2EMAA

Solution structure of the c2h2 type zinc finger (region 312-344) of human zinc finger protein 347
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 312-344) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emaA01
4R2CA 2EMZA 2WBUA 3MHSC 1YSAC 2ENCA 2YSOA 2CTDA 1RMDA 2EQ1A 4GZNC 1G2DC 2EM7A 1KJKA 2A25A 2JP9A 2EN6A 2EM3A 4F2JC 1BBOA 2YTOA 1A1LA 1A1KA 2EMYA 2EOFA 1MEYC 2EL4A 2EOQA 2HGHA 2LO3A 3MHHC 2DGCA 2EOXA 2EJ4A 2EOIA 1DGCA 1Z1BA 4F6MA 1ZU1A 2ENAA 2EPXA 2YTDA 3UK3C 2EM0A 2DMIA 4X9JA 1BB8A 2LV2A 1G2FC 2EOEA 2EMAA 2WCC3 5KL3A 2EE8A 3EPLA 2PRTA 2D9HA 1A1GA 2EMGA 1X6FA 2RPCA 1TF3A 1YUJA 1A1JA 2EPUA 4R2PA 2YTFA 2EOHA 1A1FA 2RSIA 2MKNA 1X6HA 2EPZA 2EN1A 2J7JA 2EQ0A 4R2RA 2EMFA 2GHFA 2CSHA 2VRDA 2CT1A 2ELZA 2EMXA 2DRPA 1B69A 2EN7A 1UN6B 2EORA 2EM6A 2M9AA 5KL5A 2EOSA 2EM4A 2EMLA 1F2IG 2LVHA 4R2EA 4IJDA 5KL7A 4R2QA 2YTNA 2YTIA 2EOOA 2BB8A 2EL5A 2E72A 3M99B 5KL4A 2MDGA 2ELYA 1X3CA 1LLMC 2DLKA 4FK5C 2DLQA 2EN4A 1UBDC 2I13A 2EMIA 2EMCA 2EMHA 2EOZA 2YTQA 2YTJA 2EP3A 1AAYA 4WSGA 2YU5A 1YUIA 1JK2A 1A1IA 2EQ3A 1JK1A 2NABA 4M9VC 2LT7A 2EMWA 3EPHA 2YRKA 3VHTB 2YU8A 3EPKA 4IS1C 2JPAA 2EL6A 2LCEA 2EM9A 2YTGA 5KL2A 4R2DA 2YRHA 1TF6A 1X6EA 1TN9A 2EN3A 2EPRA 2ADRA 1X5WA 2EM5A 2EOJA 2EOYA 2EPAA 2YRMA 3EPJA 2EMKA 1NCSA 2ENHA 1P47A 2YTPA 2EMBA 2EM8A 2R1FA 2EN8A 2WBTA 2YSPA 2WBSA 1ZR9A 4R2AA 2GLIA 1ZAAC 1WJPA 5KL6A 2MKDA 2EPCA 4F6NA 2EOMA 2EPPA 2YTEA 4R2SA 2EN2A 2EM2A 1A1HA
chains in the Genus database with same CATH superfamily
3TQMA 1WHQA 2E1MA 4JI6E 2RSMA 2EMZA 2DMYA 2UU9E 2EPNA 4DV7E 2VF1A 1T39A 2EPLX 4JI5E 4GZNC 2BBGA 1MGTA 5BR8E 2EN6A 4J8ZA 1BBOA 4R03A 4BCAA 4DR5E 2V88A 2L6MA 2NUGA 1IMUA 2L2KB 2EOFA 2EOQA 4Q28A 2HGHA 2EOXA 4WXCA 2EOIA 1DGCA 4BC7A 3OMLA 4BHBA 1J5EE 4L5NC 4LF4E 4X9JA 2LV2A 1XMQE 1YUJA 1A1GA 2EMGA 3ADJA 3THNA 2LTSA 2RSIA 1A1FA 1YZ9A 3DF6A 2EN1A 3H09A 3J80C 3C4TA 2UUBE 1IBKE 1J26A 2EQ0A 4M30A 4KZSA 1N36E 2JWOA 2L3CA 4P78A 2DRPA 4B3ME 1WXRA 4N4RB 4DV5E 2EORA 3JAMC 2M9AA 3HPZA 4KHPE 3ZOQB 2YTNA 2EL5A 3M99B 3ECRA 3F6GA 4YY3E 2DLQA 2EN4A 2I13A 4Q35B 2EMIA 5IT9C 1GTKA 2EMCA 4L8NA 1NEIA 5DNYA 4JI0E 5IXMB 2EP3A 4M0VA 1YUIA 2MC6A 5A6BD 2UXDE 1FKAE 1HNXE 4ZYHA 2LT7A 5FLXC 4P7DA 2YRKA 4O43A 3VHTB 3HQ1A 2V8QB 3C4BA 2EL6A 4JV5E 1STUA 1KYQA 2YTGA 1TF6A 4R2DA 2LUQA 1HNZE 1TN9A 2JR1A 4MLVA 5AE3A 2ENHA 2YTPA 4JI7E 2EMBA 2R1FA 1ZR9A 1ZBQA 1ZAAC 2MKDA 2YZTA 2YWQA 2LRSA 2YTEA 4R2SA 1A1HA 3KWRA 4NXME 4F9CB 3OTOE 2RS6A 4JI3E 3MHSC 1YSAC 2JYAA 4DR7E 2YSOA 2JVAA 3MSWA 1N33E 2MDRA 5LL6R 2EM7A 1ZBTA 4BMJA 2EM3A 4F2JC 4GEQB 4NZVA 3J81C 1A1KA 2EMYA 1MEYC 4B3SE 1XNRE 4WSPA 2EJ4A 2V85A 1Z1BA 4F6MA 1N34E 4BS9A 2ENAA 2EPXA 3UK3C 2EM0A 3HXLA 1BB8A 2B3TB 1GZ6A 2EMAA 5A69A 5KL3A 2NUEA 3EPLA 2PRTA 1X6FA 2UUAE 3J7AG 1A1JA 2EOHA 1WRJA 2L8TA 3IWCA 4WFTA 1X6HA 2J7JA 2GHFA 5ADZA 4GKJE 2VRDA 3JU0A 2EMXA 1N3GA 1PDAA 3T1YE 1T4LB 1AH5A 4DMIA 2EN7A 4LF9E 3ADIA 2HC5A 2V83A 2G7HA 3AUZA 2EM6A 1IBLE 5KL5A 5AE2A 5A6BA 2EM4A 2LJHA 1F2IG 4DR4E 4R2EA 1DI2A 4IJDA 2YTIA 2EOOA 2GPIA 2N3GA 3VYXA 3KZZA 3QG5C 3THOB 4BHCA 2JXPA 1L4SA 3LLHA 1UBDC 1YPNA 2DB2A 4F54A 2EMHA 4WX9A 2YTJA 3KZYA 1HNWE 2JY9A 2YPNA 2YU5A 5IV8B 5AASA 1EH7A 3HPSA 5A2QC 3J7Yp 4WPYA 3EPKA 3T1HE 2KONA 2CPNA 1SFEA 2RS7A 4X66E 2VE7C 1X6EA 4LU9A 1X5WA 3EPJA 2N3HA 4DR1E 1T4OA 1RC7A 5AC5A 2ODRD 1IBME 1NCSA 1YYKA 2R76A 4DR2E 3VK6A 2YSPA 2WBSA 4R2AA 2DSYA 4LF5E 4M2ZA 4F6NA 2EOMA 3IWDA 1I94E 1QU6A 4OOGC 4K0KE 4NHRA 1BBGA 4I8OA 4R2CA 3C6MA 3IWBA 3BGHA 5A6AA 2CTDA 1RMDA 2L92A 1QNTA 2F8BA 4NXNE 1KJKA 2A25A 3BBGA 4LF6E 2EPMX 1UILA 3HTXA 4LFCE 2EL4A 2LO3A 4B3RE 2DGCA 2EPOA 4RH8A 2L33A 1ZU1A 2RQLA 4DR3E 2FV4B 1XMOE 2JOXA 3ADGA 4HEIA 1N32E 2FTXB 2D9HA 2F4VE 2RPCA 2LTRA 4R2PA 2YTFA 1EH8A 4GKKE 5AE1A 2L2MA 4F9BB 4F9AB 4O24A 4WYQB 4R2RA 2UXBE 2CSHA 2ELZA 1B69A 4JI2E 2VQFE 1PKPA 4DV3E 1UN6B 4JYAE 4ZYEA 2YT4A 2EOSA 4JI1E 4JI8E 2LBSB 2EMLA 1YYWA 2LVHA 2FGGA 1IQOA 5KL7A 4R2QA 2EPKX 2BB8A 4MLQA 4X64E 4DV6E 4AQYE 4JI4E 4OX9E 3ADLA 2MDGA 2ELYA 1X3CA 1LLMC 1GQEA 5LMNE 2N8XA 4FK5C 1PJSA 4X65E 3AV0A 3FIGA 5A6JA 4WSGA 1A1IA 2K4VA 2EQ3A 2NABA 2NA2A 4M9VC 3EPHA 2JPAA 2B7TA 2ZM6E 4KWYA 2E5LE 1SR9A 2WZOA 2NUFA 5KL2A 2YRHA 4ZYGA 2EN3A 2EPRA 2ADRA 2EOJA 2EOYA 2YRMA 4X8WA 4DKKA 2EMKA 1P47A 1EKZA 2V89A 5AC4A 2H36X 5CFFE 2EN8A 2HJJA 2WBTA 2M7QA 4DV1E 4O4KA 4TUIA 2EZ6A 1WJPA 4DV0E 2EPCA 5LMUE 2DIXA 3VYYA 4BBYA 2UUCE 4DUZE 2EN2A 4DR6E 2EM8A 2K7IA 4RHBB 2M1SA 1UHZA 2WBUA 3DJWA 2JOBA 2ENCA 2EQ1A 1G2DC 4X62E 2JP9A 3RMPA 4HTGA 1X48A 2YTOA 1A1LA 5LLQA 2B7VA 2L3JA 4LF8E 3MHHC 2L2NA 2KOUA 2YTDA 2LJUA 2DMIA 1IQSA 1G2FC 1YYOA 2EOEA 2WCC3 1XNQE 2EE8A 1O0WA 3F6HA 1TF3A 2LMZA 2EM2A 1PJTA 2EPUA 2MKNA 3C6KA 2EPZA 4O5GA 3K6QA 2UXCE 2EMFA 1T4NA 2LE2A 2CT1A 4LFAE 4WXDA 4LFBE 1RQ0A 2V86A 3LMLA 5IWAE 4DV4E 4LTYA 2M4IA 2MC5A 4YHHE 1WHNA 1FJGE 4B3TE 5KL4A 3P1XA 4ZYDA 2DLKA 2HHHE 1DQ3A 4DV2E 2KHXA 3BF2A 2EWLA 3BIDA 4TUGA 4R8OA 1PJQA 2I9IA 2EOZA 2YTQA 5F3WA 5TSEA 3EQ1A 3JTZA 1AAYA 1JK2A 4DUYE 1JK1A 2EMWA 1EH6A 2YU8A 4IS1C 1YFHA 2LCEA 2IHR1 2EM9A 1X47A 2ODRC 1T38A 2LUPB 4BC9A 2EPAA 2EM5A 5T6JA 1X49A 2Q8UA 5A6KA 2RTXA 2VQEE 2GLIA 2B9DA 5KL6A 4LF7E 3L00A 2V87A 2EPPA 2E72A 1HR0E
chains in the Genus database with same CATH topology
4R2CA 2EMZA 2WBUA 3MHSC 1YSAC 2ENCA 2YSOA 2CTDA 1RMDA 2EQ1A 4GZNC 1G2DC 2EM7A 1KJKA 2A25A 2JP9A 2EN6A 2EM3A 4F2JC 1BBOA 2YTOA 1A1LA 1A1KA 2EMYA 2EOFA 1MEYC 2EL4A 2EOQA 2HGHA 2LO3A 3MHHC 2DGCA 2EOXA 2EJ4A 2EOIA 1DGCA 1Z1BA 4F6MA 1ZU1A 2ENAA 2EPXA 2YTDA 3UK3C 2EM0A 2DMIA 4X9JA 1BB8A 2LV2A 1G2FC 2EOEA 2EMAA 2WCC3 5KL3A 2EE8A 3EPLA 2PRTA 2D9HA 1A1GA 2EMGA 1X6FA 2RPCA 1TF3A 1YUJA 1A1JA 2EPUA 4R2PA 2YTFA 2EOHA 1A1FA 2RSIA 2MKNA 1X6HA 2EPZA 2EN1A 2J7JA 2EQ0A 4R2RA 2EMFA 2GHFA 2CSHA 2VRDA 2CT1A 2ELZA 2EMXA 2DRPA 1B69A 2EN7A 1UN6B 2EORA 2EM6A 2M9AA 5KL5A 2EOSA 2EM4A 2EMLA 1F2IG 2LVHA 4R2EA 4IJDA 5KL7A 4R2QA 2YTNA 2YTIA 2EOOA 2BB8A 2EL5A 2E72A 3M99B 5KL4A 2MDGA 2ELYA 1X3CA 1LLMC 2DLKA 4FK5C 2DLQA 2EN4A 1UBDC 2I13A 2EMIA 2EMCA 2EMHA 2EOZA 2YTQA 2YTJA 2EP3A 1AAYA 4WSGA 2YU5A 1YUIA 1JK2A 1A1IA 2EQ3A 1JK1A 2NABA 4M9VC 2LT7A 2EMWA 3EPHA 2YRKA 3VHTB 2YU8A 3EPKA 4IS1C 2JPAA 2EL6A 2LCEA 2EM9A 2YTGA 5KL2A 4R2DA 2YRHA 1TF6A 1X6EA 1TN9A 2EN3A 2EPRA 2ADRA 1X5WA 2EM5A 2EOJA 2EOYA 2EPAA 2YRMA 3EPJA 2EMKA 1NCSA 2ENHA 1P47A 2YTPA 2EMBA 2EM8A 2R1FA 2EN8A 2WBTA 2YSPA 2WBSA 1ZR9A 4R2AA 2GLIA 1ZAAC 1WJPA 5KL6A 2MKDA 2EPCA 4F6NA 2EOMA 2EPPA 2YTEA 4R2SA 2EN2A 2EM2A 1A1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2C A;  2EMZ A;  2WBU A;  3MHS C;  1YSA C;  2ENC A;  2YSO A;  2CTD A;  1RMD A;  2EQ1 A;  4GZN C;  1G2D C;  2EM7 A;  1KJK A;  2A25 A;  2JP9 A;  2EN6 A;  2EM3 A;  4F2J C;  1BBO A;  2YTO A;  1A1L A;  1A1K A;  2EMY A;  2EOF A;  1MEY C;  2EL4 A;  2EOQ A;  2HGH A;  2LO3 A;  3MHH C;  2DGC A;  2EOX A;  2EJ4 A;  2EOI A;  1DGC A;  1Z1B A;  4F6M A;  1ZU1 A;  2ENA A;  2EPX A;  2YTD A;  3UK3 C;  2EM0 A;  2DMI A;  4X9J A;  1BB8 A;  2LV2 A;  1G2F C;  2EOE A;  2EMA A;  2WCC 3;  5KL3 A;  2EE8 A;  3EPL A;  2PRT A;  2D9H A;  1A1G A;  2EMG A;  1X6F A;  2RPC A;  1TF3 A;  1YUJ A;  1A1J A;  2EPU A;  4R2P A;  2YTF A;  2EOH A;  1A1F A;  2RSI A;  2MKN A;  1X6H A;  2EPZ A;  2EN1 A;  2J7J A;  2EQ0 A;  4R2R A;  2EMF A;  2GHF A;  2CSH A;  2VRD A;  2CT1 A;  2ELZ A;  2EMX A;  2DRP A;  1B69 A;  2EN7 A;  1UN6 B;  2EOR A;  2EM6 A;  2M9A A;  5KL5 A;  2EOS A;  2EM4 A;  2EML A;  1F2I G;  2LVH A;  4R2E A;  4IJD A;  5KL7 A;  4R2Q A;  2YTN A;  2YTI A;  2EOO A;  2BB8 A;  2EL5 A;  2E72 A;  3M99 B;  5KL4 A;  2MDG A;  2ELY A;  1X3C A;  1LLM C;  2DLK A;  4FK5 C;  2DLQ A;  2EN4 A;  1UBD C;  2I13 A;  2EMI A;  2EMC A;  2EMH A;  2EOZ A;  2YTQ A;  2YTJ A;  2EP3 A;  1AAY A;  4WSG A;  2YU5 A;  1YUI A;  1JK2 A;  1A1I A;  2EQ3 A;  1JK1 A;  2NAB A;  4M9V C;  2LT7 A;  2EMW A;  3EPH A;  2YRK A;  3VHT B;  2YU8 A;  3EPK A;  4IS1 C;  2JPA A;  2EL6 A;  2LCE A;  2EM9 A;  2YTG A;  5KL2 A;  4R2D A;  2YRH A;  1TF6 A;  1X6E A;  1TN9 A;  2EN3 A;  2EPR A;  2ADR A;  1X5W A;  2EM5 A;  2EOJ A;  2EOY A;  2EPA A;  2YRM A;  3EPJ A;  2EMK A;  1NCS A;  2ENH A;  1P47 A;  2YTP A;  2EMB A;  2EM8 A;  2R1F A;  2EN8 A;  2WBT A;  2YSP A;  2WBS A;  1ZR9 A;  4R2A A;  2GLI A;  1ZAA C;  1WJP A;  5KL6 A;  2MKD A;  2EPC A;  4F6N A;  2EOM A;  2EPP A;  2YTE A;  4R2S A;  2EN2 A;  2EM2 A;  1A1H A; 
#chains in the Genus database with same CATH topology
 3TQM A;  1WHQ A;  2E1M A;  4JI6 E;  2RSM A;  2EMZ A;  2DMY A;  2UU9 E;  2EPN A;  4DV7 E;  2VF1 A;  1T39 A;  2EPL X;  4JI5 E;  4GZN C;  2BBG A;  1MGT A;  5BR8 E;  2EN6 A;  4J8Z A;  1BBO A;  4R03 A;  4BCA A;  4DR5 E;  2V88 A;  2L6M A;  2NUG A;  1IMU A;  2L2K B;  2EOF A;  2EOQ A;  4Q28 A;  2HGH A;  2EOX A;  4WXC A;  2EOI A;  1DGC A;  4BC7 A;  3OML A;  4BHB A;  1J5E E;  4L5N C;  4LF4 E;  4X9J A;  2LV2 A;  1XMQ E;  1YUJ A;  1A1G A;  2EMG A;  3ADJ A;  3THN A;  2LTS A;  2RSI A;  1A1F A;  1YZ9 A;  3DF6 A;  2EN1 A;  3H09 A;  3J80 C;  3C4T A;  2UUB E;  1IBK E;  1J26 A;  2EQ0 A;  4M30 A;  4KZS A;  1N36 E;  2JWO A;  2L3C A;  4P78 A;  2DRP A;  4B3M E;  1WXR A;  4N4R B;  4DV5 E;  2EOR A;  3JAM C;  2M9A A;  3HPZ A;  4KHP E;  3ZOQ B;  2YTN A;  2EL5 A;  3M99 B;  3ECR A;  3F6G A;  4YY3 E;  2DLQ A;  2EN4 A;  2I13 A;  4Q35 B;  2EMI A;  5IT9 C;  1GTK A;  2EMC A;  4L8N A;  1NEI A;  5DNY A;  4JI0 E;  5IXM B;  2EP3 A;  4M0V A;  1YUI A;  2MC6 A;  5A6B D;  2UXD E;  1FKA E;  1HNX E;  4ZYH A;  2LT7 A;  5FLX C;  4P7D A;  2YRK A;  4O43 A;  3VHT B;  3HQ1 A;  2V8Q B;  3C4B A;  2EL6 A;  4JV5 E;  1STU A;  1KYQ A;  2YTG A;  1TF6 A;  4R2D A;  2LUQ A;  1HNZ E;  1TN9 A;  2JR1 A;  4MLV A;  5AE3 A;  2ENH A;  2YTP A;  4JI7 E;  2EMB A;  2R1F A;  1ZR9 A;  1ZBQ A;  1ZAA C;  2MKD A;  2YZT A;  2YWQ A;  2LRS A;  2YTE A;  4R2S A;  1A1H A;  3KWR A;  4NXM E;  4F9C B;  3OTO E;  2RS6 A;  4JI3 E;  3MHS C;  1YSA C;  2JYA A;  4DR7 E;  2YSO A;  2JVA A;  3MSW A;  1N33 E;  2MDR A;  5LL6 R;  2EM7 A;  1ZBT A;  4BMJ A;  2EM3 A;  4F2J C;  4GEQ B;  4NZV A;  3J81 C;  1A1K A;  2EMY A;  1MEY C;  4B3S E;  1XNR E;  4WSP A;  2EJ4 A;  2V85 A;  1Z1B A;  4F6M A;  1N34 E;  4BS9 A;  2ENA A;  2EPX A;  3UK3 C;  2EM0 A;  3HXL A;  1BB8 A;  2B3T B;  1GZ6 A;  2EMA A;  5A69 A;  5KL3 A;  2NUE A;  3EPL A;  2PRT A;  1X6F A;  2UUA E;  3J7A G;  1A1J A;  2EOH A;  1WRJ A;  2L8T A;  3IWC A;  4WFT A;  1X6H A;  2J7J A;  2GHF A;  5ADZ A;  4GKJ E;  2VRD A;  3JU0 A;  2EMX A;  1N3G A;  1PDA A;  3T1Y E;  1T4L B;  1AH5 A;  4DMI A;  2EN7 A;  4LF9 E;  3ADI A;  2HC5 A;  2V83 A;  2G7H A;  3AUZ A;  2EM6 A;  1IBL E;  5KL5 A;  5AE2 A;  5A6B A;  2EM4 A;  2LJH A;  1F2I G;  4DR4 E;  4R2E A;  1DI2 A;  4IJD A;  2YTI A;  2EOO A;  2GPI A;  2N3G A;  3VYX A;  3KZZ A;  3QG5 C;  3THO B;  4BHC A;  2JXP A;  1L4S A;  3LLH A;  1UBD C;  1YPN A;  2DB2 A;  4F54 A;  2EMH A;  4WX9 A;  2YTJ A;  3KZY A;  1HNW E;  2JY9 A;  2YPN A;  2YU5 A;  5IV8 B;  5AAS A;  1EH7 A;  3HPS A;  5A2Q C;  3J7Y p;  4WPY A;  3EPK A;  3T1H E;  2KON A;  2CPN A;  1SFE A;  2RS7 A;  4X66 E;  2VE7 C;  1X6E A;  4LU9 A;  1X5W A;  3EPJ A;  2N3H A;  4DR1 E;  1T4O A;  1RC7 A;  5AC5 A;  2ODR D;  1IBM E;  1NCS A;  1YYK A;  2R76 A;  4DR2 E;  3VK6 A;  2YSP A;  2WBS A;  4R2A A;  2DSY A;  4LF5 E;  4M2Z A;  4F6N A;  2EOM A;  3IWD A;  1I94 E;  1QU6 A;  4OOG C;  4K0K E;  4NHR A;  1BBG A;  4I8O A;  4R2C A;  3C6M A;  3IWB A;  3BGH A;  5A6A A;  2CTD A;  1RMD A;  2L92 A;  1QNT A;  2F8B A;  4NXN E;  1KJK A;  2A25 A;  3BBG A;  4LF6 E;  2EPM X;  1UIL A;  3HTX A;  4LFC E;  2EL4 A;  2LO3 A;  4B3R E;  2DGC A;  2EPO A;  4RH8 A;  2L33 A;  1ZU1 A;  2RQL A;  4DR3 E;  2FV4 B;  1XMO E;  2JOX A;  3ADG A;  4HEI A;  1N32 E;  2FTX B;  2D9H A;  2F4V E;  2RPC A;  2LTR A;  4R2P A;  2YTF A;  1EH8 A;  4GKK E;  5AE1 A;  2L2M A;  4F9B B;  4F9A B;  4O24 A;  4WYQ B;  4R2R A;  2UXB E;  2CSH A;  2ELZ A;  1B69 A;  4JI2 E;  2VQF E;  1PKP A;  4DV3 E;  1UN6 B;  4JYA E;  4ZYE A;  2YT4 A;  2EOS A;  4JI1 E;  4JI8 E;  2LBS B;  2EML A;  1YYW A;  2LVH A;  2FGG A;  1IQO A;  5KL7 A;  4R2Q A;  2EPK X;  2BB8 A;  4MLQ A;  4X64 E;  4DV6 E;  4AQY E;  4JI4 E;  4OX9 E;  3ADL A;  2MDG A;  2ELY A;  1X3C A;  1LLM C;  1GQE A;  5LMN E;  2N8X A;  4FK5 C;  1PJS A;  4X65 E;  3AV0 A;  3FIG A;  5A6J A;  4WSG A;  1A1I A;  2K4V A;  2EQ3 A;  2NAB A;  2NA2 A;  4M9V C;  3EPH A;  2JPA A;  2B7T A;  2ZM6 E;  4KWY A;  2E5L E;  1SR9 A;  2WZO A;  2NUF A;  5KL2 A;  2YRH A;  4ZYG A;  2EN3 A;  2EPR A;  2ADR A;  2EOJ A;  2EOY A;  2YRM A;  4X8W A;  4DKK A;  2EMK A;  1P47 A;  1EKZ A;  2V89 A;  5AC4 A;  2H36 X;  5CFF E;  2EN8 A;  2HJJ A;  2WBT A;  2M7Q A;  4DV1 E;  4O4K A;  4TUI A;  2EZ6 A;  1WJP A;  4DV0 E;  2EPC A;  5LMU E;  2DIX A;  3VYY A;  4BBY A;  2UUC E;  4DUZ E;  2EN2 A;  4DR6 E;  2EM8 A;  2K7I A;  4RHB B;  2M1S A;  1UHZ A;  2WBU A;  3DJW A;  2JOB A;  2ENC A;  2EQ1 A;  1G2D C;  4X62 E;  2JP9 A;  3RMP A;  4HTG A;  1X48 A;  2YTO A;  1A1L A;  5LLQ A;  2B7V A;  2L3J A;  4LF8 E;  3MHH C;  2L2N A;  2KOU A;  2YTD A;  2LJU A;  2DMI A;  1IQS A;  1G2F C;  1YYO A;  2EOE A;  2WCC 3;  1XNQ E;  2EE8 A;  1O0W A;  3F6H A;  1TF3 A;  2LMZ A;  2EM2 A;  1PJT A;  2EPU A;  2MKN A;  3C6K A;  2EPZ A;  4O5G A;  3K6Q A;  2UXC E;  2EMF A;  1T4N A;  2LE2 A;  2CT1 A;  4LFA E;  4WXD A;  4LFB E;  1RQ0 A;  2V86 A;  3LML A;  5IWA E;  4DV4 E;  4LTY A;  2M4I A;  2MC5 A;  4YHH E;  1WHN A;  1FJG E;  4B3T E;  5KL4 A;  3P1X A;  4ZYD A;  2DLK A;  2HHH E;  1DQ3 A;  4DV2 E;  2KHX A;  3BF2 A;  2EWL A;  3BID A;  4TUG A;  4R8O A;  1PJQ A;  2I9I A;  2EOZ A;  2YTQ A;  5F3W A;  5TSE A;  3EQ1 A;  3JTZ A;  1AAY A;  1JK2 A;  4DUY E;  1JK1 A;  2EMW A;  1EH6 A;  2YU8 A;  4IS1 C;  1YFH A;  2LCE A;  2IHR 1;  2EM9 A;  1X47 A;  2ODR C;  1T38 A;  2LUP B;  4BC9 A;  2EPA A;  2EM5 A;  5T6J A;  1X49 A;  2Q8U A;  5A6K A;  2RTX A;  2VQE E;  2GLI A;  2B9D A;  5KL6 A;  4LF7 E;  3L00 A;  2V87 A;  2EPP A;  2E72 A;  1HR0 E; 
#chains in the Genus database with same CATH homology
 4R2C A;  2EMZ A;  2WBU A;  3MHS C;  1YSA C;  2ENC A;  2YSO A;  2CTD A;  1RMD A;  2EQ1 A;  4GZN C;  1G2D C;  2EM7 A;  1KJK A;  2A25 A;  2JP9 A;  2EN6 A;  2EM3 A;  4F2J C;  1BBO A;  2YTO A;  1A1L A;  1A1K A;  2EMY A;  2EOF A;  1MEY C;  2EL4 A;  2EOQ A;  2HGH A;  2LO3 A;  3MHH C;  2DGC A;  2EOX A;  2EJ4 A;  2EOI A;  1DGC A;  1Z1B A;  4F6M A;  1ZU1 A;  2ENA A;  2EPX A;  2YTD A;  3UK3 C;  2EM0 A;  2DMI A;  4X9J A;  1BB8 A;  2LV2 A;  1G2F C;  2EOE A;  2EMA A;  2WCC 3;  5KL3 A;  2EE8 A;  3EPL A;  2PRT A;  2D9H A;  1A1G A;  2EMG A;  1X6F A;  2RPC A;  1TF3 A;  1YUJ A;  1A1J A;  2EPU A;  4R2P A;  2YTF A;  2EOH A;  1A1F A;  2RSI A;  2MKN A;  1X6H A;  2EPZ A;  2EN1 A;  2J7J A;  2EQ0 A;  4R2R A;  2EMF A;  2GHF A;  2CSH A;  2VRD A;  2CT1 A;  2ELZ A;  2EMX A;  2DRP A;  1B69 A;  2EN7 A;  1UN6 B;  2EOR A;  2EM6 A;  2M9A A;  5KL5 A;  2EOS A;  2EM4 A;  2EML A;  1F2I G;  2LVH A;  4R2E A;  4IJD A;  5KL7 A;  4R2Q A;  2YTN A;  2YTI A;  2EOO A;  2BB8 A;  2EL5 A;  2E72 A;  3M99 B;  5KL4 A;  2MDG A;  2ELY A;  1X3C A;  1LLM C;  2DLK A;  4FK5 C;  2DLQ A;  2EN4 A;  1UBD C;  2I13 A;  2EMI A;  2EMC A;  2EMH A;  2EOZ A;  2YTQ A;  2YTJ A;  2EP3 A;  1AAY A;  4WSG A;  2YU5 A;  1YUI A;  1JK2 A;  1A1I A;  2EQ3 A;  1JK1 A;  2NAB A;  4M9V C;  2LT7 A;  2EMW A;  3EPH A;  2YRK A;  3VHT B;  2YU8 A;  3EPK A;  4IS1 C;  2JPA A;  2EL6 A;  2LCE A;  2EM9 A;  2YTG A;  5KL2 A;  4R2D A;  2YRH A;  1TF6 A;  1X6E A;  1TN9 A;  2EN3 A;  2EPR A;  2ADR A;  1X5W A;  2EM5 A;  2EOJ A;  2EOY A;  2EPA A;  2YRM A;  3EPJ A;  2EMK A;  1NCS A;  2ENH A;  1P47 A;  2YTP A;  2EMB A;  2EM8 A;  2R1F A;  2EN8 A;  2WBT A;  2YSP A;  2WBS A;  1ZR9 A;  4R2A A;  2GLI A;  1ZAA C;  1WJP A;  5KL6 A;  2MKD A;  2EPC A;  4F6N A;  2EOM A;  2EPP A;  2YTE A;  4R2S A;  2EN2 A;  2EM2 A;  1A1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...