1P47A

Crystal structure of tandem zif268 molecules complexed to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*GP*TP*GP*GP*CP*GP*TP*GP*GP*GP*CP*GP*GP*CP*GP*TP*GP*GP*
publication title Constraints for Zinc Finger Linker Design as Inferred from X-ray Crystal Structure of Tandem Zif268-DNA Complexes
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A03
2R1FA 1B69A 2YSOA 1LLMC 2DGCA 2EN3A 2LV2A 3MHSC 1TN9A 4R2QA 2EMWA 2EMYA 2YRHA 1JK1A 1P47A 2MKDA 4R2SA 2EOIA 1YSAC 1RMDA 2DLQA 2EMKA 1YUIA 2CSHA 2ELYA 2EMCA 2EM4A 5KL2A 2YSPA 2EM2A 1A1KA 1ZU1A 3EPHA 5KL5A 1X3CA 1X6HA 2EMBA 1A1IA 1DGCA 2EMGA 2EN1A 2EOEA 2YTFA 2EN6A 5KL3A 2EMAA 3EPKA 2EMFA 1A1GA 2YU8A 2EQ0A 2EM8A 2EOHA 4FK5C 2ENAA 1X6EA 5KL6A 1F2IG 2YTPA 2EPCA 2VRDA 1A1LA 2GLIA 2EQ3A 2GHFA 2EMLA 2DLKA 1ZR9A 2YRMA 1JK2A 1X6FA 1UBDC 2D9HA 2WBUA 2EM9A 2LVHA 1MEYC 2EPUA 4F6MA 2EPZA 2EMHA 2ENHA 2EPAA 2EM5A 2YTGA 3M99B 4R2PA 4M9VC 2EN4A 2E72A 2NABA 4R2DA 2CTDA 5KL4A 2EM3A 3VHTB 2EL5A 1A1JA 1UN6B 2MDGA 2JP9A 2ADRA 2EN7A 2EL6A 2EOJA 2EOXA 2EQ1A 2I13A 2JPAA 1NCSA 1BBOA 4F6NA 3MHHC 2YTIA 2EPPA 2WCC3 2EM6A 4R2AA 1YUJA 2YTNA 1WJPA 2WBSA 2ELZA 4GZNC 4R2EA 2EN2A 4IS1C 1KJKA 2EMXA 2PRTA 2EOQA 2YTQA 2DRPA 4R2CA 2WBTA 1BB8A 2EN8A 2EOOA 4IJDA 2EOMA 2EOYA 2EMIA 2BB8A 2YTJA 4R2RA 2DMIA 2YTEA 2HGHA 2EOZA 4WSGA 2J7JA 1Z1BA 2EPRA 5KL7A 2LT7A 2EL4A 2EJ4A 2LCEA 3UK3C 1A1FA 2ENCA 2EM0A 2CT1A 2YTOA 1A1HA 2YTDA 1X5WA 2EPXA 2EMZA 2EORA 1TF3A 2MKNA 1G2FC 2EP3A 2LO3A 4X9JA 2M9AA 1G2DC 2RSIA 1AAYA 2YU5A 3EPJA 2EE8A 2A25A 2EM7A 2EOSA 2RPCA 2EOFA 2YRKA 4F2JC 3EPLA 1ZAAC 1TF6A
chains in the Genus database with same CATH superfamily
2F4VE 2YSOA 1EKZA 1L4SA 2EN3A 4WXDA 1TN9A 4R2QA 1I94E 2IHR1 2DMYA 4M0VA 2LTSA 4HTGA 1JK1A 4B3ME 3OTOE 4DR4E 4RHBB 3AV0A 1N34E 1YUIA 2EMCA 5KL2A 2DIXA 2YSPA 1A1KA 1NEIA 5ADZA 1GZ6A 3C4TA 1X47A 1IQOA 1X6HA 2EMBA 1A1IA 5IV8B 2RS6A 4B3TE 5TSEA 2L33A 2EQ0A 1MGTA 3T1YE 1F2IG 2L92A 4N4RB 1BBGA 3J7Yp 1A1LA 3F6GA 4F54A 1JK2A 4JI2E 2D9HA 2M4IA 2HHHE 4X8WA 2EM9A 5AC4A 4M2ZA 2EPZA 4O43A 4JI0E 1X49A 4BHCA 3K6QA 2EPAA 3QG5C 4P78A 2L3JA 2LUQA 5IT9C 4M9VC 2EN4A 3J80C 3L00A 2NUGA 3IWBA 2UXBE 1HNZE 2EWLA 3VHTB 4Q28A 3THOB 1PJTA 2BBGA 2JXPA 3KZYA 1YZ9A 2EOXA 2EQ1A 4DV7E 2ZM6E 4KHPE 3VK6A 5A6JA 4JI4E 2WCC3 4R2AA 2EPNA 1N3GA 3HPSA 4R8OA 4BS9A 4DR2E 4R2EA 4IS1C 2EPLX 4NXME 2F8BA 2EOMA 2KONA 2YTJA 4R2RA 2EOZA 2H36X 2J7JA 4AQYE 1IMUA 5LMNE 2EM0A 2E5LE 1A1HA 2YTDA 1X5WA 2EMZA 3JAMC 2EORA 1TF3A 4WXCA 2MKNA 1XNRE 2M9AA 1PJQA 5IXMB 4NZVA 2DSYA 4O4KA 2YRKA 5A2QC 3C6KA 2V83A 1B69A 1KYQA 2YRHA 2JVAA 2M1SA 1ZBTA 1FKAE 2N3GA 2UXDE 2EMKA 5F3WA 1YPNA 2JWOA 3EQ1A 2CSHA 2RS7A 1ZBQA 2EM2A 4NXNE 1T4LB 3T1HE 4LF5E 4X64E 2K4VA 1DGCA 3BGHA 2EMAA 2EOHA 4FK5C 4NHRA 1X6EA 5KL6A 1EH7A 2DLKA 1UBDC 4WFTA 4LF8E 4ZYHA 2EMHA 4B3RE 3ADLA 2R76A 2EM5A 2YTGA 4R2PA 2NABA 4R2DA 1YFHA 1IBME 2NUEA 1A1JA 2GPIA 2UXCE 1XMQE 2JP9A 5FLXC 2EL6A 4BBYA 5DNYA 3MSWA 2B7TA 3BIDA 2YTIA 5T6JA 1YUJA 2L2NA 2YTNA 1WJPA 3KZZA 4GZNC 1PKPA 2EMXA 2PRTA 2V89A 3JU0A 1EH8A 1BB8A 2EOOA 1SR9A 3FIGA 4IJDA 2JY9A 2EOYA 2UUCE 4WPYA 2YTEA 4WSGA 1XMOE 4LF9E 2LJHA 4ZYDA 2EL4A 2JYAA 3UK3C 2RSMA 1WXRA 2JOXA 2LE2A 1YYKA 2YTOA 4OX9E 2EPXA 4DR1E 1YYWA 1HNWE 1QNTA 1G2FC 2LO3A 4X9JA 4LFBE 4JV5E 5IWAE 2VQEE 2UUBE 2YU5A 3J81C 2EM7A 2EOSA 1T4NA 4F2JC 4L8NA 3HPZA 2R1FA 5LL6R 3TQMA 4I8OA 2V86A 2L8TA 2LMZA 3MHSC 4DUYE 3C4BA 3VYYA 3JTZA 1IBLE 1HR0E 1STUA 1UILA 3ADJA 1P47A 2N3HA 2YZTA 4F9AB 4R2SA 1X48A 2KHXA 1YSAC 2DLQA 2ELYA 2V88A 4B3SE 4YHHE 3EPHA 4LF7E 1WRJA 5A6BA 2EN1A 3EPKA 5KL3A 4DUZE 2YU8A 4DMIA 1GQEA 2ENAA 1EH6A 2FV4B 4GEQB 2JR1A 2YTPA 4YY3E 2NA2A 2VRDA 4R03A 3DJWA 4BHBA 1J5EE 3F6HA 2GLIA 4KWYA 2GHFA 1FJGE 2EMLA 2HC5A 2YRMA 1ZR9A 3P1XA 2LUPB 1N36E 2L2MA 1MEYC 2EPUA 4DR3E 3VYXA 1GTKA 2YT4A 1RC7A 5AE2A 2ODRD 3LLHA 4WYQB 2CTDA 2LBSB 2EM3A 4GKKE 2EL5A 2FTXB 4Q35B 2EZ6A 2EN7A 3LMLA 2L3CA 4ZYEA 2VE7C 1NCSA 1BBOA 5A69A 4F6NA 3MHHC 2E1MA 1T4OA 2EPPA 3H09A 2EM6A 4LU9A 2EPOA 4DR6E 1WHQA 1IBKE 2L6MA 2B3TB 1N32E 2ELZA 2UU9E 1XNQE 1UHZA 2YTQA 4O24A 5AE1A 2EN8A 1DI2A 2BB8A 5AE3A 5CFFE 3HQ1A 2JOBA 4BMJA 2LJUA 2EPRA 2LT7A 2LCEA 1A1FA 1YYOA 4TUGA 2ENCA 4LFAE 2CT1A 1J26A 4MLVA 4X62E 4M30A 3DF6A 4TUIA 1DQ3A 2EP3A 4DKKA 4BC9A 1G2DC 2RSIA 1AAYA 3EPJA 2A25A 2RPCA 3C6MA 3HXLA 3EPLA 4LFCE 1ZAAC 1TF6A 4LF6E 4DV5E 4DV3E 1T38A 2N8XA 1LLMC 2DGCA 4JYAE 2LV2A 4KZSA 2VF1A 2EMWA 1SFEA 2EMYA 1N33E 3J7AG 2B7VA 1RQ0A 2MKDA 4MLQA 4WX9A 4K0KE 2EOIA 1RMDA 3THNA 4BCAA 2M7QA 4DV1E 4J8ZA 2EM4A 1ZU1A 2RTXA 5KL5A 1X3CA 2DB2A 2MC5A 5LMUE 2MC6A 1IQSA 2EMGA 2EOEA 2YTFA 3OMLA 2EN6A 4DV2E 2EMFA 1A1GA 2EM8A 3IWCA 4RH8A 2L2KB 2EPCA 4WSPA 2G7HA 3BBGA 2EQ3A 1X6FA 4O5GA 2EPKX 1HNXE 4OOGC 2WBUA 2LVHA 3HTXA 1AH5A 2B9DA 2V8QB 4F6MA 2ENHA 2EPMX 4BC7A 2LRSA 4GKJE 2YWQA 2NUFA 4DV0E 3M99B 2Q8UA 2E72A 2KOUA 4X66E 2HJJA 4JI7E 5KL4A 1O0WA 1UN6B 2MDGA 2ADRA 2RQLA 4HEIA 4DR5E 2EOJA 2I13A 5AC5A 2JPAA 3ADGA 1T39A 2YPNA 3AUZA 5A6BD 4L5NC 5A6KA 4DR7E 1PJSA 2WBSA 5AASA 4DV4E 2EN2A 3IWDA 1KJKA 2EOQA 2DRPA 4R2CA 2CPNA 2WBTA 2FGGA 2ODRC 1WHNA 2EMIA 4F9CB 4DV6E 2DMIA 2LTRA 2HGHA 4JI1E 1Z1BA 3BF2A 5KL7A 4JI3E 4P7DA 2EJ4A 2VQFE 3ECRA 2V87A 4LF4E 2I9IA 2K7IA 1PDAA 2V85A 4JI8E 5LLQA 4JI6E 4X65E 3RMPA 2MDRA 3KWRA 2WZOA 4LTYA 1QU6A 3ADIA 4ZYGA 4JI5E 2EE8A 2EOFA 2UUAE 4F9BB 3ZOQB 5A6AA 5BR8E
chains in the Genus database with same CATH topology
2R1FA 1B69A 2YSOA 1LLMC 2DGCA 2EN3A 2LV2A 3MHSC 1TN9A 4R2QA 2EMWA 2EMYA 2YRHA 1JK1A 1P47A 2MKDA 4R2SA 2EOIA 1YSAC 1RMDA 2DLQA 2EMKA 1YUIA 2CSHA 2ELYA 2EMCA 2EM4A 5KL2A 2YSPA 2EM2A 1A1KA 1ZU1A 3EPHA 5KL5A 1X3CA 1X6HA 2EMBA 1A1IA 1DGCA 2EMGA 2EN1A 2EOEA 2YTFA 2EN6A 5KL3A 2EMAA 3EPKA 2EMFA 1A1GA 2YU8A 2EQ0A 2EM8A 2EOHA 4FK5C 2ENAA 1X6EA 5KL6A 1F2IG 2YTPA 2EPCA 2VRDA 1A1LA 2GLIA 2EQ3A 2GHFA 2EMLA 2DLKA 1ZR9A 2YRMA 1JK2A 1X6FA 1UBDC 2D9HA 2WBUA 2EM9A 2LVHA 1MEYC 2EPUA 4F6MA 2EPZA 2EMHA 2ENHA 2EPAA 2EM5A 2YTGA 3M99B 4R2PA 4M9VC 2EN4A 2E72A 2NABA 4R2DA 2CTDA 5KL4A 2EM3A 3VHTB 2EL5A 1A1JA 1UN6B 2MDGA 2JP9A 2ADRA 2EN7A 2EL6A 2EOJA 2EOXA 2EQ1A 2I13A 2JPAA 1NCSA 1BBOA 4F6NA 3MHHC 2YTIA 2EPPA 2WCC3 2EM6A 4R2AA 1YUJA 2YTNA 1WJPA 2WBSA 2ELZA 4GZNC 4R2EA 2EN2A 4IS1C 1KJKA 2EMXA 2PRTA 2EOQA 2YTQA 2DRPA 4R2CA 2WBTA 1BB8A 2EN8A 2EOOA 4IJDA 2EOMA 2EOYA 2EMIA 2BB8A 2YTJA 4R2RA 2DMIA 2YTEA 2HGHA 2EOZA 4WSGA 2J7JA 1Z1BA 2EPRA 5KL7A 2LT7A 2EL4A 2EJ4A 2LCEA 3UK3C 1A1FA 2ENCA 2EM0A 2CT1A 2YTOA 1A1HA 2YTDA 1X5WA 2EPXA 2EMZA 2EORA 1TF3A 2MKNA 1G2FC 2EP3A 2LO3A 4X9JA 2M9AA 1G2DC 2RSIA 1AAYA 2YU5A 3EPJA 2EE8A 2A25A 2EM7A 2EOSA 2RPCA 2EOFA 2YRKA 4F2JC 3EPLA 1ZAAC 1TF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R1F A;  1B69 A;  2YSO A;  1LLM C;  2DGC A;  2EN3 A;  2LV2 A;  3MHS C;  1TN9 A;  4R2Q A;  2EMW A;  2EMY A;  2YRH A;  1JK1 A;  1P47 A;  2MKD A;  4R2S A;  2EOI A;  1YSA C;  1RMD A;  2DLQ A;  2EMK A;  1YUI A;  2CSH A;  2ELY A;  2EMC A;  2EM4 A;  5KL2 A;  2YSP A;  2EM2 A;  1A1K A;  1ZU1 A;  3EPH A;  5KL5 A;  1X3C A;  1X6H A;  2EMB A;  1A1I A;  1DGC A;  2EMG A;  2EN1 A;  2EOE A;  2YTF A;  2EN6 A;  5KL3 A;  2EMA A;  3EPK A;  2EMF A;  1A1G A;  2YU8 A;  2EQ0 A;  2EM8 A;  2EOH A;  4FK5 C;  2ENA A;  1X6E A;  5KL6 A;  1F2I G;  2YTP A;  2EPC A;  2VRD A;  1A1L A;  2GLI A;  2EQ3 A;  2GHF A;  2EML A;  2DLK A;  1ZR9 A;  2YRM A;  1JK2 A;  1X6F A;  1UBD C;  2D9H A;  2WBU A;  2EM9 A;  2LVH A;  1MEY C;  2EPU A;  4F6M A;  2EPZ A;  2EMH A;  2ENH A;  2EPA A;  2EM5 A;  2YTG A;  3M99 B;  4R2P A;  4M9V C;  2EN4 A;  2E72 A;  2NAB A;  4R2D A;  2CTD A;  5KL4 A;  2EM3 A;  3VHT B;  2EL5 A;  1A1J A;  1UN6 B;  2MDG A;  2JP9 A;  2ADR A;  2EN7 A;  2EL6 A;  2EOJ A;  2EOX A;  2EQ1 A;  2I13 A;  2JPA A;  1NCS A;  1BBO A;  4F6N A;  3MHH C;  2YTI A;  2EPP A;  2WCC 3;  2EM6 A;  4R2A A;  1YUJ A;  2YTN A;  1WJP A;  2WBS A;  2ELZ A;  4GZN C;  4R2E A;  2EN2 A;  4IS1 C;  1KJK A;  2EMX A;  2PRT A;  2EOQ A;  2YTQ A;  2DRP A;  4R2C A;  2WBT A;  1BB8 A;  2EN8 A;  2EOO A;  4IJD A;  2EOM A;  2EOY A;  2EMI A;  2BB8 A;  2YTJ A;  4R2R A;  2DMI A;  2YTE A;  2HGH A;  2EOZ A;  4WSG A;  2J7J A;  1Z1B A;  2EPR A;  5KL7 A;  2LT7 A;  2EL4 A;  2EJ4 A;  2LCE A;  3UK3 C;  1A1F A;  2ENC A;  2EM0 A;  2CT1 A;  2YTO A;  1A1H A;  2YTD A;  1X5W A;  2EPX A;  2EMZ A;  2EOR A;  1TF3 A;  2MKN A;  1G2F C;  2EP3 A;  2LO3 A;  4X9J A;  2M9A A;  1G2D C;  2RSI A;  1AAY A;  2YU5 A;  3EPJ A;  2EE8 A;  2A25 A;  2EM7 A;  2EOS A;  2RPC A;  2EOF A;  2YRK A;  4F2J C;  3EPL A;  1ZAA C;  1TF6 A; 
#chains in the Genus database with same CATH topology
 2F4V E;  2YSO A;  1EKZ A;  1L4S A;  2EN3 A;  4WXD A;  1TN9 A;  4R2Q A;  1I94 E;  2IHR 1;  2DMY A;  4M0V A;  2LTS A;  4HTG A;  1JK1 A;  4B3M E;  3OTO E;  4DR4 E;  4RHB B;  3AV0 A;  1N34 E;  1YUI A;  2EMC A;  5KL2 A;  2DIX A;  2YSP A;  1A1K A;  1NEI A;  5ADZ A;  1GZ6 A;  3C4T A;  1X47 A;  1IQO A;  1X6H A;  2EMB A;  1A1I A;  5IV8 B;  2RS6 A;  4B3T E;  5TSE A;  2L33 A;  2EQ0 A;  1MGT A;  3T1Y E;  1F2I G;  2L92 A;  4N4R B;  1BBG A;  3J7Y p;  1A1L A;  3F6G A;  4F54 A;  1JK2 A;  4JI2 E;  2D9H A;  2M4I A;  2HHH E;  4X8W A;  2EM9 A;  5AC4 A;  4M2Z A;  2EPZ A;  4O43 A;  4JI0 E;  1X49 A;  4BHC A;  3K6Q A;  2EPA A;  3QG5 C;  4P78 A;  2L3J A;  2LUQ A;  5IT9 C;  4M9V C;  2EN4 A;  3J80 C;  3L00 A;  2NUG A;  3IWB A;  2UXB E;  1HNZ E;  2EWL A;  3VHT B;  4Q28 A;  3THO B;  1PJT A;  2BBG A;  2JXP A;  3KZY A;  1YZ9 A;  2EOX A;  2EQ1 A;  4DV7 E;  2ZM6 E;  4KHP E;  3VK6 A;  5A6J A;  4JI4 E;  2WCC 3;  4R2A A;  2EPN A;  1N3G A;  3HPS A;  4R8O A;  4BS9 A;  4DR2 E;  4R2E A;  4IS1 C;  2EPL X;  4NXM E;  2F8B A;  2EOM A;  2KON A;  2YTJ A;  4R2R A;  2EOZ A;  2H36 X;  2J7J A;  4AQY E;  1IMU A;  5LMN E;  2EM0 A;  2E5L E;  1A1H A;  2YTD A;  1X5W A;  2EMZ A;  3JAM C;  2EOR A;  1TF3 A;  4WXC A;  2MKN A;  1XNR E;  2M9A A;  1PJQ A;  5IXM B;  4NZV A;  2DSY A;  4O4K A;  2YRK A;  5A2Q C;  3C6K A;  2V83 A;  1B69 A;  1KYQ A;  2YRH A;  2JVA A;  2M1S A;  1ZBT A;  1FKA E;  2N3G A;  2UXD E;  2EMK A;  5F3W A;  1YPN A;  2JWO A;  3EQ1 A;  2CSH A;  2RS7 A;  1ZBQ A;  2EM2 A;  4NXN E;  1T4L B;  3T1H E;  4LF5 E;  4X64 E;  2K4V A;  1DGC A;  3BGH A;  2EMA A;  2EOH A;  4FK5 C;  4NHR A;  1X6E A;  5KL6 A;  1EH7 A;  2DLK A;  1UBD C;  4WFT A;  4LF8 E;  4ZYH A;  2EMH A;  4B3R E;  3ADL A;  2R76 A;  2EM5 A;  2YTG A;  4R2P A;  2NAB A;  4R2D A;  1YFH A;  1IBM E;  2NUE A;  1A1J A;  2GPI A;  2UXC E;  1XMQ E;  2JP9 A;  5FLX C;  2EL6 A;  4BBY A;  5DNY A;  3MSW A;  2B7T A;  3BID A;  2YTI A;  5T6J A;  1YUJ A;  2L2N A;  2YTN A;  1WJP A;  3KZZ A;  4GZN C;  1PKP A;  2EMX A;  2PRT A;  2V89 A;  3JU0 A;  1EH8 A;  1BB8 A;  2EOO A;  1SR9 A;  3FIG A;  4IJD A;  2JY9 A;  2EOY A;  2UUC E;  4WPY A;  2YTE A;  4WSG A;  1XMO E;  4LF9 E;  2LJH A;  4ZYD A;  2EL4 A;  2JYA A;  3UK3 C;  2RSM A;  1WXR A;  2JOX A;  2LE2 A;  1YYK A;  2YTO A;  4OX9 E;  2EPX A;  4DR1 E;  1YYW A;  1HNW E;  1QNT A;  1G2F C;  2LO3 A;  4X9J A;  4LFB E;  4JV5 E;  5IWA E;  2VQE E;  2UUB E;  2YU5 A;  3J81 C;  2EM7 A;  2EOS A;  1T4N A;  4F2J C;  4L8N A;  3HPZ A;  2R1F A;  5LL6 R;  3TQM A;  4I8O A;  2V86 A;  2L8T A;  2LMZ A;  3MHS C;  4DUY E;  3C4B A;  3VYY A;  3JTZ A;  1IBL E;  1HR0 E;  1STU A;  1UIL A;  3ADJ A;  1P47 A;  2N3H A;  2YZT A;  4F9A B;  4R2S A;  1X48 A;  2KHX A;  1YSA C;  2DLQ A;  2ELY A;  2V88 A;  4B3S E;  4YHH E;  3EPH A;  4LF7 E;  1WRJ A;  5A6B A;  2EN1 A;  3EPK A;  5KL3 A;  4DUZ E;  2YU8 A;  4DMI A;  1GQE A;  2ENA A;  1EH6 A;  2FV4 B;  4GEQ B;  2JR1 A;  2YTP A;  4YY3 E;  2NA2 A;  2VRD A;  4R03 A;  3DJW A;  4BHB A;  1J5E E;  3F6H A;  2GLI A;  4KWY A;  2GHF A;  1FJG E;  2EML A;  2HC5 A;  2YRM A;  1ZR9 A;  3P1X A;  2LUP B;  1N36 E;  2L2M A;  1MEY C;  2EPU A;  4DR3 E;  3VYX A;  1GTK A;  2YT4 A;  1RC7 A;  5AE2 A;  2ODR D;  3LLH A;  4WYQ B;  2CTD A;  2LBS B;  2EM3 A;  4GKK E;  2EL5 A;  2FTX B;  4Q35 B;  2EZ6 A;  2EN7 A;  3LML A;  2L3C A;  4ZYE A;  2VE7 C;  1NCS A;  1BBO A;  5A69 A;  4F6N A;  3MHH C;  2E1M A;  1T4O A;  2EPP A;  3H09 A;  2EM6 A;  4LU9 A;  2EPO A;  4DR6 E;  1WHQ A;  1IBK E;  2L6M A;  2B3T B;  1N32 E;  2ELZ A;  2UU9 E;  1XNQ E;  1UHZ A;  2YTQ A;  4O24 A;  5AE1 A;  2EN8 A;  1DI2 A;  2BB8 A;  5AE3 A;  5CFF E;  3HQ1 A;  2JOB A;  4BMJ A;  2LJU A;  2EPR A;  2LT7 A;  2LCE A;  1A1F A;  1YYO A;  4TUG A;  2ENC A;  4LFA E;  2CT1 A;  1J26 A;  4MLV A;  4X62 E;  4M30 A;  3DF6 A;  4TUI A;  1DQ3 A;  2EP3 A;  4DKK A;  4BC9 A;  1G2D C;  2RSI A;  1AAY A;  3EPJ A;  2A25 A;  2RPC A;  3C6M A;  3HXL A;  3EPL A;  4LFC E;  1ZAA C;  1TF6 A;  4LF6 E;  4DV5 E;  4DV3 E;  1T38 A;  2N8X A;  1LLM C;  2DGC A;  4JYA E;  2LV2 A;  4KZS A;  2VF1 A;  2EMW A;  1SFE A;  2EMY A;  1N33 E;  3J7A G;  2B7V A;  1RQ0 A;  2MKD A;  4MLQ A;  4WX9 A;  4K0K E;  2EOI A;  1RMD A;  3THN A;  4BCA A;  2M7Q A;  4DV1 E;  4J8Z A;  2EM4 A;  1ZU1 A;  2RTX A;  5KL5 A;  1X3C A;  2DB2 A;  2MC5 A;  5LMU E;  2MC6 A;  1IQS A;  2EMG A;  2EOE A;  2YTF A;  3OML A;  2EN6 A;  4DV2 E;  2EMF A;  1A1G A;  2EM8 A;  3IWC A;  4RH8 A;  2L2K B;  2EPC A;  4WSP A;  2G7H A;  3BBG A;  2EQ3 A;  1X6F A;  4O5G A;  2EPK X;  1HNX E;  4OOG C;  2WBU A;  2LVH A;  3HTX A;  1AH5 A;  2B9D A;  2V8Q B;  4F6M A;  2ENH A;  2EPM X;  4BC7 A;  2LRS A;  4GKJ E;  2YWQ A;  2NUF A;  4DV0 E;  3M99 B;  2Q8U A;  2E72 A;  2KOU A;  4X66 E;  2HJJ A;  4JI7 E;  5KL4 A;  1O0W A;  1UN6 B;  2MDG A;  2ADR A;  2RQL A;  4HEI A;  4DR5 E;  2EOJ A;  2I13 A;  5AC5 A;  2JPA A;  3ADG A;  1T39 A;  2YPN A;  3AUZ A;  5A6B D;  4L5N C;  5A6K A;  4DR7 E;  1PJS A;  2WBS A;  5AAS A;  4DV4 E;  2EN2 A;  3IWD A;  1KJK A;  2EOQ A;  2DRP A;  4R2C A;  2CPN A;  2WBT A;  2FGG A;  2ODR C;  1WHN A;  2EMI A;  4F9C B;  4DV6 E;  2DMI A;  2LTR A;  2HGH A;  4JI1 E;  1Z1B A;  3BF2 A;  5KL7 A;  4JI3 E;  4P7D A;  2EJ4 A;  2VQF E;  3ECR A;  2V87 A;  4LF4 E;  2I9I A;  2K7I A;  1PDA A;  2V85 A;  4JI8 E;  5LLQ A;  4JI6 E;  4X65 E;  3RMP A;  2MDR A;  3KWR A;  2WZO A;  4LTY A;  1QU6 A;  3ADI A;  4ZYG A;  4JI5 E;  2EE8 A;  2EOF A;  2UUA E;  4F9B B;  3ZOQ B;  5A6A A;  5BR8 E; 
#chains in the Genus database with same CATH homology
 2R1F A;  1B69 A;  2YSO A;  1LLM C;  2DGC A;  2EN3 A;  2LV2 A;  3MHS C;  1TN9 A;  4R2Q A;  2EMW A;  2EMY A;  2YRH A;  1JK1 A;  1P47 A;  2MKD A;  4R2S A;  2EOI A;  1YSA C;  1RMD A;  2DLQ A;  2EMK A;  1YUI A;  2CSH A;  2ELY A;  2EMC A;  2EM4 A;  5KL2 A;  2YSP A;  2EM2 A;  1A1K A;  1ZU1 A;  3EPH A;  5KL5 A;  1X3C A;  1X6H A;  2EMB A;  1A1I A;  1DGC A;  2EMG A;  2EN1 A;  2EOE A;  2YTF A;  2EN6 A;  5KL3 A;  2EMA A;  3EPK A;  2EMF A;  1A1G A;  2YU8 A;  2EQ0 A;  2EM8 A;  2EOH A;  4FK5 C;  2ENA A;  1X6E A;  5KL6 A;  1F2I G;  2YTP A;  2EPC A;  2VRD A;  1A1L A;  2GLI A;  2EQ3 A;  2GHF A;  2EML A;  2DLK A;  1ZR9 A;  2YRM A;  1JK2 A;  1X6F A;  1UBD C;  2D9H A;  2WBU A;  2EM9 A;  2LVH A;  1MEY C;  2EPU A;  4F6M A;  2EPZ A;  2EMH A;  2ENH A;  2EPA A;  2EM5 A;  2YTG A;  3M99 B;  4R2P A;  4M9V C;  2EN4 A;  2E72 A;  2NAB A;  4R2D A;  2CTD A;  5KL4 A;  2EM3 A;  3VHT B;  2EL5 A;  1A1J A;  1UN6 B;  2MDG A;  2JP9 A;  2ADR A;  2EN7 A;  2EL6 A;  2EOJ A;  2EOX A;  2EQ1 A;  2I13 A;  2JPA A;  1NCS A;  1BBO A;  4F6N A;  3MHH C;  2YTI A;  2EPP A;  2WCC 3;  2EM6 A;  4R2A A;  1YUJ A;  2YTN A;  1WJP A;  2WBS A;  2ELZ A;  4GZN C;  4R2E A;  2EN2 A;  4IS1 C;  1KJK A;  2EMX A;  2PRT A;  2EOQ A;  2YTQ A;  2DRP A;  4R2C A;  2WBT A;  1BB8 A;  2EN8 A;  2EOO A;  4IJD A;  2EOM A;  2EOY A;  2EMI A;  2BB8 A;  2YTJ A;  4R2R A;  2DMI A;  2YTE A;  2HGH A;  2EOZ A;  4WSG A;  2J7J A;  1Z1B A;  2EPR A;  5KL7 A;  2LT7 A;  2EL4 A;  2EJ4 A;  2LCE A;  3UK3 C;  1A1F A;  2ENC A;  2EM0 A;  2CT1 A;  2YTO A;  1A1H A;  2YTD A;  1X5W A;  2EPX A;  2EMZ A;  2EOR A;  1TF3 A;  2MKN A;  1G2F C;  2EP3 A;  2LO3 A;  4X9J A;  2M9A A;  1G2D C;  2RSI A;  1AAY A;  2YU5 A;  3EPJ A;  2EE8 A;  2A25 A;  2EM7 A;  2EOS A;  2RPC A;  2EOF A;  2YRK A;  4F2J C;  3EPL A;  1ZAA C;  1TF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...