1P47A

Crystal structure of tandem zif268 molecules complexed to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Constraints for Zinc Finger Linker Design as Inferred from X-ray Crystal Structure of Tandem Zif268-DNA Complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*TP*GP*GP*CP*GP*TP*GP*GP*GP*CP*GP*GP*CP*GP*TP*GP*GP*
total genus 26
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1p47A03
2EORA 2E72A 2EM6A 4R2AA 2JP9A 1A1FA 1AAYA 1MEYC 2DRPA 3VHTB 2EOYA 2EM0A 2EMCA 2EN1A 2WBTA 2EMYA 2YTEA 2EM7A 1X6HA 1KJKA 1ZU1A 2EMLA 2ADRA 4M9VC 2EMZA 2EM5A 2YTJA 5KL5A 2LV2A 2EOQA 4F6MA 2EP3A 2EPXA 2RSIA 4GZNC 5KL7A 1F2IG 1UBDC 2EMGA 2I13A 3MHHC 2ENHA 2YTPA 4R2PA 2EOSA 1BBOA 2WCC3 1NCSA 2EPUA 2J7JA 2EL4A 2EM2A 1X6FA 1X5WA 2DLQA 2EOXA 2EPZA 2DGCA 2EQ1A 2CSHA 5KL3A 1P47A 4R2RA 2LVHA 2DLKA 2EL5A 2EMXA 2LCEA 1ZR9A 2PRTA 2R1FA 4F6NA 2EN3A 2JPAA 5KL6A 2YTIA 2HGHA 2EOMA 2EN4A 2ENAA 1YSAC 2YU5A 4R2QA 2LO3A 1TN9A 3EPJA 5KL4A 2EOJA 1JK2A 1ZAAC 2WBSA 2MDGA 2EOZA 2EPCA 2DMIA 2EOHA 4R2SA 1RMDA 1YUJA 2EMWA 2YRKA 2ELYA 4X9JA 2EPRA 2YSOA 3MHSC 1TF3A 2WBUA 2EM3A 2EN6A 1Z1BA 1UN6B 4IJDA 4R2DA 3UK3C 2EM9A 2EQ0A 1X6EA 2EMIA 2MKNA 3M99B 2YTOA 3EPKA 2EMHA 2GLIA 2ELZA 2RPCA 2MKDA 1B69A 2YTFA 2EOOA 2EMFA 2EN2A 1BB8A 2YSPA 4IS1C 2NABA 1G2DC 2EOIA 2EMAA 1A1KA 2EPPA 3EPHA 4R2EA 1WJPA 2EM8A 2M9AA 2EE8A 2EN7A 5KL2A 1JK1A 2EOFA 4FK5C 2EMKA 4F2JC 2EN8A 2A25A 1A1LA 2YU8A 3EPLA 2YTNA 2EMBA 1DGCA 2YRHA 1YUIA 2YTQA 4R2CA 1X3CA 1LLMC 1G2FC 2YTGA 1A1GA 1A1HA 2VRDA 4WSGA 2EL6A 1A1IA 2EPAA 2YTDA 2D9HA 2EOEA 2BB8A 2CTDA 2GHFA 1A1JA 2EQ3A 2YRMA 2LT7A 2CT1A 2EM4A 1TF6A 2EJ4A 2ENCA
chains in the Genus database with same CATH superfamily
3BIDA 2VQFE 4R2AA 3J7AG 3C6MA 4K0KE 1PJTA 1A1FA 4BHCA 4DR3E 4BS9A 2EMYA 4BHBA 3ZOQB 3FIGA 1ZU1A 2EWLA 1T4OA 1O0WA 4Q28A 3F6HA 2LV2A 1IQOA 2V86A 4F6MA 2EP3A 2EPXA 1UBDC 4OOGC 2EMGA 2I13A 3MHHC 4P78A 4X8WA 4X65E 4B3RE 2J7JA 2EL4A 1YYWA 3K6QA 4M0VA 4JV5E 2MDRA 4L8NA 3MSWA 2EQ1A 4DV0E 2FV4B 2EL5A 2RS7A 5AE1A 2PRTA 2R1FA 4RHBB 2EN3A 2EZ6A 2HGHA 2YTIA 2EN4A 2ENAA 2E1MA 3LMLA 4L5NC 2K7IA 2LO3A 2YZTA 3HPSA 5KL4A 4BMJA 2RS6A 4R03A 1GZ6A 3C6KA 5AC5A 2UXDE 2NUEA 4BC7A 2EMWA 2WZOA 2N3GA 4X9JA 4LF4E 2EPRA 4GKKE 1L4SA 1TF3A 4JYAE 2EN6A 1Z1BA 3ADIA 4Q35B 3UK3C 2VE7C 2MKNA 1I94E 4AQYE 1NEIA 2EMHA 1STUA 2LUPB 1RC7A 2MKDA 4JI1E 1UHZA 4F9CB 4IS1C 2EOIA 4MLQA 3ADGA 3EPHA 2EE8A 2DMYA 2EN7A 5KL2A 2EOFA 2EPKX 1N3GA 1WHQA 2YU8A 5A6KA 2LBSB 4KZSA 2B3TB 2YTQA 4YY3E 1X3CA 4I8OA 2YWQA 4BCAA 1G2FC 2ODRC 1A1HA 4WSGA 2EPAA 3KZYA 1GTKA 2EOEA 2JY9A 5LLQA 1A1JA 1QU6A 2LT7A 1N32E 4GEQB 2CT1A 2EM4A 2B7TA 1XMOE 1AH5A 2E72A 4X64E 3BBGA 4O43A 3H09A 3JAMC 2JP9A 4WPYA 2UXBE 2L92A 1PKPA 2EN1A 4BC9A 2WBTA 2JOBA 1UILA 3ADJA 1HNXE 1WRJA 1X6HA 2ADRA 2L6MA 2JR1A 5AE2A 2RTXA 2V83A 3P1XA 2FTXB 3HTXA 1X47A 4GZNC 2RSIA 1F2IG 5TSEA 3HQ1A 2ODRD 2ZM6E 2YTPA 1IQSA 4R2PA 2EOSA 2WCC3 1WHNA 5F3WA 1X6FA 2NUFA 5A6BA 2YT4A 1X5WA 4O4KA 2L8TA 4M2ZA 1IBME 4R2RA 2LVHA 4RH8A 2JWOA 3BF2A 2V89A 1SR9A 3TQMA 4R2QA 4ZYEA 1TN9A 3THOB 1JK2A 1T4LB 1XNQE 4BBYA 4NXNE 4NHRA 3AUZA 4X66E 1IBLE 2DSYA 2EOHA 4LFCE 4R2SA 5FLXC 5ADZA 2WBUA 4WXDA 4R2DA 4NXME 1YPNA 2EM9A 4JI2E 4ZYGA 2EMIA 1ZBTA 3M99B 4O5GA 2ELZA 3IWCA 1B69A 2EPMX 1BB8A 5A6BD 2JVAA 4DR1E 2H36X 3ECRA 2EMAA 1A1KA 2M9AA 1N33E 1IBKE 2UU9E 4WXCA 2MC5A 2F8BA 2EN8A 2A25A 3THNA 3EPLA 2YTNA 1GQEA 1T39A 1EH8A 1LLMC 2M4IA 2YTGA 1A1IA 5CFFE 2GHFA 2BB8A 2YRMA 4ZYDA 5AE3A 2DIXA 2B9DA 1BBGA 1TF6A 2ENCA 2F4VE 2EORA 2NA2A 4J8ZA 2EM6A 1MEYC 1AAYA 2DRPA 2UXCE 2EM0A 4DKKA 4M30A 4O24A 2YTEA 4B3ME 2VF1A 3J80C 2EM7A 3AV0A 4WX9A 2EOQA 2L3CA 5KL7A 4HTGA 4DR7E 4JI0E 1BBOA 4JI5E 1NCSA 2LUQA 4LF7E 1J5EE 2CPNA 4HEIA 2EM2A 2LTSA 2DLQA 2EOXA 1SFEA 2DGCA 2CSHA 4JI4E 4F9AB 3BGHA 5KL3A 5IXMB 2DLKA 1HR0E 4LTYA 1T38A 4YHHE 2JPAA 1YSAC 2GPIA 2HHHE 1XNRE 2YU5A 2NUGA 1EH7A 2EOJA 4X62E 3KZZA 1ZAAC 2FGGA 3JTZA 2MDGA 2EOZA 2WBSA 4DUZE 1YYKA 4OX9E 3HXLA 5AASA 2DMIA 2HJJA 1RMDA 2ELYA 4LFBE 1PJSA 2EM3A 4DV6E 1UN6B 2KOUA 2L2MA 2LJUA 2M7QA 1X6EA 3C4BA 2KONA 2LMZA 1X49A 3EPKA 4DR6E 4LF9E 2RPCA 1WXRA 2K4VA 2YTFA 2E5LE 2EMFA 2G7HA 4NZVA 2YSPA 2V8QB 1G2DC 3OMLA 2EPPA 2L2KB 1J26A 3DF6A 4R2EA 5DNYA 5A69A 4DUYE 1HNWE 5A6AA 4DV3E 1YZ9A 1QNTA 2M1SA 4DR4E 4B3SE 2I9IA 1MGTA 1A1GA 2EL6A 3QG5C 2YTDA 2V85A 2CTDA 1N34E 2EQ3A 1N36E 2JOXA 2V87A 4WSPA 2B7VA 4ZYHA 3LLHA 1FKAE 1PDAA 4F54A 3J7Yp 3VHTB 2EOYA 3IWBA 5AC4A 3J81C 2UUBE 2EMCA 5LMUE 2BBGA 2JXPA 2EPOA 4KHPE 5T6JA 2EPLX 1KJKA 2EMLA 4M9VC 4DV4E 2EMZA 2EM5A 2L33A 2YTJA 4DV5E 3EQ1A 5KL5A 5IV8B 1X48A 4DR2E 2LTRA 3JU0A 1PJQA 2ENHA 2EPNA 5LMNE 4P7DA 5IWAE 2EPUA 4N4RB 3RMPA 4LF6E 4KWYA 1IMUA 3C4TA 2EPZA 1EKZA 4WYQB 1P47A 3T1YE 2EMXA 2R76A 2LCEA 2N3HA 4DV1E 4DV7E 1DQ3A 1ZR9A 4F6NA 1KYQA 2YPNA 3IWDA 5KL6A 4B3TE 2N8XA 2EOMA 2UUCE 2VQEE 3EPJA 2JYAA 2RQLA 1YFHA 4MLVA 5A6JA 4TUIA 4LF8E 2EPCA 3OTOE 4DV2E 2L3JA 2LE2A 4LF5E 4JI6E 1YUJA 4JI8E 2KHXA 2YRKA 1RQ0A 3VYXA 2YSOA 2IHR1 3MHSC 3ADLA 2V88A 4IJDA 3KWRA 3T1HE 4LFAE 1XMQE 2EQ0A 1FJGE 5IT9C 2YTOA 4LU9A 2GLIA 2MC6A 2EOOA 4DMIA 2EN2A 4JI3E 1T4NA 2L2NA 3L00A 2NABA 4F9BB 1EH6A 3VK6A 5LL6R 2Q8UA 1WJPA 2EM8A 1JK1A 4R8OA 2DB2A 1HNZE 4FK5C 2EMKA 2HC5A 4F2JC 4DR5E 1ZBQA 1A1LA 2EMBA 1DGCA 4GKJE 2YRHA 1YUIA 1DI2A 4R2CA 2RSMA 2LRSA 5BR8E 3HPZA 2VRDA 4WFTA 4JI7E 4TUGA 2UUAE 2D9HA 3DJWA 3F6GA 3VYYA 2LJHA 2EJ4A 5A2QC 1YYOA
chains in the Genus database with same CATH topology
2EORA 2E72A 2EM6A 4R2AA 2JP9A 1A1FA 1AAYA 1MEYC 2DRPA 3VHTB 2EOYA 2EM0A 2EMCA 2EN1A 2WBTA 2EMYA 2YTEA 2EM7A 1X6HA 1KJKA 1ZU1A 2EMLA 2ADRA 4M9VC 2EMZA 2EM5A 2YTJA 5KL5A 2LV2A 2EOQA 4F6MA 2EP3A 2EPXA 2RSIA 4GZNC 5KL7A 1F2IG 1UBDC 2EMGA 2I13A 3MHHC 2ENHA 2YTPA 4R2PA 2EOSA 1BBOA 2WCC3 1NCSA 2EPUA 2J7JA 2EL4A 2EM2A 1X6FA 1X5WA 2DLQA 2EOXA 2EPZA 2DGCA 2EQ1A 2CSHA 5KL3A 1P47A 4R2RA 2LVHA 2DLKA 2EL5A 2EMXA 2LCEA 1ZR9A 2PRTA 2R1FA 4F6NA 2EN3A 2JPAA 5KL6A 2YTIA 2HGHA 2EOMA 2EN4A 2ENAA 1YSAC 2YU5A 4R2QA 2LO3A 1TN9A 3EPJA 5KL4A 2EOJA 1JK2A 1ZAAC 2WBSA 2MDGA 2EOZA 2EPCA 2DMIA 2EOHA 4R2SA 1RMDA 1YUJA 2EMWA 2YRKA 2ELYA 4X9JA 2EPRA 2YSOA 3MHSC 1TF3A 2WBUA 2EM3A 2EN6A 1Z1BA 1UN6B 4IJDA 4R2DA 3UK3C 2EM9A 2EQ0A 1X6EA 2EMIA 2MKNA 3M99B 2YTOA 3EPKA 2EMHA 2GLIA 2ELZA 2RPCA 2MKDA 1B69A 2YTFA 2EOOA 2EMFA 2EN2A 1BB8A 2YSPA 4IS1C 2NABA 1G2DC 2EOIA 2EMAA 1A1KA 2EPPA 3EPHA 4R2EA 1WJPA 2EM8A 2M9AA 2EE8A 2EN7A 5KL2A 1JK1A 2EOFA 4FK5C 2EMKA 4F2JC 2EN8A 2A25A 1A1LA 2YU8A 3EPLA 2YTNA 2EMBA 1DGCA 2YRHA 1YUIA 2YTQA 4R2CA 1X3CA 1LLMC 1G2FC 2YTGA 1A1GA 1A1HA 2VRDA 4WSGA 2EL6A 1A1IA 2EPAA 2YTDA 2D9HA 2EOEA 2BB8A 2CTDA 2GHFA 1A1JA 2EQ3A 2YRMA 2LT7A 2CT1A 2EM4A 1TF6A 2EJ4A 2ENCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOR A;  2E72 A;  2EM6 A;  4R2A A;  2JP9 A;  1A1F A;  1AAY A;  1MEY C;  2DRP A;  3VHT B;  2EOY A;  2EM0 A;  2EMC A;  2EN1 A;  2WBT A;  2EMY A;  2YTE A;  2EM7 A;  1X6H A;  1KJK A;  1ZU1 A;  2EML A;  2ADR A;  4M9V C;  2EMZ A;  2EM5 A;  2YTJ A;  5KL5 A;  2LV2 A;  2EOQ A;  4F6M A;  2EP3 A;  2EPX A;  2RSI A;  4GZN C;  5KL7 A;  1F2I G;  1UBD C;  2EMG A;  2I13 A;  3MHH C;  2ENH A;  2YTP A;  4R2P A;  2EOS A;  1BBO A;  2WCC 3;  1NCS A;  2EPU A;  2J7J A;  2EL4 A;  2EM2 A;  1X6F A;  1X5W A;  2DLQ A;  2EOX A;  2EPZ A;  2DGC A;  2EQ1 A;  2CSH A;  5KL3 A;  1P47 A;  4R2R A;  2LVH A;  2DLK A;  2EL5 A;  2EMX A;  2LCE A;  1ZR9 A;  2PRT A;  2R1F A;  4F6N A;  2EN3 A;  2JPA A;  5KL6 A;  2YTI A;  2HGH A;  2EOM A;  2EN4 A;  2ENA A;  1YSA C;  2YU5 A;  4R2Q A;  2LO3 A;  1TN9 A;  3EPJ A;  5KL4 A;  2EOJ A;  1JK2 A;  1ZAA C;  2WBS A;  2MDG A;  2EOZ A;  2EPC A;  2DMI A;  2EOH A;  4R2S A;  1RMD A;  1YUJ A;  2EMW A;  2YRK A;  2ELY A;  4X9J A;  2EPR A;  2YSO A;  3MHS C;  1TF3 A;  2WBU A;  2EM3 A;  2EN6 A;  1Z1B A;  1UN6 B;  4IJD A;  4R2D A;  3UK3 C;  2EM9 A;  2EQ0 A;  1X6E A;  2EMI A;  2MKN A;  3M99 B;  2YTO A;  3EPK A;  2EMH A;  2GLI A;  2ELZ A;  2RPC A;  2MKD A;  1B69 A;  2YTF A;  2EOO A;  2EMF A;  2EN2 A;  1BB8 A;  2YSP A;  4IS1 C;  2NAB A;  1G2D C;  2EOI A;  2EMA A;  1A1K A;  2EPP A;  3EPH A;  4R2E A;  1WJP A;  2EM8 A;  2M9A A;  2EE8 A;  2EN7 A;  5KL2 A;  1JK1 A;  2EOF A;  4FK5 C;  2EMK A;  4F2J C;  2EN8 A;  2A25 A;  1A1L A;  2YU8 A;  3EPL A;  2YTN A;  2EMB A;  1DGC A;  2YRH A;  1YUI A;  2YTQ A;  4R2C A;  1X3C A;  1LLM C;  1G2F C;  2YTG A;  1A1G A;  1A1H A;  2VRD A;  4WSG A;  2EL6 A;  1A1I A;  2EPA A;  2YTD A;  2D9H A;  2EOE A;  2BB8 A;  2CTD A;  2GHF A;  1A1J A;  2EQ3 A;  2YRM A;  2LT7 A;  2CT1 A;  2EM4 A;  1TF6 A;  2EJ4 A;  2ENC A; 
#chains in the Genus database with same CATH topology
 3BID A;  2VQF E;  4R2A A;  3J7A G;  3C6M A;  4K0K E;  1PJT A;  1A1F A;  4BHC A;  4DR3 E;  4BS9 A;  2EMY A;  4BHB A;  3ZOQ B;  3FIG A;  1ZU1 A;  2EWL A;  1T4O A;  1O0W A;  4Q28 A;  3F6H A;  2LV2 A;  1IQO A;  2V86 A;  4F6M A;  2EP3 A;  2EPX A;  1UBD C;  4OOG C;  2EMG A;  2I13 A;  3MHH C;  4P78 A;  4X8W A;  4X65 E;  4B3R E;  2J7J A;  2EL4 A;  1YYW A;  3K6Q A;  4M0V A;  4JV5 E;  2MDR A;  4L8N A;  3MSW A;  2EQ1 A;  4DV0 E;  2FV4 B;  2EL5 A;  2RS7 A;  5AE1 A;  2PRT A;  2R1F A;  4RHB B;  2EN3 A;  2EZ6 A;  2HGH A;  2YTI A;  2EN4 A;  2ENA A;  2E1M A;  3LML A;  4L5N C;  2K7I A;  2LO3 A;  2YZT A;  3HPS A;  5KL4 A;  4BMJ A;  2RS6 A;  4R03 A;  1GZ6 A;  3C6K A;  5AC5 A;  2UXD E;  2NUE A;  4BC7 A;  2EMW A;  2WZO A;  2N3G A;  4X9J A;  4LF4 E;  2EPR A;  4GKK E;  1L4S A;  1TF3 A;  4JYA E;  2EN6 A;  1Z1B A;  3ADI A;  4Q35 B;  3UK3 C;  2VE7 C;  2MKN A;  1I94 E;  4AQY E;  1NEI A;  2EMH A;  1STU A;  2LUP B;  1RC7 A;  2MKD A;  4JI1 E;  1UHZ A;  4F9C B;  4IS1 C;  2EOI A;  4MLQ A;  3ADG A;  3EPH A;  2EE8 A;  2DMY A;  2EN7 A;  5KL2 A;  2EOF A;  2EPK X;  1N3G A;  1WHQ A;  2YU8 A;  5A6K A;  2LBS B;  4KZS A;  2B3T B;  2YTQ A;  4YY3 E;  1X3C A;  4I8O A;  2YWQ A;  4BCA A;  1G2F C;  2ODR C;  1A1H A;  4WSG A;  2EPA A;  3KZY A;  1GTK A;  2EOE A;  2JY9 A;  5LLQ A;  1A1J A;  1QU6 A;  2LT7 A;  1N32 E;  4GEQ B;  2CT1 A;  2EM4 A;  2B7T A;  1XMO E;  1AH5 A;  2E72 A;  4X64 E;  3BBG A;  4O43 A;  3H09 A;  3JAM C;  2JP9 A;  4WPY A;  2UXB E;  2L92 A;  1PKP A;  2EN1 A;  4BC9 A;  2WBT A;  2JOB A;  1UIL A;  3ADJ A;  1HNX E;  1WRJ A;  1X6H A;  2ADR A;  2L6M A;  2JR1 A;  5AE2 A;  2RTX A;  2V83 A;  3P1X A;  2FTX B;  3HTX A;  1X47 A;  4GZN C;  2RSI A;  1F2I G;  5TSE A;  3HQ1 A;  2ODR D;  2ZM6 E;  2YTP A;  1IQS A;  4R2P A;  2EOS A;  2WCC 3;  1WHN A;  5F3W A;  1X6F A;  2NUF A;  5A6B A;  2YT4 A;  1X5W A;  4O4K A;  2L8T A;  4M2Z A;  1IBM E;  4R2R A;  2LVH A;  4RH8 A;  2JWO A;  3BF2 A;  2V89 A;  1SR9 A;  3TQM A;  4R2Q A;  4ZYE A;  1TN9 A;  3THO B;  1JK2 A;  1T4L B;  1XNQ E;  4BBY A;  4NXN E;  4NHR A;  3AUZ A;  4X66 E;  1IBL E;  2DSY A;  2EOH A;  4LFC E;  4R2S A;  5FLX C;  5ADZ A;  2WBU A;  4WXD A;  4R2D A;  4NXM E;  1YPN A;  2EM9 A;  4JI2 E;  4ZYG A;  2EMI A;  1ZBT A;  3M99 B;  4O5G A;  2ELZ A;  3IWC A;  1B69 A;  2EPM X;  1BB8 A;  5A6B D;  2JVA A;  4DR1 E;  2H36 X;  3ECR A;  2EMA A;  1A1K A;  2M9A A;  1N33 E;  1IBK E;  2UU9 E;  4WXC A;  2MC5 A;  2F8B A;  2EN8 A;  2A25 A;  3THN A;  3EPL A;  2YTN A;  1GQE A;  1T39 A;  1EH8 A;  1LLM C;  2M4I A;  2YTG A;  1A1I A;  5CFF E;  2GHF A;  2BB8 A;  2YRM A;  4ZYD A;  5AE3 A;  2DIX A;  2B9D A;  1BBG A;  1TF6 A;  2ENC A;  2F4V E;  2EOR A;  2NA2 A;  4J8Z A;  2EM6 A;  1MEY C;  1AAY A;  2DRP A;  2UXC E;  2EM0 A;  4DKK A;  4M30 A;  4O24 A;  2YTE A;  4B3M E;  2VF1 A;  3J80 C;  2EM7 A;  3AV0 A;  4WX9 A;  2EOQ A;  2L3C A;  5KL7 A;  4HTG A;  4DR7 E;  4JI0 E;  1BBO A;  4JI5 E;  1NCS A;  2LUQ A;  4LF7 E;  1J5E E;  2CPN A;  4HEI A;  2EM2 A;  2LTS A;  2DLQ A;  2EOX A;  1SFE A;  2DGC A;  2CSH A;  4JI4 E;  4F9A B;  3BGH A;  5KL3 A;  5IXM B;  2DLK A;  1HR0 E;  4LTY A;  1T38 A;  4YHH E;  2JPA A;  1YSA C;  2GPI A;  2HHH E;  1XNR E;  2YU5 A;  2NUG A;  1EH7 A;  2EOJ A;  4X62 E;  3KZZ A;  1ZAA C;  2FGG A;  3JTZ A;  2MDG A;  2EOZ A;  2WBS A;  4DUZ E;  1YYK A;  4OX9 E;  3HXL A;  5AAS A;  2DMI A;  2HJJ A;  1RMD A;  2ELY A;  4LFB E;  1PJS A;  2EM3 A;  4DV6 E;  1UN6 B;  2KOU A;  2L2M A;  2LJU A;  2M7Q A;  1X6E A;  3C4B A;  2KON A;  2LMZ A;  1X49 A;  3EPK A;  4DR6 E;  4LF9 E;  2RPC A;  1WXR A;  2K4V A;  2YTF A;  2E5L E;  2EMF A;  2G7H A;  4NZV A;  2YSP A;  2V8Q B;  1G2D C;  3OML A;  2EPP A;  2L2K B;  1J26 A;  3DF6 A;  4R2E A;  5DNY A;  5A69 A;  4DUY E;  1HNW E;  5A6A A;  4DV3 E;  1YZ9 A;  1QNT A;  2M1S A;  4DR4 E;  4B3S E;  2I9I A;  1MGT A;  1A1G A;  2EL6 A;  3QG5 C;  2YTD A;  2V85 A;  2CTD A;  1N34 E;  2EQ3 A;  1N36 E;  2JOX A;  2V87 A;  4WSP A;  2B7V A;  4ZYH A;  3LLH A;  1FKA E;  1PDA A;  4F54 A;  3J7Y p;  3VHT B;  2EOY A;  3IWB A;  5AC4 A;  3J81 C;  2UUB E;  2EMC A;  5LMU E;  2BBG A;  2JXP A;  2EPO A;  4KHP E;  5T6J A;  2EPL X;  1KJK A;  2EML A;  4M9V C;  4DV4 E;  2EMZ A;  2EM5 A;  2L33 A;  2YTJ A;  4DV5 E;  3EQ1 A;  5KL5 A;  5IV8 B;  1X48 A;  4DR2 E;  2LTR A;  3JU0 A;  1PJQ A;  2ENH A;  2EPN A;  5LMN E;  4P7D A;  5IWA E;  2EPU A;  4N4R B;  3RMP A;  4LF6 E;  4KWY A;  1IMU A;  3C4T A;  2EPZ A;  1EKZ A;  4WYQ B;  1P47 A;  3T1Y E;  2EMX A;  2R76 A;  2LCE A;  2N3H A;  4DV1 E;  4DV7 E;  1DQ3 A;  1ZR9 A;  4F6N A;  1KYQ A;  2YPN A;  3IWD A;  5KL6 A;  4B3T E;  2N8X A;  2EOM A;  2UUC E;  2VQE E;  3EPJ A;  2JYA A;  2RQL A;  1YFH A;  4MLV A;  5A6J A;  4TUI A;  4LF8 E;  2EPC A;  3OTO E;  4DV2 E;  2L3J A;  2LE2 A;  4LF5 E;  4JI6 E;  1YUJ A;  4JI8 E;  2KHX A;  2YRK A;  1RQ0 A;  3VYX A;  2YSO A;  2IHR 1;  3MHS C;  3ADL A;  2V88 A;  4IJD A;  3KWR A;  3T1H E;  4LFA E;  1XMQ E;  2EQ0 A;  1FJG E;  5IT9 C;  2YTO A;  4LU9 A;  2GLI A;  2MC6 A;  2EOO A;  4DMI A;  2EN2 A;  4JI3 E;  1T4N A;  2L2N A;  3L00 A;  2NAB A;  4F9B B;  1EH6 A;  3VK6 A;  5LL6 R;  2Q8U A;  1WJP A;  2EM8 A;  1JK1 A;  4R8O A;  2DB2 A;  1HNZ E;  4FK5 C;  2EMK A;  2HC5 A;  4F2J C;  4DR5 E;  1ZBQ A;  1A1L A;  2EMB A;  1DGC A;  4GKJ E;  2YRH A;  1YUI A;  1DI2 A;  4R2C A;  2RSM A;  2LRS A;  5BR8 E;  3HPZ A;  2VRD A;  4WFT A;  4JI7 E;  4TUG A;  2UUA E;  2D9H A;  3DJW A;  3F6G A;  3VYY A;  2LJH A;  2EJ4 A;  5A2Q C;  1YYO A; 
#chains in the Genus database with same CATH homology
 2EOR A;  2E72 A;  2EM6 A;  4R2A A;  2JP9 A;  1A1F A;  1AAY A;  1MEY C;  2DRP A;  3VHT B;  2EOY A;  2EM0 A;  2EMC A;  2EN1 A;  2WBT A;  2EMY A;  2YTE A;  2EM7 A;  1X6H A;  1KJK A;  1ZU1 A;  2EML A;  2ADR A;  4M9V C;  2EMZ A;  2EM5 A;  2YTJ A;  5KL5 A;  2LV2 A;  2EOQ A;  4F6M A;  2EP3 A;  2EPX A;  2RSI A;  4GZN C;  5KL7 A;  1F2I G;  1UBD C;  2EMG A;  2I13 A;  3MHH C;  2ENH A;  2YTP A;  4R2P A;  2EOS A;  1BBO A;  2WCC 3;  1NCS A;  2EPU A;  2J7J A;  2EL4 A;  2EM2 A;  1X6F A;  1X5W A;  2DLQ A;  2EOX A;  2EPZ A;  2DGC A;  2EQ1 A;  2CSH A;  5KL3 A;  1P47 A;  4R2R A;  2LVH A;  2DLK A;  2EL5 A;  2EMX A;  2LCE A;  1ZR9 A;  2PRT A;  2R1F A;  4F6N A;  2EN3 A;  2JPA A;  5KL6 A;  2YTI A;  2HGH A;  2EOM A;  2EN4 A;  2ENA A;  1YSA C;  2YU5 A;  4R2Q A;  2LO3 A;  1TN9 A;  3EPJ A;  5KL4 A;  2EOJ A;  1JK2 A;  1ZAA C;  2WBS A;  2MDG A;  2EOZ A;  2EPC A;  2DMI A;  2EOH A;  4R2S A;  1RMD A;  1YUJ A;  2EMW A;  2YRK A;  2ELY A;  4X9J A;  2EPR A;  2YSO A;  3MHS C;  1TF3 A;  2WBU A;  2EM3 A;  2EN6 A;  1Z1B A;  1UN6 B;  4IJD A;  4R2D A;  3UK3 C;  2EM9 A;  2EQ0 A;  1X6E A;  2EMI A;  2MKN A;  3M99 B;  2YTO A;  3EPK A;  2EMH A;  2GLI A;  2ELZ A;  2RPC A;  2MKD A;  1B69 A;  2YTF A;  2EOO A;  2EMF A;  2EN2 A;  1BB8 A;  2YSP A;  4IS1 C;  2NAB A;  1G2D C;  2EOI A;  2EMA A;  1A1K A;  2EPP A;  3EPH A;  4R2E A;  1WJP A;  2EM8 A;  2M9A A;  2EE8 A;  2EN7 A;  5KL2 A;  1JK1 A;  2EOF A;  4FK5 C;  2EMK A;  4F2J C;  2EN8 A;  2A25 A;  1A1L A;  2YU8 A;  3EPL A;  2YTN A;  2EMB A;  1DGC A;  2YRH A;  1YUI A;  2YTQ A;  4R2C A;  1X3C A;  1LLM C;  1G2F C;  2YTG A;  1A1G A;  1A1H A;  2VRD A;  4WSG A;  2EL6 A;  1A1I A;  2EPA A;  2YTD A;  2D9H A;  2EOE A;  2BB8 A;  2CTD A;  2GHF A;  1A1J A;  2EQ3 A;  2YRM A;  2LT7 A;  2CT1 A;  2EM4 A;  1TF6 A;  2EJ4 A;  2ENC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...