3BF2A

Crystal structure of the a1ksw9_neimf protein from neisseria meningitidis. northeast structural genomics consortium target mr36a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
130
structure length
125
Chain Sequence
LTYRSWHIEGGQALQFPLETALYQASGRVDDAAGAQMTLRIDSVSQNKETYTVTAVINEYLLILTVEAQVLKRGEPVGKPMTVSVRRVLAYADLGKQEEEAALWAEMRQDAAEQIVRRLTFLKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal structure of the A1KSW9_NEIMF protein from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis fam18
molecule tags Lipoprotein
total genus 24
structure length 125
sequence length 130
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 3bf2A00
5TSEA 5IV8B 4RH8A 4Q35B 4RHBB 4N4RB 4KWYA 4NHRA 3BF2A 2N8XA 5IXMB 2R76A 2JXPA
chains in the Genus database with same CATH superfamily
4LTYA 2EL6A 2B3TB 2GHFA 2LBSB 2EMBA 4X64E 4DUYE 2DIXA 2HC5A 3J80C 4F9CB 2EOMA 2MDRA 2UUCE 1DQ3A 4R2QA 2FV4B 2DB2A 3LLHA 2FGGA 2JR1A 1XNRE 2JXPA 1X6FA 2LT7A 2YTNA 1X3CA 1UHZA 1A1HA 4NXME 4B3RE 3VHTB 2UXBE 4WXDA 1IQOA 1N33E 4ZYGA 4JI4E 4M9VC 4B3SE 5KL7A 2E72A 4M0VA 1N3GA 1IQSA 4DR5E 5KL4A 2B7TA 4JV5E 4LF7E 4ZYHA 2EWLA 2EM5A 3OTOE 4LFCE 1ZBTA 1EKZA 4R2RA 1BB8A 2DMIA 1ZAAC 4BMJA 2V87A 3MSWA 3DF6A 2JP9A 1XNQE 1YUJA 5IWAE 4JI5E 1NCSA 1LLMC 4B3TE 2EOQA 5LLQA 2MKNA 1A1LA 3VYYA 1XMOE 2YRKA 4BC9A 4DV0E 5A6JA 2NA2A 3K6QA 1UBDC 2LJUA 1FKAE 2YTGA 2NUGA 4ZYEA 5IXMB 2UUAE 4DR7E 2YSOA 2YTQA 2L3JA 1J26A 1GQEA 2EPNA 2ODRD 1A1KA 2RS6A 1WXRA 4YHHE 2Q8UA 4DR3E 2EQ0A 3ZOQB 3C6MA 4WYQB 3MHHC 3ADLA 1SR9A 1KYQA 2LJHA 4X62E 4HTGA 4O5GA 3IWCA 2L2KB 2EQ3A 3ADGA 3AV0A 2YTEA 1GTKA 4DV2E 4BHCA 1YYWA 1QU6A 2EPPA 2EOYA 3AUZA 4OOGC 3KWRA 2EM7A 2EMGA 1JK1A 2IHR1 2JWOA 2HGHA 2LUPB 2M7QA 2EM6A 2R1FA 4LF6E 2UXDE 1BBGA 4DV7E 1IMUA 2LVHA 4GKKE 5AC4A 5A6AA 3MHSC 5KL5A 2YTOA 1J5EE 4Q35B 2VE7C 1MEYC 2KONA 2B9DA 3C6KA 4RHBB 2V89A 5LMUE 1HNXE 4BC7A 2ADRA 3J7AG 2EOEA 3ECRA 4JI3E 2EN3A 4R2AA 4KHPE 2EN6A 2MDGA 1X6EA 5F3WA 2EJ4A 1YYKA 2EPMX 1HR0E 3ADIA 1ZR9A 4TUIA 1T4LB 2ZM6E 5DNYA 2YTPA 2EMXA 2JOXA 2EN8A 2DSYA 2VRDA 2EM4A 2EPZA 3OMLA 2CT1A 4DV4E 2BBGA 2CSHA 3VYXA 2NUEA 5CFFE 2EMYA 3J81C 2EMFA 3J7Yp 1A1FA 1A1JA 1X5WA 4GEQB 2MC5A 2HJJA 3JU0A 2PRTA 4M30A 1PJQA 2YTJA 2L92A 1ZBQA 1PJTA 3BBGA 2V88A 2YTIA 2JYAA 3BF2A 2UU9E 1WRJA 1EH6A 2KOUA 2RS7A 2JPAA 2N3GA 1N36E 1B69A 4R2PA 2EPKX 2DMYA 3HPSA 4RH8A 4X9JA 4NZVA 4BCAA 1IBLE 1AAYA 1RMDA 2VF1A 2EOJA 2GPIA 3FIGA 2DLQA 5BR8E 1HNWE 4WSGA 4B3ME 1YYOA 2YTFA 1T4OA 3JAMC 2EMAA 2EMIA 3F6GA 4NHRA 4LF9E 4DV5E 4IJDA 2LRSA 2EP3A 2UUBE 2L3CA 4BS9A 2EMZA 2EOHA 4R2SA 4TUGA 2I13A 1I94E 5TSEA 1WJPA 4N4RB 4LF4E 2VQFE 1L4SA 2EM2A 2I9IA 2EM8A 4WSPA 3THOB 5AE3A 4YY3E 1Z1BA 3ADJA 2LE2A 2LMZA 5AE2A 3C4TA 3JTZA 2JOBA 4LF8E 2LTRA 1TF3A 3M99B 1XMQE 4OX9E 4ZYDA 1PJSA 4O43A 1X49A 2YPNA 4JI0E 1STUA 5AASA 4JI7E 3IWDA 4DV3E 1T4NA 1N32E 4P7DA 2EL4A 2RTXA 4MLQA 3C4BA 4L5NC 2YU5A 4DMIA 5KL3A 2EPXA 3DJWA 4DR1E 1RQ0A 5KL6A 2EOXA 2V83A 2EPAA 3KZYA 4MLVA 2E1MA 1YPNA 2EL5A 4F6MA 1RC7A 2EN7A 3KZZA 1O0WA 2L33A 1A1GA 2J7JA 2ENHA 2D9HA 5AC5A 2NUFA 3L00A 4NXNE 5A2QC 2EOIA 4GKJE 2G7HA 2LUQA 4WFTA 3H09A 1DI2A 4X65E 1T39A 4R2CA 3EPKA 2N3HA 1JK2A 1IBKE 3HTXA 4IS1C 5LL6R 2RSMA 3EQ1A 5FLXC 2LTSA 2EOSA 3HXLA 2L6MA 4L8NA 2EPCA 2H36X 2V8QB 2EZ6A 2V86A 2M9AA 3BGHA 1YSAC 2FTXB 5ADZA 4R2EA 1X48A 2LCEA 4F9AB 2DGCA 5A6BD 1UILA 2VQEE 2WBTA 2EN1A 2RQLA 4KWYA 1X6HA 4WPYA 2KHXA 5A69A 2LV2A 2EM3A 2EPRA 2EOZA 3TQMA 4DR6E 3T1YE 2DRPA 4R03A 3F6HA 4DUZE 2YWQA 4K0KE 1DGCA 2RPCA 2EMCA 2EM0A 2LO3A 2DLKA 2L8TA 2EN4A 1BBOA 4DR4E 4LU9A 2N8XA 4DKKA 2R76A 5LMNE 3THNA 2A25A 3T1HE 1G2FC 4F9BB 1P47A 1G2DC 2L2NA 2ELYA 4JI2E 4Q28A 3HQ1A 4I8OA 1PKPA 4BHBA 1WHNA 3HPZA 2YRHA 1T38A 3RMPA 4FK5C 2BB8A 2YU8A 2YSPA 2YZTA 4O24A 1X47A 2CPNA 5IV8B 1UN6B 4F54A 4X66E 2V85A 1MGTA 4AQYE 1AH5A 1HNZE 4LF5E 4O4KA 1YUIA 2GLIA 4LFAE 2MKDA 2WBSA 3P1XA 2YRMA 2WZOA 2YT4A 1F2IG 4R2DA 4WXCA 2UXCE 1KJKA 2EM9A 4BBYA 4P78A 2K7IA 4LFBE 2RSIA 4GZNC 4F2JC 1GZ6A 3QG5C 1N34E 1YFHA 3UK3C 5T6JA 4F6NA 4JYAE 2WBUA 2F8BA 1IBME 2K4VA 2EQ1A 1NEIA 4X8WA 2JY9A 1WHQA 2EPUA 2EOFA 2MC6A 1EH7A 5A6KA 2EMWA 4WX9A 1FJGE 3BIDA 2ENCA 2EPOA 1A1IA 2B7VA 2WCC3 2F4VE 2EMHA 5AE1A 4DV6E 4M2ZA 2YTDA 1TN9A 2ODRC 4HEIA 1TF6A 2EMLA 4JI1E 5KL2A 2NABA 2CTDA 3EPJA 3VK6A 3EPHA 2EORA 2ENAA 2M4IA 1EH8A 2EE8A 2M1SA 2E5LE 1PDAA 2JVAA 3LMLA 4R8OA 1QNTA 4DV1E 2EPLX 1YZ9A 5A6BA 2HHHE 1ZU1A 4JI6E 3IWBA 2EOOA 5IT9C 2EMKA 2L2MA 4J8ZA 1SFEA 2EN2A 2ELZA 3EPLA 4DR2E 4KZSA 4JI8E
chains in the Genus database with same CATH topology
5TSEA 5IV8B 4RH8A 4Q35B 4RHBB 4N4RB 4KWYA 4NHRA 3BF2A 2N8XA 5IXMB 2R76A 2JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TSE A;  5IV8 B;  4RH8 A;  4Q35 B;  4RHB B;  4N4R B;  4KWY A;  4NHR A;  3BF2 A;  2N8X A;  5IXM B;  2R76 A;  2JXP A; 
#chains in the Genus database with same CATH topology
 4LTY A;  2EL6 A;  2B3T B;  2GHF A;  2LBS B;  2EMB A;  4X64 E;  4DUY E;  2DIX A;  2HC5 A;  3J80 C;  4F9C B;  2EOM A;  2MDR A;  2UUC E;  1DQ3 A;  4R2Q A;  2FV4 B;  2DB2 A;  3LLH A;  2FGG A;  2JR1 A;  1XNR E;  2JXP A;  1X6F A;  2LT7 A;  2YTN A;  1X3C A;  1UHZ A;  1A1H A;  4NXM E;  4B3R E;  3VHT B;  2UXB E;  4WXD A;  1IQO A;  1N33 E;  4ZYG A;  4JI4 E;  4M9V C;  4B3S E;  5KL7 A;  2E72 A;  4M0V A;  1N3G A;  1IQS A;  4DR5 E;  5KL4 A;  2B7T A;  4JV5 E;  4LF7 E;  4ZYH A;  2EWL A;  2EM5 A;  3OTO E;  4LFC E;  1ZBT A;  1EKZ A;  4R2R A;  1BB8 A;  2DMI A;  1ZAA C;  4BMJ A;  2V87 A;  3MSW A;  3DF6 A;  2JP9 A;  1XNQ E;  1YUJ A;  5IWA E;  4JI5 E;  1NCS A;  1LLM C;  4B3T E;  2EOQ A;  5LLQ A;  2MKN A;  1A1L A;  3VYY A;  1XMO E;  2YRK A;  4BC9 A;  4DV0 E;  5A6J A;  2NA2 A;  3K6Q A;  1UBD C;  2LJU A;  1FKA E;  2YTG A;  2NUG A;  4ZYE A;  5IXM B;  2UUA E;  4DR7 E;  2YSO A;  2YTQ A;  2L3J A;  1J26 A;  1GQE A;  2EPN A;  2ODR D;  1A1K A;  2RS6 A;  1WXR A;  4YHH E;  2Q8U A;  4DR3 E;  2EQ0 A;  3ZOQ B;  3C6M A;  4WYQ B;  3MHH C;  3ADL A;  1SR9 A;  1KYQ A;  2LJH A;  4X62 E;  4HTG A;  4O5G A;  3IWC A;  2L2K B;  2EQ3 A;  3ADG A;  3AV0 A;  2YTE A;  1GTK A;  4DV2 E;  4BHC A;  1YYW A;  1QU6 A;  2EPP A;  2EOY A;  3AUZ A;  4OOG C;  3KWR A;  2EM7 A;  2EMG A;  1JK1 A;  2IHR 1;  2JWO A;  2HGH A;  2LUP B;  2M7Q A;  2EM6 A;  2R1F A;  4LF6 E;  2UXD E;  1BBG A;  4DV7 E;  1IMU A;  2LVH A;  4GKK E;  5AC4 A;  5A6A A;  3MHS C;  5KL5 A;  2YTO A;  1J5E E;  4Q35 B;  2VE7 C;  1MEY C;  2KON A;  2B9D A;  3C6K A;  4RHB B;  2V89 A;  5LMU E;  1HNX E;  4BC7 A;  2ADR A;  3J7A G;  2EOE A;  3ECR A;  4JI3 E;  2EN3 A;  4R2A A;  4KHP E;  2EN6 A;  2MDG A;  1X6E A;  5F3W A;  2EJ4 A;  1YYK A;  2EPM X;  1HR0 E;  3ADI A;  1ZR9 A;  4TUI A;  1T4L B;  2ZM6 E;  5DNY A;  2YTP A;  2EMX A;  2JOX A;  2EN8 A;  2DSY A;  2VRD A;  2EM4 A;  2EPZ A;  3OML A;  2CT1 A;  4DV4 E;  2BBG A;  2CSH A;  3VYX A;  2NUE A;  5CFF E;  2EMY A;  3J81 C;  2EMF A;  3J7Y p;  1A1F A;  1A1J A;  1X5W A;  4GEQ B;  2MC5 A;  2HJJ A;  3JU0 A;  2PRT A;  4M30 A;  1PJQ A;  2YTJ A;  2L92 A;  1ZBQ A;  1PJT A;  3BBG A;  2V88 A;  2YTI A;  2JYA A;  3BF2 A;  2UU9 E;  1WRJ A;  1EH6 A;  2KOU A;  2RS7 A;  2JPA A;  2N3G A;  1N36 E;  1B69 A;  4R2P A;  2EPK X;  2DMY A;  3HPS A;  4RH8 A;  4X9J A;  4NZV A;  4BCA A;  1IBL E;  1AAY A;  1RMD A;  2VF1 A;  2EOJ A;  2GPI A;  3FIG A;  2DLQ A;  5BR8 E;  1HNW E;  4WSG A;  4B3M E;  1YYO A;  2YTF A;  1T4O A;  3JAM C;  2EMA A;  2EMI A;  3F6G A;  4NHR A;  4LF9 E;  4DV5 E;  4IJD A;  2LRS A;  2EP3 A;  2UUB E;  2L3C A;  4BS9 A;  2EMZ A;  2EOH A;  4R2S A;  4TUG A;  2I13 A;  1I94 E;  5TSE A;  1WJP A;  4N4R B;  4LF4 E;  2VQF E;  1L4S A;  2EM2 A;  2I9I A;  2EM8 A;  4WSP A;  3THO B;  5AE3 A;  4YY3 E;  1Z1B A;  3ADJ A;  2LE2 A;  2LMZ A;  5AE2 A;  3C4T A;  3JTZ A;  2JOB A;  4LF8 E;  2LTR A;  1TF3 A;  3M99 B;  1XMQ E;  4OX9 E;  4ZYD A;  1PJS A;  4O43 A;  1X49 A;  2YPN A;  4JI0 E;  1STU A;  5AAS A;  4JI7 E;  3IWD A;  4DV3 E;  1T4N A;  1N32 E;  4P7D A;  2EL4 A;  2RTX A;  4MLQ A;  3C4B A;  4L5N C;  2YU5 A;  4DMI A;  5KL3 A;  2EPX A;  3DJW A;  4DR1 E;  1RQ0 A;  5KL6 A;  2EOX A;  2V83 A;  2EPA A;  3KZY A;  4MLV A;  2E1M A;  1YPN A;  2EL5 A;  4F6M A;  1RC7 A;  2EN7 A;  3KZZ A;  1O0W A;  2L33 A;  1A1G A;  2J7J A;  2ENH A;  2D9H A;  5AC5 A;  2NUF A;  3L00 A;  4NXN E;  5A2Q C;  2EOI A;  4GKJ E;  2G7H A;  2LUQ A;  4WFT A;  3H09 A;  1DI2 A;  4X65 E;  1T39 A;  4R2C A;  3EPK A;  2N3H A;  1JK2 A;  1IBK E;  3HTX A;  4IS1 C;  5LL6 R;  2RSM A;  3EQ1 A;  5FLX C;  2LTS A;  2EOS A;  3HXL A;  2L6M A;  4L8N A;  2EPC A;  2H36 X;  2V8Q B;  2EZ6 A;  2V86 A;  2M9A A;  3BGH A;  1YSA C;  2FTX B;  5ADZ A;  4R2E A;  1X48 A;  2LCE A;  4F9A B;  2DGC A;  5A6B D;  1UIL A;  2VQE E;  2WBT A;  2EN1 A;  2RQL A;  4KWY A;  1X6H A;  4WPY A;  2KHX A;  5A69 A;  2LV2 A;  2EM3 A;  2EPR A;  2EOZ A;  3TQM A;  4DR6 E;  3T1Y E;  2DRP A;  4R03 A;  3F6H A;  4DUZ E;  2YWQ A;  4K0K E;  1DGC A;  2RPC A;  2EMC A;  2EM0 A;  2LO3 A;  2DLK A;  2L8T A;  2EN4 A;  1BBO A;  4DR4 E;  4LU9 A;  2N8X A;  4DKK A;  2R76 A;  5LMN E;  3THN A;  2A25 A;  3T1H E;  1G2F C;  4F9B B;  1P47 A;  1G2D C;  2L2N A;  2ELY A;  4JI2 E;  4Q28 A;  3HQ1 A;  4I8O A;  1PKP A;  4BHB A;  1WHN A;  3HPZ A;  2YRH A;  1T38 A;  3RMP A;  4FK5 C;  2BB8 A;  2YU8 A;  2YSP A;  2YZT A;  4O24 A;  1X47 A;  2CPN A;  5IV8 B;  1UN6 B;  4F54 A;  4X66 E;  2V85 A;  1MGT A;  4AQY E;  1AH5 A;  1HNZ E;  4LF5 E;  4O4K A;  1YUI A;  2GLI A;  4LFA E;  2MKD A;  2WBS A;  3P1X A;  2YRM A;  2WZO A;  2YT4 A;  1F2I G;  4R2D A;  4WXC A;  2UXC E;  1KJK A;  2EM9 A;  4BBY A;  4P78 A;  2K7I A;  4LFB E;  2RSI A;  4GZN C;  4F2J C;  1GZ6 A;  3QG5 C;  1N34 E;  1YFH A;  3UK3 C;  5T6J A;  4F6N A;  4JYA E;  2WBU A;  2F8B A;  1IBM E;  2K4V A;  2EQ1 A;  1NEI A;  4X8W A;  2JY9 A;  1WHQ A;  2EPU A;  2EOF A;  2MC6 A;  1EH7 A;  5A6K A;  2EMW A;  4WX9 A;  1FJG E;  3BID A;  2ENC A;  2EPO A;  1A1I A;  2B7V A;  2WCC 3;  2F4V E;  2EMH A;  5AE1 A;  4DV6 E;  4M2Z A;  2YTD A;  1TN9 A;  2ODR C;  4HEI A;  1TF6 A;  2EML A;  4JI1 E;  5KL2 A;  2NAB A;  2CTD A;  3EPJ A;  3VK6 A;  3EPH A;  2EOR A;  2ENA A;  2M4I A;  1EH8 A;  2EE8 A;  2M1S A;  2E5L E;  1PDA A;  2JVA A;  3LML A;  4R8O A;  1QNT A;  4DV1 E;  2EPL X;  1YZ9 A;  5A6B A;  2HHH E;  1ZU1 A;  4JI6 E;  3IWB A;  2EOO A;  5IT9 C;  2EMK A;  2L2M A;  4J8Z A;  1SFE A;  2EN2 A;  2ELZ A;  3EPL A;  4DR2 E;  4KZS A;  4JI8 E; 
#chains in the Genus database with same CATH homology
 5TSE A;  5IV8 B;  4RH8 A;  4Q35 B;  4RHB B;  4N4R B;  4KWY A;  4NHR A;  3BF2 A;  2N8X A;  5IXM B;  2R76 A;  2JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...