3BF2A

Crystal structure of the a1ksw9_neimf protein from neisseria meningitidis. northeast structural genomics consortium target mr36a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
125
Chain Sequence
LTYRSWHIEGGQALQFPLETALYQASGRVDDAAGAQMTLRIDSVSQNKETYTVTAVINEYLLILTVEAQVLKRGEPVGKPMTVSVRRVLAYADLGKQEEEAALWAEMRQDAAEQIVRRLTFLKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipoprotein
molecule keywords Putative lipoprotein
publication title Crystal structure of the A1KSW9_NEIMF protein from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis fam18
total genus 24
structure length 125
sequence length 130
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 3bf2A00
4NHRA 2N8XA 4N4RB 3BF2A 2R76A 5IV8B 4RH8A 4Q35B 4RHBB 5TSEA 4KWYA 2JXPA 5IXMB
chains in the Genus database with same CATH superfamily
2EMAA 2GHFA 2EJ4A 1T4NA 1B69A 2EQ0A 2LTSA 3FIGA 4F9CB 2EMBA 2DSYA 4JI4E 1ZBTA 4HEIA 4DR6E 2CSHA 2EMHA 1T38A 2V87A 1AAYA 2GPIA 1HNZE 3LMLA 3ZOQB 2YWQA 2EOFA 4LTYA 3EPLA 1DGCA 2UU9E 1HNWE 1BBGA 1BBOA 5AC4A 2EM6A 2PRTA 2EOEA 1MEYC 1WXRA 4JI3E 2UUBE 2YTIA 2EN3A 2RPCA 2EOIA 2LE2A 2EOSA 2ODRD 2EM9A 4M30A 4R2PA 3J7Yp 2ODRC 1IBLE 2ZM6E 4BCAA 1PKPA 2ELYA 2DLKA 4KZSA 4R2DA 2EOOA 2EE8A 2EN6A 2KOUA 2J7JA 1ZAAC 5KL3A 1TF6A 1RMDA 2EMFA 4LFAE 1FJGE 4B3ME 3F6GA 3TQMA 4WFTA 4GEQB 2YRHA 3T1YE 3J7AG 2JYAA 5AE3A 3BF2A 2EN2A 2N3HA 2EPCA 2VQEE 4IS1C 2EM0A 2NUEA 3M99B 1YYOA 4JV5E 2YTQA 4F9BB 3F6HA 4IJDA 5KL2A 4X9JA 2B7VA 2KONA 1NEIA 4R03A 1YZ9A 1X49A 2EPOA 4LF8E 1HR0E 2JPAA 4B3RE 1T4OA 2YRMA 1EH7A 2CTDA 2NABA 4AQYE 4MLQA 2EMZA 2EOYA 3KWRA 5AE1A 2JWOA 1L4SA 5AASA 3VK6A 1J5EE 3VHTB 4R2QA 4X66E 3VYYA 1XMOE 2N8XA 1YSAC 4NXNE 3K6QA 2JY9A 5IXMB 5CFFE 4X8WA 2EL4A 3AV0A 2V85A 3VYXA 1X6EA 5BR8E 1DI2A 2B3TB 4N4RB 1XNQE 2YTNA 2EMIA 2RQLA 1Z1BA 4DR7E 1YPNA 2JP9A 2MKNA 2CT1A 1O0WA 4WXDA 4K0KE 3ECRA 1X48A 4O24A 4ZYEA 1YUJA 2ENAA 2V8QB 2L92A 2YTGA 4WPYA 4Q35B 3EQ1A 1ZR9A 4DV0E 4DMIA 2ENHA 4P7DA 4LF5E 2ELZA 3P1XA 1UHZA 5A6JA 1KJKA 4F2JC 4TUIA 4GKKE 2M9AA 2MC5A 1YFHA 1F2IG 2F8BA 5KL6A 4WSGA 2EOHA 3RMPA 4ZYHA 2L2KB 1GTKA 3ADGA 3IWCA 2YZTA 4R2CA 4OOGC 4B3TE 1UBDC 1LLMC 2MC6A 4LF7E 1WHNA 2EP3A 4OX9E 1RQ0A 1ZU1A 3ADLA 2LUQA 3EPJA 1BB8A 1X6HA 2K4VA 1IQSA 2RSMA 2V83A 2YTJA 2L3JA 1A1GA 2EMLA 2EMWA 3C6MA 4DUZE 2N3GA 1YUIA 2DMYA 4ZYDA 2R1FA 2D9HA 1RC7A 2DGCA 4JI5E 5FLXC 2Q8UA 4BBYA 2L6MA 2EM5A 2EPZA 1YYKA 4DV5E 1YYWA 4JI0E 4RH8A 4WYQB 4MLVA 3L00A 2EMYA 4I8OA 4TUGA 3IWDA 2GLIA 2MDGA 4DR5E 2EQ3A 1JK1A 4ZYGA 2UXBE 3JU0A 4LF4E 2YTFA 4M2ZA 5T6JA 2ADRA 3BBGA 3DF6A 1WJPA 3THNA 5A6BD 3MSWA 2JVAA 2EN4A 4BHCA 4LFBE 4DR4E 2LCEA 5IWAE 2L33A 1A1JA 1WHQA 4R8OA 3J80C 1N32E 2E72A 2G7HA 2EOJA 2FGGA 4LFCE 2WZOA 4YY3E 4DV2E 2EPNA 2EPLX 2JXPA 1N36E 1PJQA 4BS9A 2DLQA 2M4IA 2YTDA 3LLHA 3C6KA 4YHHE 2V89A 3C4TA 1IBME 3C4BA 2EM7A 2MKDA 1J26A 1PDAA 2ENCA 4BC7A 2UUCE 4DKKA 4KHPE 5A6BA 1DQ3A 5ADZA 5A69A 4X62E 1N33E 4R2RA 2MDRA 2LVHA 4BMJA 3BIDA 2LO3A 4DV3E 5LMUE 1TF3A 5IV8B 2UXDE 1STUA 2YRKA 3JAMC 4O5GA 1TN9A 2EPAA 4JYAE 2VF1A 2EOZA 1I94E 3MHHC 2BB8A 1UN6B 1IBKE 1QNTA 2A25A 5LMNE 2EOMA 2JOBA 4NXME 3EPKA 2EMGA 2LBSB 4X64E 2B9DA 2WBUA 2YT4A 4JI6E 2JOXA 4JI1E 2EZ6A 2DB2A 2LT7A 1FKAE 4F6NA 1GQEA 2FTXB 4O4KA 3OMLA 2EN7A 2H36X 1N34E 2WBTA 1EH8A 4R2SA 2EM2A 4GZNC 2EOQA 2YPNA 3HXLA 4RHBB 2EM3A 4FK5C 4P78A 1IQOA 2L2MA 4LU9A 2WBSA 1KYQA 1HNXE 1SR9A 2EPKX 2YTPA 1XNRE 2EM4A 1A1IA 1A1LA 2IHR1 2NUFA 4DUYE 2UUAE 2V88A 4X65E 1X3CA 4DV7E 2LRSA 3HTXA 2EMCA 5LL6R 2EM8A 4WXCA 1PJSA 1PJTA 2R76A 3MHSC 4BC9A 4DV6E 2VE7C 5F3WA 2YSPA 4NHRA 5KL7A 3ADJA 4JI7E 2LJHA 3OTOE 2EORA 1JK2A 1WRJA 2K7IA 2L8TA 2YTEA 1T39A 2V86A 4B3SE 2EN1A 2LV2A 1A1KA 1G2FC 1SFEA 1X47A 3T1HE 1ZBQA 3IWBA 3UK3C 1GZ6A 4J8ZA 4M0VA 2L3CA 4HTGA 3HQ1A 4BHBA 3DJWA 4DR3E 2NUGA 1EH6A 4LF6E 2YU5A 2EN8A 2EMXA 2HC5A 2EPUA 3ADIA 3HPZA 1N3GA 4F9AB 2F4VE 2FV4B 2LJUA 4KWYA 2E5LE 4F6MA 1X5WA 4R2AA 4L8NA 4F54A 5AE2A 2HHHE 5IT9C 2LMZA 2CPNA 3AUZA 3H09A 5LLQA 2RS7A 5DNYA 3BGHA 1A1HA 5KL5A 4NZVA 1NCSA 2B7TA 3HPSA 2I13A 2EL5A 4M9VC 2DIXA 4JI2E 3KZYA 4DV1E 2E1MA 3QG5C 1IMUA 4DR2E 1A1FA 5KL4A 2EPMX 3EPHA 2YSOA 2YTOA 2I9IA 2EWLA 1P47A 1T4LB 1QU6A 2RTXA 2BBGA 2WCC3 2KHXA 4JI8E 4WSPA 2RSIA 2LTRA 2LUPB 1X6FA 2DMIA 2RS6A 2EPXA 1G2DC 5A6KA 4O43A 4WX9A 1UILA 2EOXA 2HJJA 2EMKA 1EKZA 2HGHA 2UXCE 2EPRA 3KZZA 3JTZA 1MGTA 5A2QC 3J81C 1AH5A 1XMQE 2VRDA 2VQFE 2YU8A 4Q28A 4R2EA 4LF9E 4DV4E 2EQ1A 4DR1E 2NA2A 5TSEA 2M7QA 4L5NC 2L2NA 2M1SA 5AC5A 2DRPA 2EPPA 2EL6A 5A6AA 4GKJE 3THOB 2JR1A
chains in the Genus database with same CATH topology
4NHRA 2N8XA 4N4RB 3BF2A 2R76A 5IV8B 4RH8A 4Q35B 4RHBB 5TSEA 4KWYA 2JXPA 5IXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHR A;  2N8X A;  4N4R B;  3BF2 A;  2R76 A;  5IV8 B;  4RH8 A;  4Q35 B;  4RHB B;  5TSE A;  4KWY A;  2JXP A;  5IXM B; 
#chains in the Genus database with same CATH topology
 2EMA A;  2GHF A;  2EJ4 A;  1T4N A;  1B69 A;  2EQ0 A;  2LTS A;  3FIG A;  4F9C B;  2EMB A;  2DSY A;  4JI4 E;  1ZBT A;  4HEI A;  4DR6 E;  2CSH A;  2EMH A;  1T38 A;  2V87 A;  1AAY A;  2GPI A;  1HNZ E;  3LML A;  3ZOQ B;  2YWQ A;  2EOF A;  4LTY A;  3EPL A;  1DGC A;  2UU9 E;  1HNW E;  1BBG A;  1BBO A;  5AC4 A;  2EM6 A;  2PRT A;  2EOE A;  1MEY C;  1WXR A;  4JI3 E;  2UUB E;  2YTI A;  2EN3 A;  2RPC A;  2EOI A;  2LE2 A;  2EOS A;  2ODR D;  2EM9 A;  4M30 A;  4R2P A;  3J7Y p;  2ODR C;  1IBL E;  2ZM6 E;  4BCA A;  1PKP A;  2ELY A;  2DLK A;  4KZS A;  4R2D A;  2EOO A;  2EE8 A;  2EN6 A;  2KOU A;  2J7J A;  1ZAA C;  5KL3 A;  1TF6 A;  1RMD A;  2EMF A;  4LFA E;  1FJG E;  4B3M E;  3F6G A;  3TQM A;  4WFT A;  4GEQ B;  2YRH A;  3T1Y E;  3J7A G;  2JYA A;  5AE3 A;  3BF2 A;  2EN2 A;  2N3H A;  2EPC A;  2VQE E;  4IS1 C;  2EM0 A;  2NUE A;  3M99 B;  1YYO A;  4JV5 E;  2YTQ A;  4F9B B;  3F6H A;  4IJD A;  5KL2 A;  4X9J A;  2B7V A;  2KON A;  1NEI A;  4R03 A;  1YZ9 A;  1X49 A;  2EPO A;  4LF8 E;  1HR0 E;  2JPA A;  4B3R E;  1T4O A;  2YRM A;  1EH7 A;  2CTD A;  2NAB A;  4AQY E;  4MLQ A;  2EMZ A;  2EOY A;  3KWR A;  5AE1 A;  2JWO A;  1L4S A;  5AAS A;  3VK6 A;  1J5E E;  3VHT B;  4R2Q A;  4X66 E;  3VYY A;  1XMO E;  2N8X A;  1YSA C;  4NXN E;  3K6Q A;  2JY9 A;  5IXM B;  5CFF E;  4X8W A;  2EL4 A;  3AV0 A;  2V85 A;  3VYX A;  1X6E A;  5BR8 E;  1DI2 A;  2B3T B;  4N4R B;  1XNQ E;  2YTN A;  2EMI A;  2RQL A;  1Z1B A;  4DR7 E;  1YPN A;  2JP9 A;  2MKN A;  2CT1 A;  1O0W A;  4WXD A;  4K0K E;  3ECR A;  1X48 A;  4O24 A;  4ZYE A;  1YUJ A;  2ENA A;  2V8Q B;  2L92 A;  2YTG A;  4WPY A;  4Q35 B;  3EQ1 A;  1ZR9 A;  4DV0 E;  4DMI A;  2ENH A;  4P7D A;  4LF5 E;  2ELZ A;  3P1X A;  1UHZ A;  5A6J A;  1KJK A;  4F2J C;  4TUI A;  4GKK E;  2M9A A;  2MC5 A;  1YFH A;  1F2I G;  2F8B A;  5KL6 A;  4WSG A;  2EOH A;  3RMP A;  4ZYH A;  2L2K B;  1GTK A;  3ADG A;  3IWC A;  2YZT A;  4R2C A;  4OOG C;  4B3T E;  1UBD C;  1LLM C;  2MC6 A;  4LF7 E;  1WHN A;  2EP3 A;  4OX9 E;  1RQ0 A;  1ZU1 A;  3ADL A;  2LUQ A;  3EPJ A;  1BB8 A;  1X6H A;  2K4V A;  1IQS A;  2RSM A;  2V83 A;  2YTJ A;  2L3J A;  1A1G A;  2EML A;  2EMW A;  3C6M A;  4DUZ E;  2N3G A;  1YUI A;  2DMY A;  4ZYD A;  2R1F A;  2D9H A;  1RC7 A;  2DGC A;  4JI5 E;  5FLX C;  2Q8U A;  4BBY A;  2L6M A;  2EM5 A;  2EPZ A;  1YYK A;  4DV5 E;  1YYW A;  4JI0 E;  4RH8 A;  4WYQ B;  4MLV A;  3L00 A;  2EMY A;  4I8O A;  4TUG A;  3IWD A;  2GLI A;  2MDG A;  4DR5 E;  2EQ3 A;  1JK1 A;  4ZYG A;  2UXB E;  3JU0 A;  4LF4 E;  2YTF A;  4M2Z A;  5T6J A;  2ADR A;  3BBG A;  3DF6 A;  1WJP A;  3THN A;  5A6B D;  3MSW A;  2JVA A;  2EN4 A;  4BHC A;  4LFB E;  4DR4 E;  2LCE A;  5IWA E;  2L33 A;  1A1J A;  1WHQ A;  4R8O A;  3J80 C;  1N32 E;  2E72 A;  2G7H A;  2EOJ A;  2FGG A;  4LFC E;  2WZO A;  4YY3 E;  4DV2 E;  2EPN A;  2EPL X;  2JXP A;  1N36 E;  1PJQ A;  4BS9 A;  2DLQ A;  2M4I A;  2YTD A;  3LLH A;  3C6K A;  4YHH E;  2V89 A;  3C4T A;  1IBM E;  3C4B A;  2EM7 A;  2MKD A;  1J26 A;  1PDA A;  2ENC A;  4BC7 A;  2UUC E;  4DKK A;  4KHP E;  5A6B A;  1DQ3 A;  5ADZ A;  5A69 A;  4X62 E;  1N33 E;  4R2R A;  2MDR A;  2LVH A;  4BMJ A;  3BID A;  2LO3 A;  4DV3 E;  5LMU E;  1TF3 A;  5IV8 B;  2UXD E;  1STU A;  2YRK A;  3JAM C;  4O5G A;  1TN9 A;  2EPA A;  4JYA E;  2VF1 A;  2EOZ A;  1I94 E;  3MHH C;  2BB8 A;  1UN6 B;  1IBK E;  1QNT A;  2A25 A;  5LMN E;  2EOM A;  2JOB A;  4NXM E;  3EPK A;  2EMG A;  2LBS B;  4X64 E;  2B9D A;  2WBU A;  2YT4 A;  4JI6 E;  2JOX A;  4JI1 E;  2EZ6 A;  2DB2 A;  2LT7 A;  1FKA E;  4F6N A;  1GQE A;  2FTX B;  4O4K A;  3OML A;  2EN7 A;  2H36 X;  1N34 E;  2WBT A;  1EH8 A;  4R2S A;  2EM2 A;  4GZN C;  2EOQ A;  2YPN A;  3HXL A;  4RHB B;  2EM3 A;  4FK5 C;  4P78 A;  1IQO A;  2L2M A;  4LU9 A;  2WBS A;  1KYQ A;  1HNX E;  1SR9 A;  2EPK X;  2YTP A;  1XNR E;  2EM4 A;  1A1I A;  1A1L A;  2IHR 1;  2NUF A;  4DUY E;  2UUA E;  2V88 A;  4X65 E;  1X3C A;  4DV7 E;  2LRS A;  3HTX A;  2EMC A;  5LL6 R;  2EM8 A;  4WXC A;  1PJS A;  1PJT A;  2R76 A;  3MHS C;  4BC9 A;  4DV6 E;  2VE7 C;  5F3W A;  2YSP A;  4NHR A;  5KL7 A;  3ADJ A;  4JI7 E;  2LJH A;  3OTO E;  2EOR A;  1JK2 A;  1WRJ A;  2K7I A;  2L8T A;  2YTE A;  1T39 A;  2V86 A;  4B3S E;  2EN1 A;  2LV2 A;  1A1K A;  1G2F C;  1SFE A;  1X47 A;  3T1H E;  1ZBQ A;  3IWB A;  3UK3 C;  1GZ6 A;  4J8Z A;  4M0V A;  2L3C A;  4HTG A;  3HQ1 A;  4BHB A;  3DJW A;  4DR3 E;  2NUG A;  1EH6 A;  4LF6 E;  2YU5 A;  2EN8 A;  2EMX A;  2HC5 A;  2EPU A;  3ADI A;  3HPZ A;  1N3G A;  4F9A B;  2F4V E;  2FV4 B;  2LJU A;  4KWY A;  2E5L E;  4F6M A;  1X5W A;  4R2A A;  4L8N A;  4F54 A;  5AE2 A;  2HHH E;  5IT9 C;  2LMZ A;  2CPN A;  3AUZ A;  3H09 A;  5LLQ A;  2RS7 A;  5DNY A;  3BGH A;  1A1H A;  5KL5 A;  4NZV A;  1NCS A;  2B7T A;  3HPS A;  2I13 A;  2EL5 A;  4M9V C;  2DIX A;  4JI2 E;  3KZY A;  4DV1 E;  2E1M A;  3QG5 C;  1IMU A;  4DR2 E;  1A1F A;  5KL4 A;  2EPM X;  3EPH A;  2YSO A;  2YTO A;  2I9I A;  2EWL A;  1P47 A;  1T4L B;  1QU6 A;  2RTX A;  2BBG A;  2WCC 3;  2KHX A;  4JI8 E;  4WSP A;  2RSI A;  2LTR A;  2LUP B;  1X6F A;  2DMI A;  2RS6 A;  2EPX A;  1G2D C;  5A6K A;  4O43 A;  4WX9 A;  1UIL A;  2EOX A;  2HJJ A;  2EMK A;  1EKZ A;  2HGH A;  2UXC E;  2EPR A;  3KZZ A;  3JTZ A;  1MGT A;  5A2Q C;  3J81 C;  1AH5 A;  1XMQ E;  2VRD A;  2VQF E;  2YU8 A;  4Q28 A;  4R2E A;  4LF9 E;  4DV4 E;  2EQ1 A;  4DR1 E;  2NA2 A;  5TSE A;  2M7Q A;  4L5N C;  2L2N A;  2M1S A;  5AC5 A;  2DRP A;  2EPP A;  2EL6 A;  5A6A A;  4GKJ E;  3THO B;  2JR1 A; 
#chains in the Genus database with same CATH homology
 4NHR A;  2N8X A;  4N4R B;  3BF2 A;  2R76 A;  5IV8 B;  4RH8 A;  4Q35 B;  4RHB B;  5TSE A;  4KWY A;  2JXP A;  5IXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...