2ADR A;  1X48 A;  1UBD C;  2EJ4 A;  2LO3 A;  4FK5 C;  4LU9 A;  5AC4 A;  2GHF A;  2RTX A;  2NUG A;  5BR8 E;  1XNQ E;  1GZ6 A;  2YWQ A;  3EPL A;  4GZN C;  2Q8U A;  4WSP A;  1WJP A;  1X6E A;  2IHR 1;  2CT1 A;  4R2P A;  2EOH A;  2L6M A;  3ECR A;  2EQ3 A;  2EOR A;  4R2S A;  1KJK A;  2YRK A;  1T4L B;  2EM2 A;  2WBS A;  2VQF E;  2EN4 A;  5LMN E;  2EOM A;  2EOZ A;  4R2Q A;  2UXB E;  2N3G A;  2RS6 A;  4JI0 E;  2V87 A;  2EPO A;  1HNW E;  1PKP A;  2EM9 A;  4KWY A;  2MKN A;  2KOU A;  4JI2 E;  2R76 A;  4F9B B;  4DV4 E;  4OX9 E;  2EOE A;  3QG5 C;  1TF6 A;  3JTZ A;  4Q35 B;  2EPN A;  2EMA A;  3HPZ A;  4O24 A;  4JI3 E;  1YYK A;  2RSM A;  2G7H A;  1MEY C;  2UU9 E;  1DQ3 A;  1EH6 A;  1YSA C;  1BBG A;  1L4S A;  2WBU A;  1XNR E;  3OTO E;  1QU6 A;  3AUZ A;  4DV7 E;  3MHH C;  2EPK X;  2NAB A;  3VYY A;  2B9D A;  2EM8 A;  2UUA E;  4M30 A;  2FV4 B;  4LF5 E;  3DF6 A;  4F9A B;  4TUG A;  4R2A A;  2EE8 A;  1XMQ E;  3VK6 A;  5A6B A;  1X3C A;  2EMW A;  5KL5 A;  4R2R A;  2D9H A;  5T6J A;  2YTF A; 
#chains in the Genus database with same CATH homology
 2EOF A;  4F6M A;  2EPC A;  2EMC A;  2EN1 A;  2EOJ A;  1DGC A;  1JK2 A;  2YTN A;  2CTD A;  2ENA A;  2EOS A;  2EN2 A;  2YRM A;  1BB8 A;  2EN6 A;  2YTQ A;  2EPZ A;  4M9V C;  1G2F C;  1ZAA C;  1F2I G;  4WSG A;  2YTJ A;  2EQ0 A;  2EL4 A;  1Z1B A;  1B69 A;  2M9A A;  3UK3 C;  4F6N A;  1UN6 B;  2HGH A;  2EMY A;  3M99 B;  2EL6 A;  4R2C A;  1A1K A;  2ADR A;  1UBD C;  2EJ4 A;  5KL3 A;  2MDG A;  2LO3 A;  2EPP A;  4X9J A;  2EOQ A;  2ENH A;  2EP3 A;  4FK5 C;  5KL2 A;  2CSH A;  2DMI A;  1X5W A;  1X6F A;  4F2J C;  2BB8 A;  2EM7 A;  2EQ1 A;  2GHF A;  2EPX A;  2YTO A;  2YTE A;  2YTD A;  2EOX A;  2I13 A;  3EPJ A;  2EMX A;  2YTG A;  2EML A;  2WBT A;  2YSP A;  3EPK A;  4R2E A;  3EPL A;  4GZN C;  2DLK A;  1WJP A;  1X6E A;  2CT1 A;  2YSO A;  4R2P A;  2EOH A;  2EL5 A;  4IJD A;  2EOO A;  2EQ3 A;  2EOR A;  4R2S A;  1KJK A;  2EN8 A;  2YRK A;  2YU8 A;  2EPR A;  2ENC A;  2EM2 A;  2WBS A;  2EN4 A;  1LLM C;  2EN3 A;  2J7J A;  2EOM A;  2EOZ A;  4R2Q A;  2PRT A;  2EPA A;  2DGC A;  2EMB A;  2LVH A;  2EM5 A;  1A1H A;  2EOY A;  2JP9 A;  1A1F A;  5KL7 A;  2WCC 3;  1G2D C;  1JK1 A;  1A1L A;  2YTP A;  1A1I A;  2GLI A;  2EM9 A;  2MKN A;  2VRD A;  2EMI A;  1ZR9 A;  2EOE A;  1X6H A;  1TF6 A;  2EPU A;  4R2D A;  2EMH A;  2EOI A;  2EMA A;  2EMF A;  2RSI A;  1TF3 A;  1YUI A;  2EM4 A;  2LCE A;  1P47 A;  2ELY A;  2EMZ A;  1MEY C;  2ELZ A;  2LV2 A;  5KL6 A;  5KL4 A;  2YTI A;  3VHT B;  1YSA C;  1BBO A;  2EMK A;  4IS1 C;  1RMD A;  2WBU A;  2DRP A;  2DLQ A;  1AAY A;  2A25 A;  2EM0 A;  2YRH A;  1A1J A;  3MHH C;  2NAB A;  2EM3 A;  2YU5 A;  2EM8 A;  1A1G A;  1NCS A;  2LT7 A;  2EM6 A;  2JPA A;  2EMG A;  1YUJ A;  2EN7 A;  3MHS C;  4R2A A;  2E72 A;  2EE8 A;  2MKD A;  2R1F A;  1ZU1 A;  1TN9 A;  1X3C A;  2EMW A;  5KL5 A;  4R2R A;  2D9H A;  3EPH A;  2RPC A;  2YTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...