3BF2A

Crystal structure of the a1ksw9_neimf protein from neisseria meningitidis. northeast structural genomics consortium target mr36a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
125
Chain Sequence
LTYRSWHIEGGQALQFPLETALYQASGRVDDAAGAQMTLRIDSVSQNKETYTVTAVINEYLLILTVEAQVLKRGEPVGKPMTVSVRRVLAYADLGKQEEEAALWAEMRQDAAEQIVRRLTFLKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal structure of the A1KSW9_NEIMF protein from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis fam18
molecule tags Lipoprotein
total genus 24
structure length 125
sequence length 130
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 3bf2A00
5TSEA 4KWYA 5IXMB 4RH8A 5IV8B 4Q35B 3BF2A 4N4RB 2JXPA 4RHBB 2N8XA 2R76A 4NHRA
chains in the Genus database with same CATH superfamily
4B3TE 2EMGA 2EN6A 2UU9E 2RPCA 3T1HE 4DR1E 4WXDA 1EH7A 2LVHA 2EPNA 4O43A 4R2EA 3ADGA 2EPLX 1EKZA 4YY3E 1FKAE 2NUFA 1X6HA 2EE8A 5A6BD 2EPAA 2EOFA 3QG5C 4P7DA 1A1IA 2YTIA 4JI8E 4KWYA 1KYQA 5AC4A 2UUBE 5KL2A 1NCSA 2V86A 4LF8E 1PJQA 4R2PA 1I94E 4BBYA 4ZYEA 1ZAAC 5FLXC 4LF4E 4R2QA 5A6KA 5IXMB 2UUAE 2LE2A 2EM0A 1PJTA 1F2IG 3P1XA 4BMJA 1YUIA 2EPKX 4ZYHA 2V88A 2V83A 4DV1E 2EMFA 4TUGA 1YYKA 1YSAC 2YTGA 5LMNE 2EQ1A 2EOOA 5A6AA 3BGHA 2B7VA 1T4OA 2GHFA 5KL3A 2EL6A 3IWBA 1RMDA 3C4TA 1HNXE 3VYXA 4F9AB 1QNTA 2EL4A 4DV3E 2FTXB 2E72A 2EN1A 2YT4A 4M0VA 4DV4E 4LF5E 2VRDA 4MLVA 4DR7E 2EM9A 4M30A 2B9DA 2JVAA 2LMZA 2CPNA 1AAYA 4GKKE 2IHR1 3VHTB 4WPYA 1XMQE 1N32E 1B69A 1DGCA 2EN2A 2KHXA 4K0KE 2LBSB 2CSHA 2J7JA 5ADZA 4RH8A 1A1JA 1GQEA 1BBOA 1WHNA 1YYWA 5BR8E 2EM5A 4F54A 1EH6A 2DGCA 1SFEA 4O4KA 4DR2E 2MC5A 2L6MA 4TUIA 2DSYA 2LO3A 1XNRE 5KL5A 1TN9A 4GEQB 2ZM6E 3L00A 1YPNA 5LL6R 2LTRA 2EOMA 4DR5E 5T6JA 1N3GA 2DLKA 1GTKA 1NEIA 3TQMA 3BIDA 1WXRA 4R2AA 2EPMX 1IBME 2DB2A 4F9BB 2EM7A 3VYYA 4I8OA 3KWRA 4BCAA 1AH5A 4HTGA 4L8NA 2L33A 1KJKA 2MC6A 1YFHA 2DRPA 2DLQA 5IT9C 2WCC3 2RSIA 2ODRC 2V8QB 3KZYA 1IMUA 2EOZA 2R76A 4DV6E 4X8WA 2WBSA 1RQ0A 3LLHA 3THNA 4AQYE 4OX9E 2YTNA 1N36E 2NABA 2JY9A 4DR6E 2VF1A 3BF2A 4DV7E 4GZNC 4DR4E 1T4NA 4F6NA 2JWOA 4ZYGA 2EP3A 2WBUA 3ADJA 3JU0A 3OMLA 4X66E 2LV2A 4JI3E 5IV8B 2FV4B 2YSOA 1T4LB 2I9IA 2E1MA 2F8BA 2JYAA 2JR1A 5KL7A 4F2JC 1TF3A 3ECRA 2EOSA 1HNZE 2MDGA 3EPKA 4WFTA 4DUYE 4R2RA 2YTDA 1YZ9A 2EMBA 2M4IA 2GLIA 4GKJE 1MGTA 2EMLA 4JI7E 2F4VE 3ZOQB 2YRKA 1PDAA 2YU8A 2VQFE 4NXNE 1XNQE 4BHCA 1A1HA 2LUQA 2R1FA 3VK6A 5A69A 3M99B 4Q28A 3JAMC 3ADLA 2V85A 3J81C 4DV0E 2EMXA 3RMPA 3J7AG 3IWCA 3AV0A 4LFBE 1UBDC 3J7Yp 2RQLA 1ZR9A 3C6KA 2DIXA 2N8XA 2EN3A 4KHPE 4R8OA 2YZTA 2RSMA 1YYOA 5A2QC 1X47A 2EMWA 3EQ1A 3J80C 1T39A 1X6FA 2ENHA 3MHHC 4BS9A 1UHZA 2CT1A 1PKPA 2L2NA 2EWLA 3HQ1A 2BBGA 2HHHE 2N3HA 2EN8A 4O24A 2G7HA 3EPLA 2YTJA 4HEIA 4OOGC 1HR0E 2NA2A 5DNYA 3H09A 2UXCE 2YTEA 1L4SA 1X49A 4LFCE 2D9HA 4F9CB 5A6JA 2EOQA 2EMZA 4IS1C 5TSEA 2HGHA 2N3GA 3HXLA 3DJWA 5CFFE 2LCEA 4LF7E 2RS6A 4M2ZA 1YUJA 4M9VC 2JOXA 1UILA 2EOYA 2EMCA 5AE3A 4B3ME 4LU9A 2VQEE 3ADIA 4Q35B 3C4BA 1X5WA 1WJPA 4JI2E 2EM4A 3C6MA 2UUCE 3EPJA 2EM2A 2EN7A 2YTPA 4NXME 1WHQA 4WX9A 2HJJA 2M7QA 1RC7A 4JI0E 2EM8A 4BC9A 4JYAE 2EJ4A 2EPPA 2VE7C 2EPUA 2B7TA 1Z1BA 4NZVA 2Q8UA 4WYQB 1A1LA 1LLMC 1ZBQA 1EH8A 1IBKE 4B3SE 2EMYA 2UXDE 2M1SA 4LTYA 1X3CA 2RS7A 3JTZA 2K7IA 2L2MA 1WRJA 2EPCA 2KOUA 2YPNA 2A25A 1ZU1A 4LFAE 2EOHA 4DMIA 4JI6E 2M9AA 2RTXA 2L3JA 1X6EA 1O0WA 2DMIA 1X48A 2WZOA 1DQ3A 2L92A 2EL5A 5A6BA 4J8ZA 1DI2A 4BHBA 2EN4A 4R2CA 4MLQA 2EOIA 1J5EE 2EPXA 2ELYA 4JI5E 2LJUA 2L8TA 1HNWE 3MHSC 1BB8A 4DUZE 3F6HA 2LT7A 4X64E 2EM6A 4O5GA 4BC7A 4DR3E 1TF6A 3THOB 4DV2E 3FIGA 2EMHA 2YSPA 3HTXA 2YTFA 2EOXA 2UXBE 2YTQA 2V89A 5F3WA 1A1KA 2MKNA 5AC5A 2MDRA 2EMAA 1N33E 2WBTA 2EMKA 4N4RB 1IQOA 2HC5A 4B3RE 1ZBTA 1A1GA 2YWQA 2JP9A 3KZZA 1G2FC 4X65E 2EOJA 2JPAA 3UK3C 2EMIA 5IWAE 2K4VA 4R03A 2I13A 1SR9A 3HPSA 4NHRA 2E5LE 4F6MA 4IJDA 3T1YE 3HPZA 2LUPB 2EPZA 1T38A 4WXCA 2NUGA 1STUA 5KL4A 4L5NC 2NUEA 1A1FA 3BBGA 5LMUE 1G2DC 1FJGE 2H36X 3F6GA 3LMLA 4LF9E 2YU5A 2ODRD 5AE1A 1J26A 4KZSA 5KL6A 4WSGA 5AE2A 1PJSA 4X62E 2JOBA 2LJHA 4YHHE 4JV5E 3OTOE 2CTDA 3EPHA 2L3CA 2LTSA 1UN6B 1IQSA 4R2SA 1N34E 2EZ6A 1QU6A 1MEYC 2KONA 2DMYA 2MKDA 1JK2A 2JXPA 2YRMA 2GPIA 2BB8A 2B3TB 2ELZA 4JI1E 2EPRA 2ENAA 4ZYDA 2EPOA 1GZ6A 1IBLE 2YRHA 4WSPA 2ADRA 2FGGA 3DF6A 4R2DA 1JK1A 2EORA 1P47A 2EOEA 4JI4E 2LRSA 4P78A 4FK5C 2V87A 4X9JA 2ENCA 4DKKA 4LF6E 5AASA 5LLQA 3MSWA 3IWDA 2PRTA 2EM3A 4DV5E 1XMOE 2EQ3A 2EQ0A 3AUZA 1BBGA 2L2KB 4RHBB 3K6QA 2YTOA
chains in the Genus database with same CATH topology
5TSEA 4KWYA 5IXMB 4RH8A 5IV8B 4Q35B 3BF2A 4N4RB 2JXPA 4RHBB 2N8XA 2R76A 4NHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TSE A;  4KWY A;  5IXM B;  4RH8 A;  5IV8 B;  4Q35 B;  3BF2 A;  4N4R B;  2JXP A;  4RHB B;  2N8X A;  2R76 A;  4NHR A; 
#chains in the Genus database with same CATH topology
 4B3T E;  2EMG A;  2EN6 A;  2UU9 E;  2RPC A;  3T1H E;  4DR1 E;  4WXD A;  1EH7 A;  2LVH A;  2EPN A;  4O43 A;  4R2E A;  3ADG A;  2EPL X;  1EKZ A;  4YY3 E;  1FKA E;  2NUF A;  1X6H A;  2EE8 A;  5A6B D;  2EPA A;  2EOF A;  3QG5 C;  4P7D A;  1A1I A;  2YTI A;  4JI8 E;  4KWY A;  1KYQ A;  5AC4 A;  2UUB E;  5KL2 A;  1NCS A;  2V86 A;  4LF8 E;  1PJQ A;  4R2P A;  1I94 E;  4BBY A;  4ZYE A;  1ZAA C;  5FLX C;  4LF4 E;  4R2Q A;  5A6K A;  5IXM B;  2UUA E;  2LE2 A;  2EM0 A;  1PJT A;  1F2I G;  3P1X A;  4BMJ A;  1YUI A;  2EPK X;  4ZYH A;  2V88 A;  2V83 A;  4DV1 E;  2EMF A;  4TUG A;  1YYK A;  1YSA C;  2YTG A;  5LMN E;  2EQ1 A;  2EOO A;  5A6A A;  3BGH A;  2B7V A;  1T4O A;  2GHF A;  5KL3 A;  2EL6 A;  3IWB A;  1RMD A;  3C4T A;  1HNX E;  3VYX A;  4F9A B;  1QNT A;  2EL4 A;  4DV3 E;  2FTX B;  2E72 A;  2EN1 A;  2YT4 A;  4M0V A;  4DV4 E;  4LF5 E;  2VRD A;  4MLV A;  4DR7 E;  2EM9 A;  4M30 A;  2B9D A;  2JVA A;  2LMZ A;  2CPN A;  1AAY A;  4GKK E;  2IHR 1;  3VHT B;  4WPY A;  1XMQ E;  1N32 E;  1B69 A;  1DGC A;  2EN2 A;  2KHX A;  4K0K E;  2LBS B;  2CSH A;  2J7J A;  5ADZ A;  4RH8 A;  1A1J A;  1GQE A;  1BBO A;  1WHN A;  1YYW A;  5BR8 E;  2EM5 A;  4F54 A;  1EH6 A;  2DGC A;  1SFE A;  4O4K A;  4DR2 E;  2MC5 A;  2L6M A;  4TUI A;  2DSY A;  2LO3 A;  1XNR E;  5KL5 A;  1TN9 A;  4GEQ B;  2ZM6 E;  3L00 A;  1YPN A;  5LL6 R;  2LTR A;  2EOM A;  4DR5 E;  5T6J A;  1N3G A;  2DLK A;  1GTK A;  1NEI A;  3TQM A;  3BID A;  1WXR A;  4R2A A;  2EPM X;  1IBM E;  2DB2 A;  4F9B B;  2EM7 A;  3VYY A;  4I8O A;  3KWR A;  4BCA A;  1AH5 A;  4HTG A;  4L8N A;  2L33 A;  1KJK A;  2MC6 A;  1YFH A;  2DRP A;  2DLQ A;  5IT9 C;  2WCC 3;  2RSI A;  2ODR C;  2V8Q B;  3KZY A;  1IMU A;  2EOZ A;  2R76 A;  4DV6 E;  4X8W A;  2WBS A;  1RQ0 A;  3LLH A;  3THN A;  4AQY E;  4OX9 E;  2YTN A;  1N36 E;  2NAB A;  2JY9 A;  4DR6 E;  2VF1 A;  3BF2 A;  4DV7 E;  4GZN C;  4DR4 E;  1T4N A;  4F6N A;  2JWO A;  4ZYG A;  2EP3 A;  2WBU A;  3ADJ A;  3JU0 A;  3OML A;  4X66 E;  2LV2 A;  4JI3 E;  5IV8 B;  2FV4 B;  2YSO A;  1T4L B;  2I9I A;  2E1M A;  2F8B A;  2JYA A;  2JR1 A;  5KL7 A;  4F2J C;  1TF3 A;  3ECR A;  2EOS A;  1HNZ E;  2MDG A;  3EPK A;  4WFT A;  4DUY E;  4R2R A;  2YTD A;  1YZ9 A;  2EMB A;  2M4I A;  2GLI A;  4GKJ E;  1MGT A;  2EML A;  4JI7 E;  2F4V E;  3ZOQ B;  2YRK A;  1PDA A;  2YU8 A;  2VQF E;  4NXN E;  1XNQ E;  4BHC A;  1A1H A;  2LUQ A;  2R1F A;  3VK6 A;  5A69 A;  3M99 B;  4Q28 A;  3JAM C;  3ADL A;  2V85 A;  3J81 C;  4DV0 E;  2EMX A;  3RMP A;  3J7A G;  3IWC A;  3AV0 A;  4LFB E;  1UBD C;  3J7Y p;  2RQL A;  1ZR9 A;  3C6K A;  2DIX A;  2N8X A;  2EN3 A;  4KHP E;  4R8O A;  2YZT A;  2RSM A;  1YYO A;  5A2Q C;  1X47 A;  2EMW A;  3EQ1 A;  3J80 C;  1T39 A;  1X6F A;  2ENH A;  3MHH C;  4BS9 A;  1UHZ A;  2CT1 A;  1PKP A;  2L2N A;  2EWL A;  3HQ1 A;  2BBG A;  2HHH E;  2N3H A;  2EN8 A;  4O24 A;  2G7H A;  3EPL A;  2YTJ A;  4HEI A;  4OOG C;  1HR0 E;  2NA2 A;  5DNY A;  3H09 A;  2UXC E;  2YTE A;  1L4S A;  1X49 A;  4LFC E;  2D9H A;  4F9C B;  5A6J A;  2EOQ A;  2EMZ A;  4IS1 C;  5TSE A;  2HGH A;  2N3G A;  3HXL A;  3DJW A;  5CFF E;  2LCE A;  4LF7 E;  2RS6 A;  4M2Z A;  1YUJ A;  4M9V C;  2JOX A;  1UIL A;  2EOY A;  2EMC A;  5AE3 A;  4B3M E;  4LU9 A;  2VQE E;  3ADI A;  4Q35 B;  3C4B A;  1X5W A;  1WJP A;  4JI2 E;  2EM4 A;  3C6M A;  2UUC E;  3EPJ A;  2EM2 A;  2EN7 A;  2YTP A;  4NXM E;  1WHQ A;  4WX9 A;  2HJJ A;  2M7Q A;  1RC7 A;  4JI0 E;  2EM8 A;  4BC9 A;  4JYA E;  2EJ4 A;  2EPP A;  2VE7 C;  2EPU A;  2B7T A;  1Z1B A;  4NZV A;  2Q8U A;  4WYQ B;  1A1L A;  1LLM C;  1ZBQ A;  1EH8 A;  1IBK E;  4B3S E;  2EMY A;  2UXD E;  2M1S A;  4LTY A;  1X3C A;  2RS7 A;  3JTZ A;  2K7I A;  2L2M A;  1WRJ A;  2EPC A;  2KOU A;  2YPN A;  2A25 A;  1ZU1 A;  4LFA E;  2EOH A;  4DMI A;  4JI6 E;  2M9A A;  2RTX A;  2L3J A;  1X6E A;  1O0W A;  2DMI A;  1X48 A;  2WZO A;  1DQ3 A;  2L92 A;  2EL5 A;  5A6B A;  4J8Z A;  1DI2 A;  4BHB A;  2EN4 A;  4R2C A;  4MLQ A;  2EOI A;  1J5E E;  2EPX A;  2ELY A;  4JI5 E;  2LJU A;  2L8T A;  1HNW E;  3MHS C;  1BB8 A;  4DUZ E;  3F6H A;  2LT7 A;  4X64 E;  2EM6 A;  4O5G A;  4BC7 A;  4DR3 E;  1TF6 A;  3THO B;  4DV2 E;  3FIG A;  2EMH A;  2YSP A;  3HTX A;  2YTF A;  2EOX A;  2UXB E;  2YTQ A;  2V89 A;  5F3W A;  1A1K A;  2MKN A;  5AC5 A;  2MDR A;  2EMA A;  1N33 E;  2WBT A;  2EMK A;  4N4R B;  1IQO A;  2HC5 A;  4B3R E;  1ZBT A;  1A1G A;  2YWQ A;  2JP9 A;  3KZZ A;  1G2F C;  4X65 E;  2EOJ A;  2JPA A;  3UK3 C;  2EMI A;  5IWA E;  2K4V A;  4R03 A;  2I13 A;  1SR9 A;  3HPS A;  4NHR A;  2E5L E;  4F6M A;  4IJD A;  3T1Y E;  3HPZ A;  2LUP B;  2EPZ A;  1T38 A;  4WXC A;  2NUG A;  1STU A;  5KL4 A;  4L5N C;  2NUE A;  1A1F A;  3BBG A;  5LMU E;  1G2D C;  1FJG E;  2H36 X;  3F6G A;  3LML A;  4LF9 E;  2YU5 A;  2ODR D;  5AE1 A;  1J26 A;  4KZS A;  5KL6 A;  4WSG A;  5AE2 A;  1PJS A;  4X62 E;  2JOB A;  2LJH A;  4YHH E;  4JV5 E;  3OTO E;  2CTD A;  3EPH A;  2L3C A;  2LTS A;  1UN6 B;  1IQS A;  4R2S A;  1N34 E;  2EZ6 A;  1QU6 A;  1MEY C;  2KON A;  2DMY A;  2MKD A;  1JK2 A;  2JXP A;  2YRM A;  2GPI A;  2BB8 A;  2B3T B;  2ELZ A;  4JI1 E;  2EPR A;  2ENA A;  4ZYD A;  2EPO A;  1GZ6 A;  1IBL E;  2YRH A;  4WSP A;  2ADR A;  2FGG A;  3DF6 A;  4R2D A;  1JK1 A;  2EOR A;  1P47 A;  2EOE A;  4JI4 E;  2LRS A;  4P78 A;  4FK5 C;  2V87 A;  4X9J A;  2ENC A;  4DKK A;  4LF6 E;  5AAS A;  5LLQ A;  3MSW A;  3IWD A;  2PRT A;  2EM3 A;  4DV5 E;  1XMO E;  2EQ3 A;  2EQ0 A;  3AUZ A;  1BBG A;  2L2K B;  4RHB B;  3K6Q A;  2YTO A; 
#chains in the Genus database with same CATH homology
 5TSE A;  4KWY A;  5IXM B;  4RH8 A;  5IV8 B;  4Q35 B;  3BF2 A;  4N4R B;  2JXP A;  4RHB B;  2N8X A;  2R76 A;  4NHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...