3BF2A

Crystal structure of the a1ksw9_neimf protein from neisseria meningitidis. northeast structural genomics consortium target mr36a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
125
Chain Sequence
LTYRSWHIEGGQALQFPLETALYQASGRVDDAAGAQMTLRIDSVSQNKETYTVTAVINEYLLILTVEAQVLKRGEPVGKPMTVSVRRVLAYADLGKQEEEAALWAEMRQDAAEQIVRRLTFLKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the A1KSW9_NEIMF protein from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis fam18
molecule tags Lipoprotein
molecule keywords Putative lipoprotein
total genus 24
structure length 125
sequence length 130
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 3bf2A00
5IV8B 4RH8A 3BF2A 4N4RB 4Q35B 2N8XA 2R76A 4NHRA 4KWYA 5TSEA 2JXPA 5IXMB 4RHBB
chains in the Genus database with same CATH superfamily
5A69A 4Q28A 2EQ3A 4MLVA 2UXBE 3EQ1A 1SFEA 2EM5A 2YTFA 1A1KA 2M7QA 2EOZA 3KZYA 4WPYA 4DR1E 5AC5A 1IMUA 2JWOA 4K0KE 5KL5A 3IWBA 4RHBB 2JYAA 1NCSA 2L33A 4R2AA 4BS9A 1G2DC 1L4SA 2YU5A 2WCC3 1N32E 1JK2A 1N3GA 2WZOA 4L8NA 2EPRA 1PJSA 1IQSA 1EH8A 5LMUE 2F4VE 3FIGA 2L2MA 2EMXA 2B3TB 3MSWA 4LF8E 4DMIA 2N3HA 2VQFE 2EJ4A 1PJTA 1AH5A 3THNA 4X66E 3OMLA 5KL4A 4B3SE 3ADIA 3P1XA 4GZNC 4DUZE 2FGGA 1YFHA 5AE1A 4ZYHA 2EN7A 1YYWA 1UBDC 2EMZA 2Q8UA 4R2SA 5BR8E 4B3ME 2LRSA 5T6JA 5F3WA 1DI2A 4DV2E 2LUPB 1QU6A 4DR3E 2LE2A 2L6MA 1RMDA 2RPCA 1SR9A 2EPZA 2ENHA 1UN6B 1TF6A 2YPNA 5KL6A 2EP3A 1X6HA 1J5EE 3K6QA 2ODRC 1XMOE 1FJGE 2DIXA 2NUGA 2YU8A 1G2FC 5LMNE 2EN6A 5TSEA 2RSMA 1Z1BA 3BGHA 1GQEA 1GZ6A 5A6BA 2H36X 2N8XA 2B7VA 1HNXE 1ZBTA 2IHR1 4F6NA 1UILA 3ADLA 1WHQA 2DSYA 3VYYA 1BBGA 2DB2A 2EN3A 2YSOA 4J8ZA 1NEIA 2EN8A 4WSPA 4AQYE 4DV5E 1PDAA 4WFTA 2V83A 2I9IA 5ADZA 2ZM6E 4TUIA 1TF3A 2EM7A 2EOYA 2EZ6A 2YTGA 4DKKA 1IQOA 2EOJA 4WXDA 4HEIA 2EPLX 2V8QB 2YTQA 2DLQA 3KZZA 2KOUA 2YRKA 2YSPA 4KHPE 4GKKE 1A1LA 2LV2A 2EMLA 5IT9C 2L92A 2EL6A 2CT1A 4R2RA 2LTRA 2EMGA 1PKPA 5IWAE 4GKJE 3HTXA 2JVAA 1N34E 2EM4A 1STUA 2CTDA 2HC5A 4O24A 1B69A 2JOXA 5LL6R 1IBME 4OX9E 2EWLA 1LLMC 1IBKE 1A1HA 2JR1A 1FKAE 2EOMA 3HPZA 2EORA 4M2ZA 1N36E 2ELYA 3HPSA 3M99B 2J7JA 4MLQA 2CSHA 1WRJA 2EMHA 2N3GA 3JU0A 3LLHA 4GEQB 3J7AG 2VE7C 2EMAA 3TQMA 4F9CB 5AE2A 4JI3E 2EMYA 2L8TA 4P78A 5KL7A 2RSIA 2EM6A 2L2NA 4BMJA 2PRTA 1X3CA 1BBOA 2CPNA 2MKDA 2UU9E 2YTNA 4JI4E 1HNWE 2KONA 4LTYA 4LFCE 2DGCA 4DR5E 4DUYE 4F9BB 1IBLE 2UXDE 2JY9A 3DJWA 3IWDA 4BC9A 2HHHE 2EQ0A 2EM8A 1XMQE 2NUEA 1MEYC 2NUFA 2NABA 1T4LB 3J81C 2MKNA 2B9DA 4P7DA 1ZAAC 5KL3A 1DGCA 1WXRA 2YTIA 2EN1A 1P47A 1O0WA 5A6KA 2YZTA 1HNZE 2DMYA 2LJHA 2ELZA 1BB8A 4F6MA 2A25A 4LU9A 2RTXA 2D9HA 2YTEA 1JK1A 1YYKA 1T4NA 3C6KA 4R2QA 1KYQA 3BF2A 2R1FA 2EMFA 2R76A 4IJDA 2EE8A 4R2CA 4M9VC 4BHCA 2ENCA 2EPOA 2L3JA 3ADGA 3ECRA 2LT7A 4JI7E 2EPKX 5A6BD 2YTJA 5KL2A 1A1IA 1QNTA 2RQLA 4B3TE 2MDGA 2EPMX 2YT4A 3EPJA 2MC6A 2EM3A 3T1YE 1YUJA 2ENAA 5A6JA 5LLQA 2EPUA 4DV0E 2YTDA 4YHHE 2JP9A 4DV1E 3L00A 4L5NC 2V85A 1ZBQA 2JXPA 1XNQE 2MC5A 4DR4E 2YRHA 1A1JA 2EMWA 1YZ9A 4R2PA 2EOEA 4DR2E 2GHFA 3C4TA 2K7IA 4B3RE 4JYAE 2RS7A 4X65E 1I94E 3QG5C 3LMLA 3DF6A 2WBUA 4DV6E 1YUIA 4HTGA 3T1HE 4JI1E 1X48A 4N4RB 2E72A 1UHZA 4ZYGA 3J7Yp 4R2DA 4F54A 4LF6E 2EM2A 1EH6A 2L3CA 4F9AB 4ZYDA 4WXCA 3OTOE 2LJUA 2JOBA 4JI2E 2V87A 4BC7A 4TUGA 1ZR9A 3HXLA 1YYOA 2EN2A 4DV4E 4DR7E 5IXMB 4NXME 1X49A 1T38A 5CFFE 2EMKA 2LO3A 2EL5A 3MHSC 5DNYA 3AUZA 4LFBE 2LTSA 4X9JA 4LF7E 4LF4E 2HGHA 4KWYA 1WHNA 4DV3E 3VYXA 3MHHC 2UUBE 1RC7A 2EM9A 3VK6A 1X47A 2BB8A 1X6FA 4M30A 5FLXC 3THOB 5AE3A 2YWQA 2B7TA 2WBTA 2DRPA 2UXCE 4O5GA 2EOQA 2LMZA 4DV7E 4ZYEA 2LBSB 2F8BA 4JI8E 2E5LE 2EMCA 2EPXA 4X64E 4BHBA 4NXNE 3EPHA 4JV5E 1X5WA 2V89A 4O43A 2EPCA 2G7HA 1EKZA 2EOFA 2I13A 2ADRA 5IV8B 1J26A 4X62E 1TN9A 4R03A 1X6EA 2YTOA 4FK5C 2V88A 4JI0E 3H09A 4NZVA 3IWCA 2M9AA 4RH8A 1DQ3A 1YPNA 2MDRA 3HQ1A 2WBSA 4WSGA 2EPPA 3F6GA 2M4IA 1EH7A 3J80C 2E1MA 3C6MA 4M0VA 2LUQA 4I8OA 4DR6E 2JPAA 3EPKA 2RS6A 4YY3E 2LVHA 2DLKA 2UUCE 2HJJA 2M1SA 2FV4B 4LFAE 1XNRE 2EPAA 1AAYA 1A1GA 2EOIA 1A1FA 4Q35B 1HR0E 2FTXB 3KWRA 1PJQA 1ZU1A 2EL4A 2EOXA 3EPLA 2NA2A 4NHRA 1N33E 2DMIA 1GTKA 3JAMC 1RQ0A 2VRDA 2EOSA 2GPIA 2YRMA 2LCEA 2EOOA 3AV0A 4O4KA 4X8WA 2EQ1A 4WX9A 4WYQB 3ZOQB 1T4OA 2EN4A 2EPNA 3VHTB 2V86A 5A6AA 4BBYA 4F2JC 3BBGA 2K4VA 3C4BA 3UK3C 4BCAA 1MGTA 4JI5E 5AASA 2UUAE 2EMBA 1F2IG 4R8OA 2EOHA 3BIDA 4R2EA 2GLIA 5A2QC 4LF9E 3F6HA 4OOGC 2EM0A 4JI6E 1YSAC 2VF1A 3JTZA 3RMPA 2L2KB 5AC4A 4LF5E 4KZSA 1WJPA 2VQEE 2KHXA 1T39A 4IS1C 3ADJA 1KJKA 2EMIA 2BBGA 2ODRD 2YTPA
chains in the Genus database with same CATH topology
5IV8B 4RH8A 3BF2A 4N4RB 4Q35B 2N8XA 2R76A 4NHRA 4KWYA 5TSEA 2JXPA 5IXMB 4RHBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IV8 B;  4RH8 A;  3BF2 A;  4N4R B;  4Q35 B;  2N8X A;  2R76 A;  4NHR A;  4KWY A;  5TSE A;  2JXP A;  5IXM B;  4RHB B; 
#chains in the Genus database with same CATH topology
 5A69 A;  4Q28 A;  2EQ3 A;  4MLV A;  2UXB E;  3EQ1 A;  1SFE A;  2EM5 A;  2YTF A;  1A1K A;  2M7Q A;  2EOZ A;  3KZY A;  4WPY A;  4DR1 E;  5AC5 A;  1IMU A;  2JWO A;  4K0K E;  5KL5 A;  3IWB A;  4RHB B;  2JYA A;  1NCS A;  2L33 A;  4R2A A;  4BS9 A;  1G2D C;  1L4S A;  2YU5 A;  2WCC 3;  1N32 E;  1JK2 A;  1N3G A;  2WZO A;  4L8N A;  2EPR A;  1PJS A;  1IQS A;  1EH8 A;  5LMU E;  2F4V E;  3FIG A;  2L2M A;  2EMX A;  2B3T B;  3MSW A;  4LF8 E;  4DMI A;  2N3H A;  2VQF E;  2EJ4 A;  1PJT A;  1AH5 A;  3THN A;  4X66 E;  3OML A;  5KL4 A;  4B3S E;  3ADI A;  3P1X A;  4GZN C;  4DUZ E;  2FGG A;  1YFH A;  5AE1 A;  4ZYH A;  2EN7 A;  1YYW A;  1UBD C;  2EMZ A;  2Q8U A;  4R2S A;  5BR8 E;  4B3M E;  2LRS A;  5T6J A;  5F3W A;  1DI2 A;  4DV2 E;  2LUP B;  1QU6 A;  4DR3 E;  2LE2 A;  2L6M A;  1RMD A;  2RPC A;  1SR9 A;  2EPZ A;  2ENH A;  1UN6 B;  1TF6 A;  2YPN A;  5KL6 A;  2EP3 A;  1X6H A;  1J5E E;  3K6Q A;  2ODR C;  1XMO E;  1FJG E;  2DIX A;  2NUG A;  2YU8 A;  1G2F C;  5LMN E;  2EN6 A;  5TSE A;  2RSM A;  1Z1B A;  3BGH A;  1GQE A;  1GZ6 A;  5A6B A;  2H36 X;  2N8X A;  2B7V A;  1HNX E;  1ZBT A;  2IHR 1;  4F6N A;  1UIL A;  3ADL A;  1WHQ A;  2DSY A;  3VYY A;  1BBG A;  2DB2 A;  2EN3 A;  2YSO A;  4J8Z A;  1NEI A;  2EN8 A;  4WSP A;  4AQY E;  4DV5 E;  1PDA A;  4WFT A;  2V83 A;  2I9I A;  5ADZ A;  2ZM6 E;  4TUI A;  1TF3 A;  2EM7 A;  2EOY A;  2EZ6 A;  2YTG A;  4DKK A;  1IQO A;  2EOJ A;  4WXD A;  4HEI A;  2EPL X;  2V8Q B;  2YTQ A;  2DLQ A;  3KZZ A;  2KOU A;  2YRK A;  2YSP A;  4KHP E;  4GKK E;  1A1L A;  2LV2 A;  2EML A;  5IT9 C;  2L92 A;  2EL6 A;  2CT1 A;  4R2R A;  2LTR A;  2EMG A;  1PKP A;  5IWA E;  4GKJ E;  3HTX A;  2JVA A;  1N34 E;  2EM4 A;  1STU A;  2CTD A;  2HC5 A;  4O24 A;  1B69 A;  2JOX A;  5LL6 R;  1IBM E;  4OX9 E;  2EWL A;  1LLM C;  1IBK E;  1A1H A;  2JR1 A;  1FKA E;  2EOM A;  3HPZ A;  2EOR A;  4M2Z A;  1N36 E;  2ELY A;  3HPS A;  3M99 B;  2J7J A;  4MLQ A;  2CSH A;  1WRJ A;  2EMH A;  2N3G A;  3JU0 A;  3LLH A;  4GEQ B;  3J7A G;  2VE7 C;  2EMA A;  3TQM A;  4F9C B;  5AE2 A;  4JI3 E;  2EMY A;  2L8T A;  4P78 A;  5KL7 A;  2RSI A;  2EM6 A;  2L2N A;  4BMJ A;  2PRT A;  1X3C A;  1BBO A;  2CPN A;  2MKD A;  2UU9 E;  2YTN A;  4JI4 E;  1HNW E;  2KON A;  4LTY A;  4LFC E;  2DGC A;  4DR5 E;  4DUY E;  4F9B B;  1IBL E;  2UXD E;  2JY9 A;  3DJW A;  3IWD A;  4BC9 A;  2HHH E;  2EQ0 A;  2EM8 A;  1XMQ E;  2NUE A;  1MEY C;  2NUF A;  2NAB A;  1T4L B;  3J81 C;  2MKN A;  2B9D A;  4P7D A;  1ZAA C;  5KL3 A;  1DGC A;  1WXR A;  2YTI A;  2EN1 A;  1P47 A;  1O0W A;  5A6K A;  2YZT A;  1HNZ E;  2DMY A;  2LJH A;  2ELZ A;  1BB8 A;  4F6M A;  2A25 A;  4LU9 A;  2RTX A;  2D9H A;  2YTE A;  1JK1 A;  1YYK A;  1T4N A;  3C6K A;  4R2Q A;  1KYQ A;  3BF2 A;  2R1F A;  2EMF A;  2R76 A;  4IJD A;  2EE8 A;  4R2C A;  4M9V C;  4BHC A;  2ENC A;  2EPO A;  2L3J A;  3ADG A;  3ECR A;  2LT7 A;  4JI7 E;  2EPK X;  5A6B D;  2YTJ A;  5KL2 A;  1A1I A;  1QNT A;  2RQL A;  4B3T E;  2MDG A;  2EPM X;  2YT4 A;  3EPJ A;  2MC6 A;  2EM3 A;  3T1Y E;  1YUJ A;  2ENA A;  5A6J A;  5LLQ A;  2EPU A;  4DV0 E;  2YTD A;  4YHH E;  2JP9 A;  4DV1 E;  3L00 A;  4L5N C;  2V85 A;  1ZBQ A;  2JXP A;  1XNQ E;  2MC5 A;  4DR4 E;  2YRH A;  1A1J A;  2EMW A;  1YZ9 A;  4R2P A;  2EOE A;  4DR2 E;  2GHF A;  3C4T A;  2K7I A;  4B3R E;  4JYA E;  2RS7 A;  4X65 E;  1I94 E;  3QG5 C;  3LML A;  3DF6 A;  2WBU A;  4DV6 E;  1YUI A;  4HTG A;  3T1H E;  4JI1 E;  1X48 A;  4N4R B;  2E72 A;  1UHZ A;  4ZYG A;  3J7Y p;  4R2D A;  4F54 A;  4LF6 E;  2EM2 A;  1EH6 A;  2L3C A;  4F9A B;  4ZYD A;  4WXC A;  3OTO E;  2LJU A;  2JOB A;  4JI2 E;  2V87 A;  4BC7 A;  4TUG A;  1ZR9 A;  3HXL A;  1YYO A;  2EN2 A;  4DV4 E;  4DR7 E;  5IXM B;  4NXM E;  1X49 A;  1T38 A;  5CFF E;  2EMK A;  2LO3 A;  2EL5 A;  3MHS C;  5DNY A;  3AUZ A;  4LFB E;  2LTS A;  4X9J A;  4LF7 E;  4LF4 E;  2HGH A;  4KWY A;  1WHN A;  4DV3 E;  3VYX A;  3MHH C;  2UUB E;  1RC7 A;  2EM9 A;  3VK6 A;  1X47 A;  2BB8 A;  1X6F A;  4M30 A;  5FLX C;  3THO B;  5AE3 A;  2YWQ A;  2B7T A;  2WBT A;  2DRP A;  2UXC E;  4O5G A;  2EOQ A;  2LMZ A;  4DV7 E;  4ZYE A;  2LBS B;  2F8B A;  4JI8 E;  2E5L E;  2EMC A;  2EPX A;  4X64 E;  4BHB A;  4NXN E;  3EPH A;  4JV5 E;  1X5W A;  2V89 A;  4O43 A;  2EPC A;  2G7H A;  1EKZ A;  2EOF A;  2I13 A;  2ADR A;  5IV8 B;  1J26 A;  4X62 E;  1TN9 A;  4R03 A;  1X6E A;  2YTO A;  4FK5 C;  2V88 A;  4JI0 E;  3H09 A;  4NZV A;  3IWC A;  2M9A A;  4RH8 A;  1DQ3 A;  1YPN A;  2MDR A;  3HQ1 A;  2WBS A;  4WSG A;  2EPP A;  3F6G A;  2M4I A;  1EH7 A;  3J80 C;  2E1M A;  3C6M A;  4M0V A;  2LUQ A;  4I8O A;  4DR6 E;  2JPA A;  3EPK A;  2RS6 A;  4YY3 E;  2LVH A;  2DLK A;  2UUC E;  2HJJ A;  2M1S A;  2FV4 B;  4LFA E;  1XNR E;  2EPA A;  1AAY A;  1A1G A;  2EOI A;  1A1F A;  4Q35 B;  1HR0 E;  2FTX B;  3KWR A;  1PJQ A;  1ZU1 A;  2EL4 A;  2EOX A;  3EPL A;  2NA2 A;  4NHR A;  1N33 E;  2DMI A;  1GTK A;  3JAM C;  1RQ0 A;  2VRD A;  2EOS A;  2GPI A;  2YRM A;  2LCE A;  2EOO A;  3AV0 A;  4O4K A;  4X8W A;  2EQ1 A;  4WX9 A;  4WYQ B;  3ZOQ B;  1T4O A;  2EN4 A;  2EPN A;  3VHT B;  2V86 A;  5A6A A;  4BBY A;  4F2J C;  3BBG A;  2K4V A;  3C4B A;  3UK3 C;  4BCA A;  1MGT A;  4JI5 E;  5AAS A;  2UUA E;  2EMB A;  1F2I G;  4R8O A;  2EOH A;  3BID A;  4R2E A;  2GLI A;  5A2Q C;  4LF9 E;  3F6H A;  4OOG C;  2EM0 A;  4JI6 E;  1YSA C;  2VF1 A;  3JTZ A;  3RMP A;  2L2K B;  5AC4 A;  4LF5 E;  4KZS A;  1WJP A;  2VQE E;  2KHX A;  1T39 A;  4IS1 C;  3ADJ A;  1KJK A;  2EMI A;  2BBG A;  2ODR D;  2YTP A; 
#chains in the Genus database with same CATH homology
 5IV8 B;  4RH8 A;  3BF2 A;  4N4R B;  4Q35 B;  2N8X A;  2R76 A;  4NHR A;  4KWY A;  5TSE A;  2JXP A;  5IXM B;  4RHB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...