1P47A

Crystal structure of tandem zif268 molecules complexed to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*GP*TP*GP*GP*CP*GP*TP*GP*GP*GP*CP*GP*GP*CP*GP*TP*GP*GP*
publication title Constraints for Zinc Finger Linker Design as Inferred from X-ray Crystal Structure of Tandem Zif268-DNA Complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 26
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A03
1TN9A 2CSHA 1Z1BA 4F6NA 2EN2A 2EN8A 2CT1A 2LCEA 4R2PA 1X6EA 1A1LA 2EMHA 4R2EA 1G2DC 1YUJA 2EL6A 1A1JA 2WBSA 2EP3A 2ENHA 1X5WA 3EPKA 1UN6B 2E72A 2VRDA 4R2CA 2EL4A 2EPCA 2YTJA 2EQ3A 2DRPA 2EJ4A 1BBOA 1A1GA 1A1HA 2EOEA 4F2JC 1A1KA 5KL2A 2YTGA 2ELYA 1UBDC 2EOMA 2YTOA 1A1FA 2GLIA 1ZU1A 2JPAA 5KL5A 3EPLA 2YRMA 2I13A 2YU5A 3MHHC 2DLQA 2DGCA 2EN7A 2YRKA 1AAYA 2EM7A 4R2DA 2EOOA 2EPXA 1P47A 2WCC3 2GHFA 1KJKA 1LLMC 2YTNA 2EOXA 2EOFA 3M99B 2EPAA 2EPRA 2WBUA 2EN1A 2YTEA 4R2SA 2EM2A 4M9VC 2EL5A 2EN4A 1TF6A 2EM3A 2EMLA 2YSOA 2ENAA 2R1FA 1F2IG 4IS1C 2A25A 2YU8A 2NABA 4R2AA 2M9AA 2EMYA 1WJPA 2EMKA 1X6HA 4R2QA 2EPZA 1JK2A 2BB8A 2CTDA 5KL4A 3EPJA 4X9JA 2EMBA 1YSAC 1RMDA 2EE8A 2LVHA 2DMIA 2EM5A 2EOIA 2EOZA 2HGHA 1ZR9A 1X6FA 4GZNC 2JP9A 2MDGA 1A1IA 2YTPA 2EMZA 2YTQA 2YTIA 2EM4A 2J7JA 2LO3A 2EM6A 2EMXA 1NCSA 5KL6A 2EM0A 4R2RA 2EN3A 2EQ1A 2EOHA 3VHTB 1TF3A 2EOJA 1ZAAC 2EMCA 1DGCA 1MEYC 2EMAA 1YUIA 2LT7A 2YSPA 2EPPA 2DLKA 1G2FC 2WBTA 2YTFA 2EORA 2EOQA 2EMFA 4FK5C 2EMIA 1BB8A 2ENCA 2EM9A 2D9HA 2RSIA 2ELZA 3MHSC 2MKNA 2EPUA 4WSGA 5KL3A 4F6MA 2ADRA 2PRTA 1B69A 3EPHA 2YRHA 2YTDA 2EM8A 2EMWA 2EQ0A 2EOYA 1X3CA 2EN6A 2EOSA 1JK1A 4IJDA 2EMGA 2MKDA 5KL7A 3UK3C 2RPCA 2LV2A
chains in the Genus database with same CATH superfamily
2CSHA 3KZZA 4JV5E 4DV0E 4TUGA 2E5LE 2YPNA 2LBSB 2EMHA 2L33A 4JI2E 4JI1E 1G2DC 4LF5E 4NXNE 4LFAE 3KWRA 1EH8A 3BBGA 1A1JA 3THOB 1EH7A 3K6QA 4R2CA 2B7TA 2EL4A 1YZ9A 1HNZE 2EQ3A 2B7VA 2DRPA 1J26A 1A1KA 1AH5A 1YYKA 3J7Yp 2YTGA 1UBDC 1BBGA 1A1FA 2JPAA 5DNYA 3EPLA 3MHHC 4DV7E 2DGCA 2YRKA 2BBGA 1P47A 4LF9E 2RSMA 2HJJA 2EPAA 2EPRA 2JVAA 2JXPA 5AE1A 2EN1A 2YTEA 4R2SA 2EN4A 2VQEE 2FTXB 2DMYA 2EMLA 2RS7A 2YSOA 3EQ1A 4B3ME 4DR2E 2K7IA 4JI6E 1F2IG 1XMQE 4LF6E 5LMUE 2LRSA 2G7HA 1WJPA 2EMKA 2L2KB 4R2QA 2EPZA 1IBLE 2CTDA 2UUBE 5KL4A 4O43A 5A6JA 2EOIA 2EM5A 2HC5A 4WX9A 1WHNA 4DR3E 1T38A 4GKJE 1A1IA 1HNWE 2JOXA 4BC9A 2EMZA 3AUZA 2YTQA 2YTIA 5T6JA 4ZYGA 3QG5C 3ADLA 2EOHA 4BHBA 4JYAE 2GPIA 2L2NA 3HXLA 2KHXA 1O0WA 2EMAA 1YUIA 4K0KE 2EPPA 2DLKA 2WBTA 2EMFA 1NEIA 2EWLA 2NA2A 4O24A 2ODRC 1WRJA 1IQOA 5KL3A 5FLXC 2FGGA 4X8WA 3DJWA 4LFBE 4M30A 3J80C 1JK1A 2UXDE 3ADJA 2LUPB 1YPNA 2I13A 2UXCE 4JI0E 1WHQA 1Z1BA 5IXMB 4F6NA 2EN8A 2FV4B 4DUYE 1T4LB 1N34E 4JI5E 2CT1A 1YYWA 4WPYA 1ZBQA 5A2QC 4R2PA 1X6EA 1A1LA 2M1SA 5A6BD 1YUJA 2EL6A 4HEIA 2LJUA 5IT9C 4I8OA 1UN6B 5IWAE 2VRDA 3IWCA 3C4TA 4JI8E 4F2JC 4J8ZA 3HQ1A 1KYQA 4BBYA 2EOMA 4WXDA 1ZU1A 4DUZE 1IBKE 3TQMA 5AASA 4P78A 2H36X 2YU5A 2DLQA 5AC5A 3HPSA 2V83A 2EM7A 2EOOA 2EPMX 2NUGA 2GHFA 2KONA 2EOFA 4R8OA 2N3HA 2EPNA 4M9VC 4F9BB 2EL5A 3JAMC 4Q35B 2ENAA 4ZYDA 2UUCE 4BCAA 2VE7C 4IS1C 2YU8A 3H09A 2L3JA 2EMYA 2RQLA 4JI3E 2BB8A 2EE8A 2N3GA 2DMIA 2EOZA 4DV5E 1ZR9A 1STUA 1X49A 2JP9A 4KWYA 2N8XA 2YTPA 4L5NC 2EM4A 2J7JA 4Q28A 3BF2A 4R2RA 4NZVA 4LF4E 2UU9E 3ECRA 2I9IA 4KHPE 5A6KA 1DGCA 4JI7E 1MEYC 2JOBA 2DB2A 2YTFA 4X62E 2EOQA 3LMLA 3THNA 4MLQA 2EMIA 5BR8E 2V86A 4WYQB 5LL6R 2RTXA 5AE2A 2ELZA 3EPHA 1B69A 2ADRA 2YRHA 4BHCA 1RC7A 2EM8A 2EMWA 2EQ0A 4BC7A 1ZBTA 4OX9E 2EN6A 4DV3E 3MSWA 3ADGA 2LT7A 1TN9A 1FJGE 4DV2E 5LLQA 2EN2A 2YWQA 4X64E 4R03A 2LCEA 3OTOE 2LUQA 4R2EA 3F6HA 4AQYE 2YT4A 2LJHA 1T4NA 3OMLA 1X5WA 5LMNE 2E72A 2EPCA 2YTJA 3L00A 2EJ4A 2YZTA 1BBOA 1A1HA 2EOEA 3BGHA 1XMOE 5AE3A 2WZOA 5KL2A 1GZ6A 2GLIA 2EZ6A 2F4VE 3JU0A 3T1HE 5KL5A 4DV6E 4WFTA 2JWOA 1SFEA 1PDAA 2EPXA 4LU9A 2WCC3 4O4KA 1I94E 1SR9A 5CFFE 1XNQE 2EOXA 3C6MA 3M99B 2VF1A 4F54A 1UILA 1TF6A 2EM3A 1N33E 2R1FA 1PKPA 3C4BA 2NABA 4R2AA 2M9AA 1GTKA 2B3TB 1X6HA 2V88A 4WXCA 2MC5A 3EPJA 2L8TA 5AC4A 2KOUA 1YSAC 1DI2A 1RMDA 2LVHA 2RS6A 4DR7E 2V89A 5A6BA 1X6FA 1QNTA 4DKKA 1N32E 2CPNA 3RMPA 3HTXA 2JYAA 2Q8UA 5TSEA 2B9DA 4M0VA 2LTRA 4JI4E 2EM6A 5F3WA 2EMXA 1NCSA 5KL6A 4NXME 2EN3A 2EQ1A 1UHZA 3VHTB 4LFCE 1X47A 2EOJA 1ZAAC 4YHHE 3VYYA 4WSPA 3ADIA 4DR6E 2YSPA 2DSYA 2EORA 4HTGA 4DMIA 2R76A 1WXRA 2V85A 4FK5C 1BB8A 1N3GA 1X48A 2ENCA 2L92A 2V8QB 3KZYA 4F9AB 5ADZA 1HNXE 2D9HA 4BS9A 2RSIA 3LLHA 1IBME 3MHSC 4GEQB 1FKAE 2K4VA 2MKNA 4WSGA 4ZYHA 2M7QA 4X66E 2PRTA 2L3CA 4DV4E 2EOSA 4DV1E 2HHHE 3AV0A 5KL7A 3UK3C 1YYOA 2LV2A 3BIDA 2LTSA 2MC6A 4DR4E 3FIGA 4X65E 3F6GA 2IHR1 2WBSA 2EP3A 4P7DA 4BMJA 2ENHA 3EPKA 2LMZA 1EKZA 4RHBB 5IV8B 1A1GA 4DR5E 3JTZA 3P1XA 4B3RE 2ELYA 2M4IA 4F9CB 2YTOA 1IMUA 5A69A 4NHRA 1EH6A 3VK6A 2YRMA 1T4OA 2UXBE 3J81C 2NUEA 2EN7A 1AAYA 4L8NA 4R2DA 4LF7E 1PJSA 1KJKA 1LLMC 2YTNA 3C6KA 4TUIA 2F8BA 2WBUA 3T1YE 2EM2A 3IWBA 1L4SA 4LTYA 4O5GA 1XNRE 2L2MA 2A25A 2ODRD 1IQSA 1RQ0A 3HPZA 1N36E 1JK2A 2LE2A 1GQEA 4KZSA 4OOGC 4B3SE 4X9JA 4LF8E 2EMBA 1YFHA 2NUFA 3VYXA 5A6AA 2HGHA 4GZNC 2MDGA 1PJTA 2E1MA 4MLVA 1MGTA 3ZOQB 1T39A 2LO3A 2MDRA 4DR1E 2V87A 3DF6A 4RH8A 2EM0A 4B3TE 1TF3A 2EMCA 2DIXA 2VQFE 3J7AG 2JY9A 2EPOA 1J5EE 1QU6A 2EPLX 1G2FC 2ZM6E 2EM9A 1DQ3A 2UUAE 1PJQA 2EPUA 4M2ZA 4F6MA 4GKKE 2YTDA 2JR1A 2EPKX 2EOYA 1X3CA 4ZYEA 3IWDA 1HR0E 4N4RB 2L6MA 4YY3E 4IJDA 2EMGA 2MKDA 2RPCA
chains in the Genus database with same CATH topology
1TN9A 2CSHA 1Z1BA 4F6NA 2EN2A 2EN8A 2CT1A 2LCEA 4R2PA 1X6EA 1A1LA 2EMHA 4R2EA 1G2DC 1YUJA 2EL6A 1A1JA 2WBSA 2EP3A 2ENHA 1X5WA 3EPKA 1UN6B 2E72A 2VRDA 4R2CA 2EL4A 2EPCA 2YTJA 2EQ3A 2DRPA 2EJ4A 1BBOA 1A1GA 1A1HA 2EOEA 4F2JC 1A1KA 5KL2A 2YTGA 2ELYA 1UBDC 2EOMA 2YTOA 1A1FA 2GLIA 1ZU1A 2JPAA 5KL5A 3EPLA 2YRMA 2I13A 2YU5A 3MHHC 2DLQA 2DGCA 2EN7A 2YRKA 1AAYA 2EM7A 4R2DA 2EOOA 2EPXA 1P47A 2WCC3 2GHFA 1KJKA 1LLMC 2YTNA 2EOXA 2EOFA 3M99B 2EPAA 2EPRA 2WBUA 2EN1A 2YTEA 4R2SA 2EM2A 4M9VC 2EL5A 2EN4A 1TF6A 2EM3A 2EMLA 2YSOA 2ENAA 2R1FA 1F2IG 4IS1C 2A25A 2YU8A 2NABA 4R2AA 2M9AA 2EMYA 1WJPA 2EMKA 1X6HA 4R2QA 2EPZA 1JK2A 2BB8A 2CTDA 5KL4A 3EPJA 4X9JA 2EMBA 1YSAC 1RMDA 2EE8A 2LVHA 2DMIA 2EM5A 2EOIA 2EOZA 2HGHA 1ZR9A 1X6FA 4GZNC 2JP9A 2MDGA 1A1IA 2YTPA 2EMZA 2YTQA 2YTIA 2EM4A 2J7JA 2LO3A 2EM6A 2EMXA 1NCSA 5KL6A 2EM0A 4R2RA 2EN3A 2EQ1A 2EOHA 3VHTB 1TF3A 2EOJA 1ZAAC 2EMCA 1DGCA 1MEYC 2EMAA 1YUIA 2LT7A 2YSPA 2EPPA 2DLKA 1G2FC 2WBTA 2YTFA 2EORA 2EOQA 2EMFA 4FK5C 2EMIA 1BB8A 2ENCA 2EM9A 2D9HA 2RSIA 2ELZA 3MHSC 2MKNA 2EPUA 4WSGA 5KL3A 4F6MA 2ADRA 2PRTA 1B69A 3EPHA 2YRHA 2YTDA 2EM8A 2EMWA 2EQ0A 2EOYA 1X3CA 2EN6A 2EOSA 1JK1A 4IJDA 2EMGA 2MKDA 5KL7A 3UK3C 2RPCA 2LV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN9 A;  2CSH A;  1Z1B A;  4F6N A;  2EN2 A;  2EN8 A;  2CT1 A;  2LCE A;  4R2P A;  1X6E A;  1A1L A;  2EMH A;  4R2E A;  1G2D C;  1YUJ A;  2EL6 A;  1A1J A;  2WBS A;  2EP3 A;  2ENH A;  1X5W A;  3EPK A;  1UN6 B;  2E72 A;  2VRD A;  4R2C A;  2EL4 A;  2EPC A;  2YTJ A;  2EQ3 A;  2DRP A;  2EJ4 A;  1BBO A;  1A1G A;  1A1H A;  2EOE A;  4F2J C;  1A1K A;  5KL2 A;  2YTG A;  2ELY A;  1UBD C;  2EOM A;  2YTO A;  1A1F A;  2GLI A;  1ZU1 A;  2JPA A;  5KL5 A;  3EPL A;  2YRM A;  2I13 A;  2YU5 A;  3MHH C;  2DLQ A;  2DGC A;  2EN7 A;  2YRK A;  1AAY A;  2EM7 A;  4R2D A;  2EOO A;  2EPX A;  1P47 A;  2WCC 3;  2GHF A;  1KJK A;  1LLM C;  2YTN A;  2EOX A;  2EOF A;  3M99 B;  2EPA A;  2EPR A;  2WBU A;  2EN1 A;  2YTE A;  4R2S A;  2EM2 A;  4M9V C;  2EL5 A;  2EN4 A;  1TF6 A;  2EM3 A;  2EML A;  2YSO A;  2ENA A;  2R1F A;  1F2I G;  4IS1 C;  2A25 A;  2YU8 A;  2NAB A;  4R2A A;  2M9A A;  2EMY A;  1WJP A;  2EMK A;  1X6H A;  4R2Q A;  2EPZ A;  1JK2 A;  2BB8 A;  2CTD A;  5KL4 A;  3EPJ A;  4X9J A;  2EMB A;  1YSA C;  1RMD A;  2EE8 A;  2LVH A;  2DMI A;  2EM5 A;  2EOI A;  2EOZ A;  2HGH A;  1ZR9 A;  1X6F A;  4GZN C;  2JP9 A;  2MDG A;  1A1I A;  2YTP A;  2EMZ A;  2YTQ A;  2YTI A;  2EM4 A;  2J7J A;  2LO3 A;  2EM6 A;  2EMX A;  1NCS A;  5KL6 A;  2EM0 A;  4R2R A;  2EN3 A;  2EQ1 A;  2EOH A;  3VHT B;  1TF3 A;  2EOJ A;  1ZAA C;  2EMC A;  1DGC A;  1MEY C;  2EMA A;  1YUI A;  2LT7 A;  2YSP A;  2EPP A;  2DLK A;  1G2F C;  2WBT A;  2YTF A;  2EOR A;  2EOQ A;  2EMF A;  4FK5 C;  2EMI A;  1BB8 A;  2ENC A;  2EM9 A;  2D9H A;  2RSI A;  2ELZ A;  3MHS C;  2MKN A;  2EPU A;  4WSG A;  5KL3 A;  4F6M A;  2ADR A;  2PRT A;  1B69 A;  3EPH A;  2YRH A;  2YTD A;  2EM8 A;  2EMW A;  2EQ0 A;  2EOY A;  1X3C A;  2EN6 A;  2EOS A;  1JK1 A;  4IJD A;  2EMG A;  2MKD A;  5KL7 A;  3UK3 C;  2RPC A;  2LV2 A; 
#chains in the Genus database with same CATH topology
 2CSH A;  3KZZ A;  4JV5 E;  4DV0 E;  4TUG A;  2E5L E;  2YPN A;  2LBS B;  2EMH A;  2L33 A;  4JI2 E;  4JI1 E;  1G2D C;  4LF5 E;  4NXN E;  4LFA E;  3KWR A;  1EH8 A;  3BBG A;  1A1J A;  3THO B;  1EH7 A;  3K6Q A;  4R2C A;  2B7T A;  2EL4 A;  1YZ9 A;  1HNZ E;  2EQ3 A;  2B7V A;  2DRP A;  1J26 A;  1A1K A;  1AH5 A;  1YYK A;  3J7Y p;  2YTG A;  1UBD C;  1BBG A;  1A1F A;  2JPA A;  5DNY A;  3EPL A;  3MHH C;  4DV7 E;  2DGC A;  2YRK A;  2BBG A;  1P47 A;  4LF9 E;  2RSM A;  2HJJ A;  2EPA A;  2EPR A;  2JVA A;  2JXP A;  5AE1 A;  2EN1 A;  2YTE A;  4R2S A;  2EN4 A;  2VQE E;  2FTX B;  2DMY A;  2EML A;  2RS7 A;  2YSO A;  3EQ1 A;  4B3M E;  4DR2 E;  2K7I A;  4JI6 E;  1F2I G;  1XMQ E;  4LF6 E;  5LMU E;  2LRS A;  2G7H A;  1WJP A;  2EMK A;  2L2K B;  4R2Q A;  2EPZ A;  1IBL E;  2CTD A;  2UUB E;  5KL4 A;  4O43 A;  5A6J A;  2EOI A;  2EM5 A;  2HC5 A;  4WX9 A;  1WHN A;  4DR3 E;  1T38 A;  4GKJ E;  1A1I A;  1HNW E;  2JOX A;  4BC9 A;  2EMZ A;  3AUZ A;  2YTQ A;  2YTI A;  5T6J A;  4ZYG A;  3QG5 C;  3ADL A;  2EOH A;  4BHB A;  4JYA E;  2GPI A;  2L2N A;  3HXL A;  2KHX A;  1O0W A;  2EMA A;  1YUI A;  4K0K E;  2EPP A;  2DLK A;  2WBT A;  2EMF A;  1NEI A;  2EWL A;  2NA2 A;  4O24 A;  2ODR C;  1WRJ A;  1IQO A;  5KL3 A;  5FLX C;  2FGG A;  4X8W A;  3DJW A;  4LFB E;  4M30 A;  3J80 C;  1JK1 A;  2UXD E;  3ADJ A;  2LUP B;  1YPN A;  2I13 A;  2UXC E;  4JI0 E;  1WHQ A;  1Z1B A;  5IXM B;  4F6N A;  2EN8 A;  2FV4 B;  4DUY E;  1T4L B;  1N34 E;  4JI5 E;  2CT1 A;  1YYW A;  4WPY A;  1ZBQ A;  5A2Q C;  4R2P A;  1X6E A;  1A1L A;  2M1S A;  5A6B D;  1YUJ A;  2EL6 A;  4HEI A;  2LJU A;  5IT9 C;  4I8O A;  1UN6 B;  5IWA E;  2VRD A;  3IWC A;  3C4T A;  4JI8 E;  4F2J C;  4J8Z A;  3HQ1 A;  1KYQ A;  4BBY A;  2EOM A;  4WXD A;  1ZU1 A;  4DUZ E;  1IBK E;  3TQM A;  5AAS A;  4P78 A;  2H36 X;  2YU5 A;  2DLQ A;  5AC5 A;  3HPS A;  2V83 A;  2EM7 A;  2EOO A;  2EPM X;  2NUG A;  2GHF A;  2KON A;  2EOF A;  4R8O A;  2N3H A;  2EPN A;  4M9V C;  4F9B B;  2EL5 A;  3JAM C;  4Q35 B;  2ENA A;  4ZYD A;  2UUC E;  4BCA A;  2VE7 C;  4IS1 C;  2YU8 A;  3H09 A;  2L3J A;  2EMY A;  2RQL A;  4JI3 E;  2BB8 A;  2EE8 A;  2N3G A;  2DMI A;  2EOZ A;  4DV5 E;  1ZR9 A;  1STU A;  1X49 A;  2JP9 A;  4KWY A;  2N8X A;  2YTP A;  4L5N C;  2EM4 A;  2J7J A;  4Q28 A;  3BF2 A;  4R2R A;  4NZV A;  4LF4 E;  2UU9 E;  3ECR A;  2I9I A;  4KHP E;  5A6K A;  1DGC A;  4JI7 E;  1MEY C;  2JOB A;  2DB2 A;  2YTF A;  4X62 E;  2EOQ A;  3LML A;  3THN A;  4MLQ A;  2EMI A;  5BR8 E;  2V86 A;  4WYQ B;  5LL6 R;  2RTX A;  5AE2 A;  2ELZ A;  3EPH A;  1B69 A;  2ADR A;  2YRH A;  4BHC A;  1RC7 A;  2EM8 A;  2EMW A;  2EQ0 A;  4BC7 A;  1ZBT A;  4OX9 E;  2EN6 A;  4DV3 E;  3MSW A;  3ADG A;  2LT7 A;  1TN9 A;  1FJG E;  4DV2 E;  5LLQ A;  2EN2 A;  2YWQ A;  4X64 E;  4R03 A;  2LCE A;  3OTO E;  2LUQ A;  4R2E A;  3F6H A;  4AQY E;  2YT4 A;  2LJH A;  1T4N A;  3OML A;  1X5W A;  5LMN E;  2E72 A;  2EPC A;  2YTJ A;  3L00 A;  2EJ4 A;  2YZT A;  1BBO A;  1A1H A;  2EOE A;  3BGH A;  1XMO E;  5AE3 A;  2WZO A;  5KL2 A;  1GZ6 A;  2GLI A;  2EZ6 A;  2F4V E;  3JU0 A;  3T1H E;  5KL5 A;  4DV6 E;  4WFT A;  2JWO A;  1SFE A;  1PDA A;  2EPX A;  4LU9 A;  2WCC 3;  4O4K A;  1I94 E;  1SR9 A;  5CFF E;  1XNQ E;  2EOX A;  3C6M A;  3M99 B;  2VF1 A;  4F54 A;  1UIL A;  1TF6 A;  2EM3 A;  1N33 E;  2R1F A;  1PKP A;  3C4B A;  2NAB A;  4R2A A;  2M9A A;  1GTK A;  2B3T B;  1X6H A;  2V88 A;  4WXC A;  2MC5 A;  3EPJ A;  2L8T A;  5AC4 A;  2KOU A;  1YSA C;  1DI2 A;  1RMD A;  2LVH A;  2RS6 A;  4DR7 E;  2V89 A;  5A6B A;  1X6F A;  1QNT A;  4DKK A;  1N32 E;  2CPN A;  3RMP A;  3HTX A;  2JYA A;  2Q8U A;  5TSE A;  2B9D A;  4M0V A;  2LTR A;  4JI4 E;  2EM6 A;  5F3W A;  2EMX A;  1NCS A;  5KL6 A;  4NXM E;  2EN3 A;  2EQ1 A;  1UHZ A;  3VHT B;  4LFC E;  1X47 A;  2EOJ A;  1ZAA C;  4YHH E;  3VYY A;  4WSP A;  3ADI A;  4DR6 E;  2YSP A;  2DSY A;  2EOR A;  4HTG A;  4DMI A;  2R76 A;  1WXR A;  2V85 A;  4FK5 C;  1BB8 A;  1N3G A;  1X48 A;  2ENC A;  2L92 A;  2V8Q B;  3KZY A;  4F9A B;  5ADZ A;  1HNX E;  2D9H A;  4BS9 A;  2RSI A;  3LLH A;  1IBM E;  3MHS C;  4GEQ B;  1FKA E;  2K4V A;  2MKN A;  4WSG A;  4ZYH A;  2M7Q A;  4X66 E;  2PRT A;  2L3C A;  4DV4 E;  2EOS A;  4DV1 E;  2HHH E;  3AV0 A;  5KL7 A;  3UK3 C;  1YYO A;  2LV2 A;  3BID A;  2LTS A;  2MC6 A;  4DR4 E;  3FIG A;  4X65 E;  3F6G A;  2IHR 1;  2WBS A;  2EP3 A;  4P7D A;  4BMJ A;  2ENH A;  3EPK A;  2LMZ A;  1EKZ A;  4RHB B;  5IV8 B;  1A1G A;  4DR5 E;  3JTZ A;  3P1X A;  4B3R E;  2ELY A;  2M4I A;  4F9C B;  2YTO A;  1IMU A;  5A69 A;  4NHR A;  1EH6 A;  3VK6 A;  2YRM A;  1T4O A;  2UXB E;  3J81 C;  2NUE A;  2EN7 A;  1AAY A;  4L8N A;  4R2D A;  4LF7 E;  1PJS A;  1KJK A;  1LLM C;  2YTN A;  3C6K A;  4TUI A;  2F8B A;  2WBU A;  3T1Y E;  2EM2 A;  3IWB A;  1L4S A;  4LTY A;  4O5G A;  1XNR E;  2L2M A;  2A25 A;  2ODR D;  1IQS A;  1RQ0 A;  3HPZ A;  1N36 E;  1JK2 A;  2LE2 A;  1GQE A;  4KZS A;  4OOG C;  4B3S E;  4X9J A;  4LF8 E;  2EMB A;  1YFH A;  2NUF A;  3VYX A;  5A6A A;  2HGH A;  4GZN C;  2MDG A;  1PJT A;  2E1M A;  4MLV A;  1MGT A;  3ZOQ B;  1T39 A;  2LO3 A;  2MDR A;  4DR1 E;  2V87 A;  3DF6 A;  4RH8 A;  2EM0 A;  4B3T E;  1TF3 A;  2EMC A;  2DIX A;  2VQF E;  3J7A G;  2JY9 A;  2EPO A;  1J5E E;  1QU6 A;  2EPL X;  1G2F C;  2ZM6 E;  2EM9 A;  1DQ3 A;  2UUA E;  1PJQ A;  2EPU A;  4M2Z A;  4F6M A;  4GKK E;  2YTD A;  2JR1 A;  2EPK X;  2EOY A;  1X3C A;  4ZYE A;  3IWD A;  1HR0 E;  4N4R B;  2L6M A;  4YY3 E;  4IJD A;  2EMG A;  2MKD A;  2RPC A; 
#chains in the Genus database with same CATH homology
 1TN9 A;  2CSH A;  1Z1B A;  4F6N A;  2EN2 A;  2EN8 A;  2CT1 A;  2LCE A;  4R2P A;  1X6E A;  1A1L A;  2EMH A;  4R2E A;  1G2D C;  1YUJ A;  2EL6 A;  1A1J A;  2WBS A;  2EP3 A;  2ENH A;  1X5W A;  3EPK A;  1UN6 B;  2E72 A;  2VRD A;  4R2C A;  2EL4 A;  2EPC A;  2YTJ A;  2EQ3 A;  2DRP A;  2EJ4 A;  1BBO A;  1A1G A;  1A1H A;  2EOE A;  4F2J C;  1A1K A;  5KL2 A;  2YTG A;  2ELY A;  1UBD C;  2EOM A;  2YTO A;  1A1F A;  2GLI A;  1ZU1 A;  2JPA A;  5KL5 A;  3EPL A;  2YRM A;  2I13 A;  2YU5 A;  3MHH C;  2DLQ A;  2DGC A;  2EN7 A;  2YRK A;  1AAY A;  2EM7 A;  4R2D A;  2EOO A;  2EPX A;  1P47 A;  2WCC 3;  2GHF A;  1KJK A;  1LLM C;  2YTN A;  2EOX A;  2EOF A;  3M99 B;  2EPA A;  2EPR A;  2WBU A;  2EN1 A;  2YTE A;  4R2S A;  2EM2 A;  4M9V C;  2EL5 A;  2EN4 A;  1TF6 A;  2EM3 A;  2EML A;  2YSO A;  2ENA A;  2R1F A;  1F2I G;  4IS1 C;  2A25 A;  2YU8 A;  2NAB A;  4R2A A;  2M9A A;  2EMY A;  1WJP A;  2EMK A;  1X6H A;  4R2Q A;  2EPZ A;  1JK2 A;  2BB8 A;  2CTD A;  5KL4 A;  3EPJ A;  4X9J A;  2EMB A;  1YSA C;  1RMD A;  2EE8 A;  2LVH A;  2DMI A;  2EM5 A;  2EOI A;  2EOZ A;  2HGH A;  1ZR9 A;  1X6F A;  4GZN C;  2JP9 A;  2MDG A;  1A1I A;  2YTP A;  2EMZ A;  2YTQ A;  2YTI A;  2EM4 A;  2J7J A;  2LO3 A;  2EM6 A;  2EMX A;  1NCS A;  5KL6 A;  2EM0 A;  4R2R A;  2EN3 A;  2EQ1 A;  2EOH A;  3VHT B;  1TF3 A;  2EOJ A;  1ZAA C;  2EMC A;  1DGC A;  1MEY C;  2EMA A;  1YUI A;  2LT7 A;  2YSP A;  2EPP A;  2DLK A;  1G2F C;  2WBT A;  2YTF A;  2EOR A;  2EOQ A;  2EMF A;  4FK5 C;  2EMI A;  1BB8 A;  2ENC A;  2EM9 A;  2D9H A;  2RSI A;  2ELZ A;  3MHS C;  2MKN A;  2EPU A;  4WSG A;  5KL3 A;  4F6M A;  2ADR A;  2PRT A;  1B69 A;  3EPH A;  2YRH A;  2YTD A;  2EM8 A;  2EMW A;  2EQ0 A;  2EOY A;  1X3C A;  2EN6 A;  2EOS A;  1JK1 A;  4IJD A;  2EMG A;  2MKD A;  5KL7 A;  3UK3 C;  2RPC A;  2LV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...