1P47A

Crystal structure of tandem zif268 molecules complexed to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
b'ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*GP*TP*GP*GP*CP*GP*TP*GP*GP*GP*CP*GP*GP*CP*GP*TP*GP*GP*
publication title Constraints for Zinc Finger Linker Design as Inferred from X-ray Crystal Structure of Tandem Zif268-DNA Complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 26
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A03
2NABA 2EMGA 5KL5A 4F6NA 2EQ3A 2EN1A 2I13A 2D9HA 4WSGA 1BB8A 2EOYA 2EOQA 2EOMA 2EPZA 2RPCA 2EP3A 2VRDA 2EMIA 2CSHA 2EE8A 2EL5A 2WBSA 2JP9A 1X3CA 2ELYA 2EPXA 2LV2A 4R2AA 2YRKA 2EN2A 1A1IA 2EMXA 2ENHA 1KJKA 2EMYA 4F6MA 4M9VC 2EMLA 2EORA 4X9JA 2EPUA 3UK3C 2EOJA 2M9AA 1Z1BA 1G2FC 1X6FA 2JPAA 1NCSA 2EMBA 2EM3A 2EN6A 2EOSA 1A1LA 2EN3A 2WBUA 1UBDC 2EOOA 2EPAA 1ZU1A 2E72A 2WBTA 2YTFA 2EN4A 2R1FA 1TN9A 2YSOA 2DGCA 2YU8A 2ENCA 1A1JA 2YU5A 2YTJA 2LT7A 2YTPA 1B69A 2EL4A 2YTOA 4R2QA 1G2DC 1YUJA 2RSIA 1AAYA 1A1FA 2EMCA 4R2EA 4GZNC 1X6HA 2EMKA 3EPHA 2A25A 4R2PA 4R2CA 2MKDA 3EPKA 2EMZA 2BB8A 2LCEA 2LVHA 2EM6A 2YTQA 1TF6A 2EJ4A 1WJPA 2EPRA 1JK1A 2EM7A 3VHTB 2GHFA 2DLQA 1P47A 2EMWA 2EN7A 3M99B 5KL4A 2GLIA 2DMIA 5KL3A 2EOXA 2PRTA 2EM8A 2EPCA 2YRMA 2YSPA 2EM9A 2DLKA 2ELZA 1TF3A 2EL6A 1X6EA 2EPPA 5KL2A 3EPLA 3EPJA 4IS1C 2EM5A 2EMHA 1YSAC 3MHSC 1LLMC 2EM4A 1F2IG 4R2RA 2EOIA 2EOHA 1X5WA 2YTNA 2CT1A 4FK5C 2CTDA 4R2SA 5KL7A 1DGCA 1MEYC 2HGHA 4F2JC 2MKNA 2YTIA 1ZAAC 2ENAA 1UN6B 2J7JA 1JK2A 1ZR9A 2YTEA 2EQ0A 1A1GA 1A1KA 2EOEA 3MHHC 2YTGA 4R2DA 2WCC3 2YRHA 2MDGA 2EMAA 2ADRA 2EM2A 2EN8A 2DRPA 1YUIA 1BBOA 2LO3A 1RMDA 2EOZA 2YTDA 1A1HA 2EOFA 2EMFA 2EQ1A 4IJDA 2EM0A 5KL6A
chains in the Genus database with same CATH superfamily
3J80C 2EMGA 2EQ3A 4WSGA 5F3WA 2EOQA 2EPZA 5AC4A 2RPCA 2EP3A 3IWBA 5LL6R 2VRDA 4LTYA 4O43A 1STUA 2CSHA 1GZ6A 2LRSA 2LV2A 2EN2A 4BBYA 1N34E 3KZZA 3TQMA 1KJKA 4F6MA 3C6MA 4R03A 1X6FA 1IBKE 1SFEA 2EN6A 1A1LA 2EN3A 2EOOA 4BHBA 3K6QA 4ZYHA 2E72A 2LJHA 1J5EE 4JYAE 2B7VA 2WZOA 2WBTA 2YZTA 2FGGA 5IT9C 4M2ZA 2EN4A 2K7IA 3JTZA 2YTJA 2YTPA 2NUEA 1B69A 2EL4A 2NA2A 2UUBE 2RS6A 1YPNA 2RTXA 2V88A 2EMKA 5DNYA 4LF5E 4KHPE 5A6AA 3AV0A 2MKDA 2EMZA 2BB8A 1HNXE 2LCEA 5IWAE 2EJ4A 3BIDA 1DI2A 1JK1A 2N3GA 4M0VA 3BGHA 4GKJE 4WXCA 2BBGA 2RSMA 4WXDA 1UHZA 2EOXA 2ZM6E 2EM8A 2YRMA 2YSPA 1PJQA 1X6EA 1FKAE 4DR4E 4DR2E 3J81C 2UUAE 2EM5A 2HHHE 4DV7E 2UXDE 2EM4A 3RMPA 1F2IG 2EOIA 2VE7C 2CT1A 1WRJA 4FK5C 4JI6E 4X65E 2CPNA 4NHRA 2EWLA 3ECRA 1T39A 2VQFE 2RS7A 4K0KE 2NUGA 1N33E 4LFAE 2MDRA 1I94E 4LF7E 2YTEA 2EQ0A 1A1GA 4JI5E 5IV8B 3MHHC 2JWOA 5A6JA 2YRHA 4LU9A 5AE1A 4P78A 3THOB 2F4VE 2EM2A 2FV4B 3J7AG 3THNA 3T1YE 1YUIA 1YYOA 2EMFA 2EPKX 1GQEA 3P1XA 5KL6A 2YPNA 1EKZA 5KL5A 4F6NA 2EN1A 1IMUA 2EOYA 4P7DA 2M7QA 1T4LB 2JXPA 4BHCA 1WXRA 3LLHA 4DV3E 2EE8A 2VQEE 1HNZE 2EL5A 3JU0A 2WBSA 2JP9A 4JI4E 1X3CA 1MGTA 2EPXA 1GTKA 2LJUA 2UXBE 4O4KA 4DMIA 4YHHE 4YY3E 1XMOE 4X9JA 2EPUA 3UK3C 2M9AA 2EOSA 4DUZE 2L2NA 3JAMC 4DV1E 2UU9E 1ZBQA 2EPAA 2V85A 3MSWA 1ZU1A 4L5NC 4DV4E 2LUPB 1HR0E 2YSOA 2YU8A 2LT7A 2DIXA 2VF1A 2LTSA 1YUJA 4JI8E 1FJGE 2EPLX 4R2EA 3L00A 4GEQB 4OX9E 4WFTA 4R2CA 4ZYDA 4DR3E 3FIGA 1RC7A 4BS9A 1WJPA 1T4NA 2EPNA 2GHFA 3BF2A 3VHTB 2EMWA 2EN7A 4LFCE 2JR1A 4L8NA 4O5GA 1J26A 4OOGC 3C4TA 2DLKA 4Q28A 1T38A 2NUFA 2EPPA 4JI2E 1IQOA 1YZ9A 1EH6A 3DF6A 1LLMC 2L8TA 4RH8A 4R2RA 4JV5E 3EQ1A 2LUQA 2KOUA 1EH8A 1DGCA 1MEYC 2LTRA 2HGHA 1X48A 3HQ1A 2B3TB 2UXCE 1IQSA 1UN6B 1ZR9A 2L92A 4R2DA 5A2QC 2WCC3 3F6GA 2HC5A 4JI3E 2YTDA 4HTGA 4IJDA 1T4OA 5BR8E 4DV5E 1PJSA 2YWQA 5AC5A 3H09A 4J8ZA 4NXNE 1DQ3A 4O24A 5LMUE 3OMLA 4BC7A 3T1HE 1PDAA 2V8QB 2ELYA 4R2AA 4F9AB 1IBME 4X62E 2EMXA 3LMLA 2ENHA 2H36X 2EZ6A 2ODRD 4M9VC 4JI0E 4NXME 2EOJA 1YFHA 2F8BA 1WHNA 2JPAA 1NCSA 1WHQA 4LF6E 2WBUA 1UBDC 2E5LE 4DV0E 5A69A 4X8WA 1KYQA 1XNRE 4BCAA 3C4BA 2B9DA 1TN9A 2DGCA 5AASA 1YYKA 2YU5A 5AE2A 1HNWE 4R2QA 1G2DC 2RSIA 1QU6A 1AAYA 3DJWA 2E1MA 2JOXA 3ZOQB 1N3GA 3EPHA 2A25A 5A6KA 4R2PA 2YT4A 3EPKA 3VYYA 4LF9E 4LF4E 4F9CB 4X66E 2JVAA 4BC9A 2DB2A 2EM7A 1P47A 3M99B 5KL4A 2DMIA 4B3RE 4Q35B 4DR6E 5KL3A 5TSEA 2PRTA 2EPCA 4KZSA 5IXMB 2ELZA 1TF3A 1PJTA 4MLQA 4WSPA 5KL2A 3EPJA 2GPIA 4IS1C 3MHSC 3ADLA 2LMZA 4X64E 1X5WA 4GKKE 3AUZA 2KHXA 3ADIA 2CTDA 4R2SA 3ADJA 2N8XA 4F2JC 4RHBB 2LBSB 2ENAA 2J7JA 4LFBE 1A1KA 4WPYA 2YTGA 2MC6A 2MDGA 1O0WA 2EMAA 2EN8A 2DRPA 2JY9A 4TUIA 1BBOA 3IWDA 2HJJA 3OTOE 4DUYE 2M1SA 2EM0A 2L2MA 3HPSA 2L3JA 2NABA 1L4SA 2L33A 4AQYE 4ZYGA 4TUGA 4F9BB 2I13A 2D9HA 1BB8A 5FLXC 4JI7E 2EOMA 2LE2A 4NZVA 1NEIA 3F6HA 3QG5C 1N32E 2EMIA 2K4VA 2MC5A 2B7TA 1XMQE 2JYAA 2UUCE 1N36E 1BBGA 1XNQE 2YRKA 4B3TE 1A1IA 2DMYA 4B3SE 2EMYA 2JOBA 4DR7E 2EMLA 5LMNE 2N3HA 2EORA 1Z1BA 1G2FC 2L3CA 4F54A 3KZYA 2EMBA 2EM3A 4N4RB 3ADGA 5T6JA 2DSYA 5CFFE 1IBLE 2YTFA 1X47A 4HEIA 2R1FA 2ENCA 2G7HA 1A1JA 2V89A 4LF8E 2L6MA 2YTOA 2FTXB 1QNTA 1A1FA 2EMCA 4GZNC 1X6HA 2V87A 3HXLA 5A6BA 4KWYA 2ODRC 1YYWA 2LVHA 2EM6A 2YTQA 1TF6A 2V86A 4DV2E 2EPRA 2DLQA 4WX9A 2GLIA 5A6BD 3VYXA 4M30A 1SR9A 3J7Yp 5AE3A 4JI1E 2EM9A 3KWRA 3IWCA 1X49A 2EL6A 1UILA 4DKKA 5LLQA 2KONA 3EPLA 2L2KB 2EMHA 1YSAC 2R76A 2V83A 5ADZA 4R8OA 2EOHA 4DV6E 2YTNA 2IHR1 1RQ0A 3C6KA 5KL7A 2MKNA 2M4IA 2YTIA 3VK6A 1ZAAC 1EH7A 2Q8UA 2EPOA 1JK2A 3HPZA 2I9IA 2EOEA 1AH5A 3BBGA 4DR1E 2RQLA 2ADRA 4WYQB 1PKPA 2LO3A 1RMDA 2EOZA 1A1HA 1ZBTA 2EOFA 4MLVA 2EQ1A 4BMJA 4ZYEA 4DR5E 3HTXA 4B3ME 4I8OA 2EPMX
chains in the Genus database with same CATH topology
2NABA 2EMGA 5KL5A 4F6NA 2EQ3A 2EN1A 2I13A 2D9HA 4WSGA 1BB8A 2EOYA 2EOQA 2EOMA 2EPZA 2RPCA 2EP3A 2VRDA 2EMIA 2CSHA 2EE8A 2EL5A 2WBSA 2JP9A 1X3CA 2ELYA 2EPXA 2LV2A 4R2AA 2YRKA 2EN2A 1A1IA 2EMXA 2ENHA 1KJKA 2EMYA 4F6MA 4M9VC 2EMLA 2EORA 4X9JA 2EPUA 3UK3C 2EOJA 2M9AA 1Z1BA 1G2FC 1X6FA 2JPAA 1NCSA 2EMBA 2EM3A 2EN6A 2EOSA 1A1LA 2EN3A 2WBUA 1UBDC 2EOOA 2EPAA 1ZU1A 2E72A 2WBTA 2YTFA 2EN4A 2R1FA 1TN9A 2YSOA 2DGCA 2YU8A 2ENCA 1A1JA 2YU5A 2YTJA 2LT7A 2YTPA 1B69A 2EL4A 2YTOA 4R2QA 1G2DC 1YUJA 2RSIA 1AAYA 1A1FA 2EMCA 4R2EA 4GZNC 1X6HA 2EMKA 3EPHA 2A25A 4R2PA 4R2CA 2MKDA 3EPKA 2EMZA 2BB8A 2LCEA 2LVHA 2EM6A 2YTQA 1TF6A 2EJ4A 1WJPA 2EPRA 1JK1A 2EM7A 3VHTB 2GHFA 2DLQA 1P47A 2EMWA 2EN7A 3M99B 5KL4A 2GLIA 2DMIA 5KL3A 2EOXA 2PRTA 2EM8A 2EPCA 2YRMA 2YSPA 2EM9A 2DLKA 2ELZA 1TF3A 2EL6A 1X6EA 2EPPA 5KL2A 3EPLA 3EPJA 4IS1C 2EM5A 2EMHA 1YSAC 3MHSC 1LLMC 2EM4A 1F2IG 4R2RA 2EOIA 2EOHA 1X5WA 2YTNA 2CT1A 4FK5C 2CTDA 4R2SA 5KL7A 1DGCA 1MEYC 2HGHA 4F2JC 2MKNA 2YTIA 1ZAAC 2ENAA 1UN6B 2J7JA 1JK2A 1ZR9A 2YTEA 2EQ0A 1A1GA 1A1KA 2EOEA 3MHHC 2YTGA 4R2DA 2WCC3 2YRHA 2MDGA 2EMAA 2ADRA 2EM2A 2EN8A 2DRPA 1YUIA 1BBOA 2LO3A 1RMDA 2EOZA 2YTDA 1A1HA 2EOFA 2EMFA 2EQ1A 4IJDA 2EM0A 5KL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NAB A;  2EMG A;  5KL5 A;  4F6N A;  2EQ3 A;  2EN1 A;  2I13 A;  2D9H A;  4WSG A;  1BB8 A;  2EOY A;  2EOQ A;  2EOM A;  2EPZ A;  2RPC A;  2EP3 A;  2VRD A;  2EMI A;  2CSH A;  2EE8 A;  2EL5 A;  2WBS A;  2JP9 A;  1X3C A;  2ELY A;  2EPX A;  2LV2 A;  4R2A A;  2YRK A;  2EN2 A;  1A1I A;  2EMX A;  2ENH A;  1KJK A;  2EMY A;  4F6M A;  4M9V C;  2EML A;  2EOR A;  4X9J A;  2EPU A;  3UK3 C;  2EOJ A;  2M9A A;  1Z1B A;  1G2F C;  1X6F A;  2JPA A;  1NCS A;  2EMB A;  2EM3 A;  2EN6 A;  2EOS A;  1A1L A;  2EN3 A;  2WBU A;  1UBD C;  2EOO A;  2EPA A;  1ZU1 A;  2E72 A;  2WBT A;  2YTF A;  2EN4 A;  2R1F A;  1TN9 A;  2YSO A;  2DGC A;  2YU8 A;  2ENC A;  1A1J A;  2YU5 A;  2YTJ A;  2LT7 A;  2YTP A;  1B69 A;  2EL4 A;  2YTO A;  4R2Q A;  1G2D C;  1YUJ A;  2RSI A;  1AAY A;  1A1F A;  2EMC A;  4R2E A;  4GZN C;  1X6H A;  2EMK A;  3EPH A;  2A25 A;  4R2P A;  4R2C A;  2MKD A;  3EPK A;  2EMZ A;  2BB8 A;  2LCE A;  2LVH A;  2EM6 A;  2YTQ A;  1TF6 A;  2EJ4 A;  1WJP A;  2EPR A;  1JK1 A;  2EM7 A;  3VHT B;  2GHF A;  2DLQ A;  1P47 A;  2EMW A;  2EN7 A;  3M99 B;  5KL4 A;  2GLI A;  2DMI A;  5KL3 A;  2EOX A;  2PRT A;  2EM8 A;  2EPC A;  2YRM A;  2YSP A;  2EM9 A;  2DLK A;  2ELZ A;  1TF3 A;  2EL6 A;  1X6E A;  2EPP A;  5KL2 A;  3EPL A;  3EPJ A;  4IS1 C;  2EM5 A;  2EMH A;  1YSA C;  3MHS C;  1LLM C;  2EM4 A;  1F2I G;  4R2R A;  2EOI A;  2EOH A;  1X5W A;  2YTN A;  2CT1 A;  4FK5 C;  2CTD A;  4R2S A;  5KL7 A;  1DGC A;  1MEY C;  2HGH A;  4F2J C;  2MKN A;  2YTI A;  1ZAA C;  2ENA A;  1UN6 B;  2J7J A;  1JK2 A;  1ZR9 A;  2YTE A;  2EQ0 A;  1A1G A;  1A1K A;  2EOE A;  3MHH C;  2YTG A;  4R2D A;  2WCC 3;  2YRH A;  2MDG A;  2EMA A;  2ADR A;  2EM2 A;  2EN8 A;  2DRP A;  1YUI A;  1BBO A;  2LO3 A;  1RMD A;  2EOZ A;  2YTD A;  1A1H A;  2EOF A;  2EMF A;  2EQ1 A;  4IJD A;  2EM0 A;  5KL6 A; 
#chains in the Genus database with same CATH topology
 3J80 C;  2EMG A;  2EQ3 A;  4WSG A;  5F3W A;  2EOQ A;  2EPZ A;  5AC4 A;  2RPC A;  2EP3 A;  3IWB A;  5LL6 R;  2VRD A;  4LTY A;  4O43 A;  1STU A;  2CSH A;  1GZ6 A;  2LRS A;  2LV2 A;  2EN2 A;  4BBY A;  1N34 E;  3KZZ A;  3TQM A;  1KJK A;  4F6M A;  3C6M A;  4R03 A;  1X6F A;  1IBK E;  1SFE A;  2EN6 A;  1A1L A;  2EN3 A;  2EOO A;  4BHB A;  3K6Q A;  4ZYH A;  2E72 A;  2LJH A;  1J5E E;  4JYA E;  2B7V A;  2WZO A;  2WBT A;  2YZT A;  2FGG A;  5IT9 C;  4M2Z A;  2EN4 A;  2K7I A;  3JTZ A;  2YTJ A;  2YTP A;  2NUE A;  1B69 A;  2EL4 A;  2NA2 A;  2UUB E;  2RS6 A;  1YPN A;  2RTX A;  2V88 A;  2EMK A;  5DNY A;  4LF5 E;  4KHP E;  5A6A A;  3AV0 A;  2MKD A;  2EMZ A;  2BB8 A;  1HNX E;  2LCE A;  5IWA E;  2EJ4 A;  3BID A;  1DI2 A;  1JK1 A;  2N3G A;  4M0V A;  3BGH A;  4GKJ E;  4WXC A;  2BBG A;  2RSM A;  4WXD A;  1UHZ A;  2EOX A;  2ZM6 E;  2EM8 A;  2YRM A;  2YSP A;  1PJQ A;  1X6E A;  1FKA E;  4DR4 E;  4DR2 E;  3J81 C;  2UUA E;  2EM5 A;  2HHH E;  4DV7 E;  2UXD E;  2EM4 A;  3RMP A;  1F2I G;  2EOI A;  2VE7 C;  2CT1 A;  1WRJ A;  4FK5 C;  4JI6 E;  4X65 E;  2CPN A;  4NHR A;  2EWL A;  3ECR A;  1T39 A;  2VQF E;  2RS7 A;  4K0K E;  2NUG A;  1N33 E;  4LFA E;  2MDR A;  1I94 E;  4LF7 E;  2YTE A;  2EQ0 A;  1A1G A;  4JI5 E;  5IV8 B;  3MHH C;  2JWO A;  5A6J A;  2YRH A;  4LU9 A;  5AE1 A;  4P78 A;  3THO B;  2F4V E;  2EM2 A;  2FV4 B;  3J7A G;  3THN A;  3T1Y E;  1YUI A;  1YYO A;  2EMF A;  2EPK X;  1GQE A;  3P1X A;  5KL6 A;  2YPN A;  1EKZ A;  5KL5 A;  4F6N A;  2EN1 A;  1IMU A;  2EOY A;  4P7D A;  2M7Q A;  1T4L B;  2JXP A;  4BHC A;  1WXR A;  3LLH A;  4DV3 E;  2EE8 A;  2VQE E;  1HNZ E;  2EL5 A;  3JU0 A;  2WBS A;  2JP9 A;  4JI4 E;  1X3C A;  1MGT A;  2EPX A;  1GTK A;  2LJU A;  2UXB E;  4O4K A;  4DMI A;  4YHH E;  4YY3 E;  1XMO E;  4X9J A;  2EPU A;  3UK3 C;  2M9A A;  2EOS A;  4DUZ E;  2L2N A;  3JAM C;  4DV1 E;  2UU9 E;  1ZBQ A;  2EPA A;  2V85 A;  3MSW A;  1ZU1 A;  4L5N C;  4DV4 E;  2LUP B;  1HR0 E;  2YSO A;  2YU8 A;  2LT7 A;  2DIX A;  2VF1 A;  2LTS A;  1YUJ A;  4JI8 E;  1FJG E;  2EPL X;  4R2E A;  3L00 A;  4GEQ B;  4OX9 E;  4WFT A;  4R2C A;  4ZYD A;  4DR3 E;  3FIG A;  1RC7 A;  4BS9 A;  1WJP A;  1T4N A;  2EPN A;  2GHF A;  3BF2 A;  3VHT B;  2EMW A;  2EN7 A;  4LFC E;  2JR1 A;  4L8N A;  4O5G A;  1J26 A;  4OOG C;  3C4T A;  2DLK A;  4Q28 A;  1T38 A;  2NUF A;  2EPP A;  4JI2 E;  1IQO A;  1YZ9 A;  1EH6 A;  3DF6 A;  1LLM C;  2L8T A;  4RH8 A;  4R2R A;  4JV5 E;  3EQ1 A;  2LUQ A;  2KOU A;  1EH8 A;  1DGC A;  1MEY C;  2LTR A;  2HGH A;  1X48 A;  3HQ1 A;  2B3T B;  2UXC E;  1IQS A;  1UN6 B;  1ZR9 A;  2L92 A;  4R2D A;  5A2Q C;  2WCC 3;  3F6G A;  2HC5 A;  4JI3 E;  2YTD A;  4HTG A;  4IJD A;  1T4O A;  5BR8 E;  4DV5 E;  1PJS A;  2YWQ A;  5AC5 A;  3H09 A;  4J8Z A;  4NXN E;  1DQ3 A;  4O24 A;  5LMU E;  3OML A;  4BC7 A;  3T1H E;  1PDA A;  2V8Q B;  2ELY A;  4R2A A;  4F9A B;  1IBM E;  4X62 E;  2EMX A;  3LML A;  2ENH A;  2H36 X;  2EZ6 A;  2ODR D;  4M9V C;  4JI0 E;  4NXM E;  2EOJ A;  1YFH A;  2F8B A;  1WHN A;  2JPA A;  1NCS A;  1WHQ A;  4LF6 E;  2WBU A;  1UBD C;  2E5L E;  4DV0 E;  5A69 A;  4X8W A;  1KYQ A;  1XNR E;  4BCA A;  3C4B A;  2B9D A;  1TN9 A;  2DGC A;  5AAS A;  1YYK A;  2YU5 A;  5AE2 A;  1HNW E;  4R2Q A;  1G2D C;  2RSI A;  1QU6 A;  1AAY A;  3DJW A;  2E1M A;  2JOX A;  3ZOQ B;  1N3G A;  3EPH A;  2A25 A;  5A6K A;  4R2P A;  2YT4 A;  3EPK A;  3VYY A;  4LF9 E;  4LF4 E;  4F9C B;  4X66 E;  2JVA A;  4BC9 A;  2DB2 A;  2EM7 A;  1P47 A;  3M99 B;  5KL4 A;  2DMI A;  4B3R E;  4Q35 B;  4DR6 E;  5KL3 A;  5TSE A;  2PRT A;  2EPC A;  4KZS A;  5IXM B;  2ELZ A;  1TF3 A;  1PJT A;  4MLQ A;  4WSP A;  5KL2 A;  3EPJ A;  2GPI A;  4IS1 C;  3MHS C;  3ADL A;  2LMZ A;  4X64 E;  1X5W A;  4GKK E;  3AUZ A;  2KHX A;  3ADI A;  2CTD A;  4R2S A;  3ADJ A;  2N8X A;  4F2J C;  4RHB B;  2LBS B;  2ENA A;  2J7J A;  4LFB E;  1A1K A;  4WPY A;  2YTG A;  2MC6 A;  2MDG A;  1O0W A;  2EMA A;  2EN8 A;  2DRP A;  2JY9 A;  4TUI A;  1BBO A;  3IWD A;  2HJJ A;  3OTO E;  4DUY E;  2M1S A;  2EM0 A;  2L2M A;  3HPS A;  2L3J A;  2NAB A;  1L4S A;  2L33 A;  4AQY E;  4ZYG A;  4TUG A;  4F9B B;  2I13 A;  2D9H A;  1BB8 A;  5FLX C;  4JI7 E;  2EOM A;  2LE2 A;  4NZV A;  1NEI A;  3F6H A;  3QG5 C;  1N32 E;  2EMI A;  2K4V A;  2MC5 A;  2B7T A;  1XMQ E;  2JYA A;  2UUC E;  1N36 E;  1BBG A;  1XNQ E;  2YRK A;  4B3T E;  1A1I A;  2DMY A;  4B3S E;  2EMY A;  2JOB A;  4DR7 E;  2EML A;  5LMN E;  2N3H A;  2EOR A;  1Z1B A;  1G2F C;  2L3C A;  4F54 A;  3KZY A;  2EMB A;  2EM3 A;  4N4R B;  3ADG A;  5T6J A;  2DSY A;  5CFF E;  1IBL E;  2YTF A;  1X47 A;  4HEI A;  2R1F A;  2ENC A;  2G7H A;  1A1J A;  2V89 A;  4LF8 E;  2L6M A;  2YTO A;  2FTX B;  1QNT A;  1A1F A;  2EMC A;  4GZN C;  1X6H A;  2V87 A;  3HXL A;  5A6B A;  4KWY A;  2ODR C;  1YYW A;  2LVH A;  2EM6 A;  2YTQ A;  1TF6 A;  2V86 A;  4DV2 E;  2EPR A;  2DLQ A;  4WX9 A;  2GLI A;  5A6B D;  3VYX A;  4M30 A;  1SR9 A;  3J7Y p;  5AE3 A;  4JI1 E;  2EM9 A;  3KWR A;  3IWC A;  1X49 A;  2EL6 A;  1UIL A;  4DKK A;  5LLQ A;  2KON A;  3EPL A;  2L2K B;  2EMH A;  1YSA C;  2R76 A;  2V83 A;  5ADZ A;  4R8O A;  2EOH A;  4DV6 E;  2YTN A;  2IHR 1;  1RQ0 A;  3C6K A;  5KL7 A;  2MKN A;  2M4I A;  2YTI A;  3VK6 A;  1ZAA C;  1EH7 A;  2Q8U A;  2EPO A;  1JK2 A;  3HPZ A;  2I9I A;  2EOE A;  1AH5 A;  3BBG A;  4DR1 E;  2RQL A;  2ADR A;  4WYQ B;  1PKP A;  2LO3 A;  1RMD A;  2EOZ A;  1A1H A;  1ZBT A;  2EOF A;  4MLV A;  2EQ1 A;  4BMJ A;  4ZYE A;  4DR5 E;  3HTX A;  4B3M E;  4I8O A;  2EPM X; 
#chains in the Genus database with same CATH homology
 2NAB A;  2EMG A;  5KL5 A;  4F6N A;  2EQ3 A;  2EN1 A;  2I13 A;  2D9H A;  4WSG A;  1BB8 A;  2EOY A;  2EOQ A;  2EOM A;  2EPZ A;  2RPC A;  2EP3 A;  2VRD A;  2EMI A;  2CSH A;  2EE8 A;  2EL5 A;  2WBS A;  2JP9 A;  1X3C A;  2ELY A;  2EPX A;  2LV2 A;  4R2A A;  2YRK A;  2EN2 A;  1A1I A;  2EMX A;  2ENH A;  1KJK A;  2EMY A;  4F6M A;  4M9V C;  2EML A;  2EOR A;  4X9J A;  2EPU A;  3UK3 C;  2EOJ A;  2M9A A;  1Z1B A;  1G2F C;  1X6F A;  2JPA A;  1NCS A;  2EMB A;  2EM3 A;  2EN6 A;  2EOS A;  1A1L A;  2EN3 A;  2WBU A;  1UBD C;  2EOO A;  2EPA A;  1ZU1 A;  2E72 A;  2WBT A;  2YTF A;  2EN4 A;  2R1F A;  1TN9 A;  2YSO A;  2DGC A;  2YU8 A;  2ENC A;  1A1J A;  2YU5 A;  2YTJ A;  2LT7 A;  2YTP A;  1B69 A;  2EL4 A;  2YTO A;  4R2Q A;  1G2D C;  1YUJ A;  2RSI A;  1AAY A;  1A1F A;  2EMC A;  4R2E A;  4GZN C;  1X6H A;  2EMK A;  3EPH A;  2A25 A;  4R2P A;  4R2C A;  2MKD A;  3EPK A;  2EMZ A;  2BB8 A;  2LCE A;  2LVH A;  2EM6 A;  2YTQ A;  1TF6 A;  2EJ4 A;  1WJP A;  2EPR A;  1JK1 A;  2EM7 A;  3VHT B;  2GHF A;  2DLQ A;  1P47 A;  2EMW A;  2EN7 A;  3M99 B;  5KL4 A;  2GLI A;  2DMI A;  5KL3 A;  2EOX A;  2PRT A;  2EM8 A;  2EPC A;  2YRM A;  2YSP A;  2EM9 A;  2DLK A;  2ELZ A;  1TF3 A;  2EL6 A;  1X6E A;  2EPP A;  5KL2 A;  3EPL A;  3EPJ A;  4IS1 C;  2EM5 A;  2EMH A;  1YSA C;  3MHS C;  1LLM C;  2EM4 A;  1F2I G;  4R2R A;  2EOI A;  2EOH A;  1X5W A;  2YTN A;  2CT1 A;  4FK5 C;  2CTD A;  4R2S A;  5KL7 A;  1DGC A;  1MEY C;  2HGH A;  4F2J C;  2MKN A;  2YTI A;  1ZAA C;  2ENA A;  1UN6 B;  2J7J A;  1JK2 A;  1ZR9 A;  2YTE A;  2EQ0 A;  1A1G A;  1A1K A;  2EOE A;  3MHH C;  2YTG A;  4R2D A;  2WCC 3;  2YRH A;  2MDG A;  2EMA A;  2ADR A;  2EM2 A;  2EN8 A;  2DRP A;  1YUI A;  1BBO A;  2LO3 A;  1RMD A;  2EOZ A;  2YTD A;  1A1H A;  2EOF A;  2EMF A;  2EQ1 A;  4IJD A;  2EM0 A;  5KL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...