3BF2A

Crystal structure of the a1ksw9_neimf protein from neisseria meningitidis. northeast structural genomics consortium target mr36a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
125
Chain Sequence
b'LTYRSWHIEGGQALQFPLETALYQASGRVDDAAGAQMTLRIDSVSQNKETYTVTAVINEYLLILTVEAQVLKRGEPVGKPMTVSVRRVLAYADLGKQEEEAALWAEMRQDAAEQIVRRLTFLKAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
molecule tags Lipoprotein
source organism Neisseria meningitidis fam18
publication title Crystal structure of the A1KSW9_NEIMF protein from Neisseria meningitidis.
rcsb
total genus 24
structure length 125
sequence length 130
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 3bf2A00
4RH8A 5TSEA 5IV8B 2JXPA 4KWYA 4Q35B 2N8XA 4N4RB 5IXMB 2R76A 4NHRA 4RHBB 3BF2A
chains in the Genus database with same CATH superfamily
2EN1A 3VYXA 2LV2A 3T1HE 3HPSA 4JYAE 4DV7E 4O43A 3AV0A 2YTEA 4R03A 4JI0E 3HXLA 2LTRA 2JPAA 5AE2A 2YTIA 4N4RB 3RMPA 4Q28A 2EOEA 4JI3E 2J7JA 1TN9A 3OMLA 1YPNA 4R2DA 1XMOE 2E5LE 2EMKA 1GTKA 4BHCA 1GZ6A 2KONA 1PKPA 2MC6A 5AC4A 2F8BA 1ZBTA 4B3ME 1HNZE 1X48A 2VF1A 4DV6E 1X6HA 4WPYA 2CSHA 2ELYA 4FK5C 4LF9E 2EM6A 1G2DC 3H09A 1YUIA 3TQMA 1WJPA 1EH8A 2YRKA 2M4IA 3EQ1A 4X66E 2YTFA 1JK2A 2D9HA 4ZYHA 2BBGA 2WCC3 4DUYE 3C4TA 3QG5C 2V88A 1IQSA 1T39A 2I9IA 1P47A 2EOYA 2MDGA 2EORA 3P1XA 4L8NA 2HGHA 2NUGA 2ADRA 2EPMX 4R2QA 5IT9C 4DR2E 1YYOA 4K0KE 2B7TA 4RHBB 2UUCE 2R1FA 3ECRA 2EMGA 4OX9E 3JAMC 1IQOA 2MKNA 4JI8E 2YPNA 4WXCA 1QNTA 2YTQA 1MEYC 1MGTA 4OOGC 2JY9A 2ELZA 2ODRD 4P78A 3HTXA 3ADLA 2FGGA 2L6MA 4R2RA 5T6JA 2EOQA 2MDRA 2YZTA 1YSAC 4R2CA 2EM7A 2A25A 1EH6A 2LO3A 2PRTA 3VK6A 2CT1A 2LT7A 4B3SE 1IBME 5A69A 3HQ1A 4WXDA 2MC5A 1WHQA 2YTOA 4JI6E 2LBSB 2EOZA 1XNQE 2YTPA 2GLIA 5KL2A 4JI2E 4BMJA 4BC7A 1BBGA 2G7HA 3THNA 5AE3A 5FLXC 2UU9E 2LCEA 1GQEA 2EMIA 1KYQA 3DJWA 2EQ3A 1STUA 3LLHA 4M0VA 3ADGA 4B3RE 2V8QB 1YFHA 2EMHA 1B69A 3KWRA 4R2SA 2EPUA 4M2ZA 4WYQB 2EN7A 4JI4E 4IJDA 3BGHA 3J7Yp 3EPJA 4R8OA 2R76A 1BB8A 2N3GA 2ZM6E 4TUIA 1SFEA 3ADJA 2B9DA 1DQ3A 2WZOA 2E72A 1ZBQA 2M7QA 2ENCA 2MKDA 2Q8UA 1N34E 1XMQE 2DMYA 5KL7A 1A1KA 3J80C 2EL5A 1L4SA 2EOHA 2DSYA 3IWDA 4R2PA 1WXRA 4HTGA 2EZ6A 2DLKA 4X62E 1LLMC 1F2IG 2EPRA 4NXME 2EM9A 4DV2E 1A1JA 4GZNC 4F9BB 3BBGA 2EN8A 4KWYA 2YTGA 2LRSA 3BIDA 2YT4A 5LMUE 2HJJA 2LTSA 2NUEA 2EMFA 2EM5A 2EE8A 1J26A 2EN3A 2EM3A 1A1FA 4DV4E 4F9AB 1WRJA 4RH8A 2UXCE 2EPCA 3T1YE 2ODRC 2UUAE 5AASA 1SR9A 1ZR9A 2YRMA 5LMNE 2DGCA 3OTOE 1KJKA 5LL6R 1T4LB 2LMZA 3KZZA 2EM2A 3KZYA 2EM8A 5A6KA 1X6EA 2EQ1A 4DV5E 1T38A 1UHZA 2V86A 2E1MA 2NA2A 2YSPA 4ZYEA 4P7DA 2EP3A 3IWBA 2DMIA 3K6QA 2CPNA 5KL4A 1FJGE 1N3GA 4M30A 1RC7A 2EOXA 1TF3A 5KL6A 4X8WA 2EOMA 5A6BD 2EMCA 4GKJE 4WX9A 1X47A 4GEQB 4NHRA 1TF6A 1YYKA 1X3CA 1A1LA 5AC5A 3MHHC 1J5EE 3ZOQB 4TUGA 4WSGA 4R2AA 1I94E 2DLQA 4F2JC 2FV4B 1BBOA 2B7VA 2WBSA 2ENAA 2EMBA 4KZSA 2FTXB 2LJUA 1DI2A 4X64E 4DR7E 4JV5E 2RS6A 2KOUA 1PJSA 4LF4E 1JK1A 4LFBE 4WFTA 1IMUA 3EPLA 5TSEA 1IBLE 2UXDE 4DR4E 1HNXE 4JI7E 2L2NA 5A2QC 4O4KA 2RS7A 2EN2A 3J7AG 2EM0A 4ZYDA 2JVAA 3C6KA 2DB2A 1EH7A 4DV1E 2NUFA 3BF2A 3DF6A 2WBUA 3MSWA 2EMZA 2YU5A 2EN4A 2F4VE 1HNWE 4NXNE 2JOBA 1A1HA 4LF5E 2UUBE 1RMDA 3MHSC 1XNRE 2JP9A 4BC9A 1G2FC 3FIGA 4DMIA 2HHHE 2L92A 2RQLA 2EPKX 2L33A 4LF8E 4O24A 2DIXA 2EPLX 5IXMB 2M1SA 1QU6A 3AUZA 1A1GA 1X5WA 2EOSA 2L3JA 3JU0A 4DV0E 5DNYA 2YRHA 3M99B 4LFCE 2V85A 1Z1BA 5A6JA 5AE1A 2V83A 1PJTA 3IWCA 2EMLA 4YY3E 4MLVA 1WHNA 2JXPA 4ZYGA 2LVHA 3LMLA 1ZAAC 5ADZA 2RSIA 2EOFA 1UBDC 3C6MA 1T4OA 3VYYA 4I8OA 4F6NA 3ADIA 2V87A 4DKKA 2VQEE 2YTDA 1DGCA 4Q35B 1X6FA 4F9CB 2GPIA 2LUQA 2EM4A 2LUPB 1PJQA 5F3WA 2ENHA 4M9VC 2M9AA 2HC5A 4AQYE 3J81C 2L8TA 4BBYA 2NABA 1AH5A 4LTYA 5A6AA 2JWOA 2BB8A 4KHPE 2VRDA 2YSOA 4F6MA 2L2KB 5IV8B 2EOIA 3C4BA 2EPNA 3F6GA 1YUJA 4LU9A 3HPZA 2EL4A 1UN6B 4R2EA 1X49A 2L2MA 2EPAA 2K4VA 2KHXA 2EQ0A 1NCSA 4F54A 2UXBE 1AAYA 4DR3E 1EKZA 1N36E 2K7IA 2EMAA 2EN6A 2EPOA 5KL3A 2EWLA 1A1IA 2EPXA 2JOXA 4WSPA 2LE2A 2WBTA 3F6HA 2EMYA 2YTJA 4DR6E 3THOB 1HR0E 4JI5E 2YWQA 1N32E 1RQ0A 2EOOA 2EPPA 2GHFA 2RPCA 3JTZA 1PDAA 1N33E 4L5NC 4BCAA 4YHHE 4DV3E 5LLQA 1O0WA 1NEIA 1T4NA 2EMXA 3UK3C 1IBKE 4DUZE 3EPKA 5CFFE 1YZ9A 2N8XA 2RSMA 1ZU1A 1YYWA 2N3HA 4X9JA 2VE7C 4LFAE 4J8ZA 5A6BA 2RTXA 2EMWA 2H36X 2B3TB 4X65E 5KL5A 4MLQA 3VHTB 4O5GA 4DR1E 2JR1A 2LJHA 3L00A 1UILA 2EJ4A 2DRPA 5BR8E 2JYAA 4IS1C 4DR5E 4LF6E 2V89A 4BS9A 2EL6A 2L3CA 3EPHA 5IWAE 2VQFE 2I13A 2EPZA 1FKAE 4LF7E 4GKKE 4BHBA 4HEIA 4JI1E 2EOJA 2IHR1 2YU8A 2CTDA 4B3TE 2YTNA 4NZVA
chains in the Genus database with same CATH topology
4RH8A 5TSEA 5IV8B 2JXPA 4KWYA 4Q35B 2N8XA 4N4RB 5IXMB 2R76A 4NHRA 4RHBB 3BF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RH8 A;  5TSE A;  5IV8 B;  2JXP A;  4KWY A;  4Q35 B;  2N8X A;  4N4R B;  5IXM B;  2R76 A;  4NHR A;  4RHB B;  3BF2 A; 
#chains in the Genus database with same CATH topology
 2EN1 A;  3VYX A;  2LV2 A;  3T1H E;  3HPS A;  4JYA E;  4DV7 E;  4O43 A;  3AV0 A;  2YTE A;  4R03 A;  4JI0 E;  3HXL A;  2LTR A;  2JPA A;  5AE2 A;  2YTI A;  4N4R B;  3RMP A;  4Q28 A;  2EOE A;  4JI3 E;  2J7J A;  1TN9 A;  3OML A;  1YPN A;  4R2D A;  1XMO E;  2E5L E;  2EMK A;  1GTK A;  4BHC A;  1GZ6 A;  2KON A;  1PKP A;  2MC6 A;  5AC4 A;  2F8B A;  1ZBT A;  4B3M E;  1HNZ E;  1X48 A;  2VF1 A;  4DV6 E;  1X6H A;  4WPY A;  2CSH A;  2ELY A;  4FK5 C;  4LF9 E;  2EM6 A;  1G2D C;  3H09 A;  1YUI A;  3TQM A;  1WJP A;  1EH8 A;  2YRK A;  2M4I A;  3EQ1 A;  4X66 E;  2YTF A;  1JK2 A;  2D9H A;  4ZYH A;  2BBG A;  2WCC 3;  4DUY E;  3C4T A;  3QG5 C;  2V88 A;  1IQS A;  1T39 A;  2I9I A;  1P47 A;  2EOY A;  2MDG A;  2EOR A;  3P1X A;  4L8N A;  2HGH A;  2NUG A;  2ADR A;  2EPM X;  4R2Q A;  5IT9 C;  4DR2 E;  1YYO A;  4K0K E;  2B7T A;  4RHB B;  2UUC E;  2R1F A;  3ECR A;  2EMG A;  4OX9 E;  3JAM C;  1IQO A;  2MKN A;  4JI8 E;  2YPN A;  4WXC A;  1QNT A;  2YTQ A;  1MEY C;  1MGT A;  4OOG C;  2JY9 A;  2ELZ A;  2ODR D;  4P78 A;  3HTX A;  3ADL A;  2FGG A;  2L6M A;  4R2R A;  5T6J A;  2EOQ A;  2MDR A;  2YZT A;  1YSA C;  4R2C A;  2EM7 A;  2A25 A;  1EH6 A;  2LO3 A;  2PRT A;  3VK6 A;  2CT1 A;  2LT7 A;  4B3S E;  1IBM E;  5A69 A;  3HQ1 A;  4WXD A;  2MC5 A;  1WHQ A;  2YTO A;  4JI6 E;  2LBS B;  2EOZ A;  1XNQ E;  2YTP A;  2GLI A;  5KL2 A;  4JI2 E;  4BMJ A;  4BC7 A;  1BBG A;  2G7H A;  3THN A;  5AE3 A;  5FLX C;  2UU9 E;  2LCE A;  1GQE A;  2EMI A;  1KYQ A;  3DJW A;  2EQ3 A;  1STU A;  3LLH A;  4M0V A;  3ADG A;  4B3R E;  2V8Q B;  1YFH A;  2EMH A;  1B69 A;  3KWR A;  4R2S A;  2EPU A;  4M2Z A;  4WYQ B;  2EN7 A;  4JI4 E;  4IJD A;  3BGH A;  3J7Y p;  3EPJ A;  4R8O A;  2R76 A;  1BB8 A;  2N3G A;  2ZM6 E;  4TUI A;  1SFE A;  3ADJ A;  2B9D A;  1DQ3 A;  2WZO A;  2E72 A;  1ZBQ A;  2M7Q A;  2ENC A;  2MKD A;  2Q8U A;  1N34 E;  1XMQ E;  2DMY A;  5KL7 A;  1A1K A;  3J80 C;  2EL5 A;  1L4S A;  2EOH A;  2DSY A;  3IWD A;  4R2P A;  1WXR A;  4HTG A;  2EZ6 A;  2DLK A;  4X62 E;  1LLM C;  1F2I G;  2EPR A;  4NXM E;  2EM9 A;  4DV2 E;  1A1J A;  4GZN C;  4F9B B;  3BBG A;  2EN8 A;  4KWY A;  2YTG A;  2LRS A;  3BID A;  2YT4 A;  5LMU E;  2HJJ A;  2LTS A;  2NUE A;  2EMF A;  2EM5 A;  2EE8 A;  1J26 A;  2EN3 A;  2EM3 A;  1A1F A;  4DV4 E;  4F9A B;  1WRJ A;  4RH8 A;  2UXC E;  2EPC A;  3T1Y E;  2ODR C;  2UUA E;  5AAS A;  1SR9 A;  1ZR9 A;  2YRM A;  5LMN E;  2DGC A;  3OTO E;  1KJK A;  5LL6 R;  1T4L B;  2LMZ A;  3KZZ A;  2EM2 A;  3KZY A;  2EM8 A;  5A6K A;  1X6E A;  2EQ1 A;  4DV5 E;  1T38 A;  1UHZ A;  2V86 A;  2E1M A;  2NA2 A;  2YSP A;  4ZYE A;  4P7D A;  2EP3 A;  3IWB A;  2DMI A;  3K6Q A;  2CPN A;  5KL4 A;  1FJG E;  1N3G A;  4M30 A;  1RC7 A;  2EOX A;  1TF3 A;  5KL6 A;  4X8W A;  2EOM A;  5A6B D;  2EMC A;  4GKJ E;  4WX9 A;  1X47 A;  4GEQ B;  4NHR A;  1TF6 A;  1YYK A;  1X3C A;  1A1L A;  5AC5 A;  3MHH C;  1J5E E;  3ZOQ B;  4TUG A;  4WSG A;  4R2A A;  1I94 E;  2DLQ A;  4F2J C;  2FV4 B;  1BBO A;  2B7V A;  2WBS A;  2ENA A;  2EMB A;  4KZS A;  2FTX B;  2LJU A;  1DI2 A;  4X64 E;  4DR7 E;  4JV5 E;  2RS6 A;  2KOU A;  1PJS A;  4LF4 E;  1JK1 A;  4LFB E;  4WFT A;  1IMU A;  3EPL A;  5TSE A;  1IBL E;  2UXD E;  4DR4 E;  1HNX E;  4JI7 E;  2L2N A;  5A2Q C;  4O4K A;  2RS7 A;  2EN2 A;  3J7A G;  2EM0 A;  4ZYD A;  2JVA A;  3C6K A;  2DB2 A;  1EH7 A;  4DV1 E;  2NUF A;  3BF2 A;  3DF6 A;  2WBU A;  3MSW A;  2EMZ A;  2YU5 A;  2EN4 A;  2F4V E;  1HNW E;  4NXN E;  2JOB A;  1A1H A;  4LF5 E;  2UUB E;  1RMD A;  3MHS C;  1XNR E;  2JP9 A;  4BC9 A;  1G2F C;  3FIG A;  4DMI A;  2HHH E;  2L92 A;  2RQL A;  2EPK X;  2L33 A;  4LF8 E;  4O24 A;  2DIX A;  2EPL X;  5IXM B;  2M1S A;  1QU6 A;  3AUZ A;  1A1G A;  1X5W A;  2EOS A;  2L3J A;  3JU0 A;  4DV0 E;  5DNY A;  2YRH A;  3M99 B;  4LFC E;  2V85 A;  1Z1B A;  5A6J A;  5AE1 A;  2V83 A;  1PJT A;  3IWC A;  2EML A;  4YY3 E;  4MLV A;  1WHN A;  2JXP A;  4ZYG A;  2LVH A;  3LML A;  1ZAA C;  5ADZ A;  2RSI A;  2EOF A;  1UBD C;  3C6M A;  1T4O A;  3VYY A;  4I8O A;  4F6N A;  3ADI A;  2V87 A;  4DKK A;  2VQE E;  2YTD A;  1DGC A;  4Q35 B;  1X6F A;  4F9C B;  2GPI A;  2LUQ A;  2EM4 A;  2LUP B;  1PJQ A;  5F3W A;  2ENH A;  4M9V C;  2M9A A;  2HC5 A;  4AQY E;  3J81 C;  2L8T A;  4BBY A;  2NAB A;  1AH5 A;  4LTY A;  5A6A A;  2JWO A;  2BB8 A;  4KHP E;  2VRD A;  2YSO A;  4F6M A;  2L2K B;  5IV8 B;  2EOI A;  3C4B A;  2EPN A;  3F6G A;  1YUJ A;  4LU9 A;  3HPZ A;  2EL4 A;  1UN6 B;  4R2E A;  1X49 A;  2L2M A;  2EPA A;  2K4V A;  2KHX A;  2EQ0 A;  1NCS A;  4F54 A;  2UXB E;  1AAY A;  4DR3 E;  1EKZ A;  1N36 E;  2K7I A;  2EMA A;  2EN6 A;  2EPO A;  5KL3 A;  2EWL A;  1A1I A;  2EPX A;  2JOX A;  4WSP A;  2LE2 A;  2WBT A;  3F6H A;  2EMY A;  2YTJ A;  4DR6 E;  3THO B;  1HR0 E;  4JI5 E;  2YWQ A;  1N32 E;  1RQ0 A;  2EOO A;  2EPP A;  2GHF A;  2RPC A;  3JTZ A;  1PDA A;  1N33 E;  4L5N C;  4BCA A;  4YHH E;  4DV3 E;  5LLQ A;  1O0W A;  1NEI A;  1T4N A;  2EMX A;  3UK3 C;  1IBK E;  4DUZ E;  3EPK A;  5CFF E;  1YZ9 A;  2N8X A;  2RSM A;  1ZU1 A;  1YYW A;  2N3H A;  4X9J A;  2VE7 C;  4LFA E;  4J8Z A;  5A6B A;  2RTX A;  2EMW A;  2H36 X;  2B3T B;  4X65 E;  5KL5 A;  4MLQ A;  3VHT B;  4O5G A;  4DR1 E;  2JR1 A;  2LJH A;  3L00 A;  1UIL A;  2EJ4 A;  2DRP A;  5BR8 E;  2JYA A;  4IS1 C;  4DR5 E;  4LF6 E;  2V89 A;  4BS9 A;  2EL6 A;  2L3C A;  3EPH A;  5IWA E;  2VQF E;  2I13 A;  2EPZ A;  1FKA E;  4LF7 E;  4GKK E;  4BHB A;  4HEI A;  4JI1 E;  2EOJ A;  2IHR 1;  2YU8 A;  2CTD A;  4B3T E;  2YTN A;  4NZV A; 
#chains in the Genus database with same CATH homology
 4RH8 A;  5TSE A;  5IV8 B;  2JXP A;  4KWY A;  4Q35 B;  2N8X A;  4N4R B;  5IXM B;  2R76 A;  4NHR A;  4RHB B;  3BF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...