2EMAA

Solution structure of the c2h2 type zinc finger (region 312-344) of human zinc finger protein 347
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 312-344) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 347
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emaA01
1LLMC 2EMAA 2EOSA 2YSPA 2EOMA 2ELZA 3M99B 3UK3C 2LO3A 5KL2A 1WJPA 1KJKA 2EJ4A 2EMCA 2EOZA 2HGHA 2YTFA 2EMIA 4R2SA 4R2RA 2YRHA 2LV2A 2ENAA 2EE8A 2EM2A 2EMYA 2YRKA 1A1IA 2YTNA 2EPXA 1B69A 2EORA 2YTOA 4R2AA 2DMIA 2EL6A 2LVHA 2MDGA 2J7JA 1YUJA 2EMZA 2YTDA 2D9HA 2EM8A 2M9AA 2ADRA 4M9VC 2RSIA 1ZR9A 1BB8A 2EM6A 1JK2A 1X6EA 2DLKA 2EMHA 2EM4A 2MKDA 2RPCA 3EPLA 2NABA 3EPKA 2EN7A 2EMGA 1P47A 1ZU1A 2EOQA 2DRPA 2EPCA 2EN6A 1F2IG 2EOEA 2EL5A 2LT7A 2CSHA 1A1FA 2EPUA 2EPZA 1JK1A 2EQ0A 2EOXA 2EN3A 2EN8A 2EQ1A 2ELYA 1TN9A 2YTPA 1A1GA 2A25A 1UBDC 2WBUA 4R2DA 2EQ3A 2EOYA 5KL6A 1Z1BA 1A1JA 2EPAA 4R2QA 1TF6A 1BBOA 4F6NA 2WBTA 1A1KA 2EN4A 2YU5A 2EM3A 2BB8A 4GZNC 3MHHC 4FK5C 2YTGA 2YTQA 5KL4A 2EOHA 2R1FA 2EPPA 1X6HA 2EL4A 2WBSA 2EMBA 1X5WA 2EMKA 2JPAA 3VHTB 2EM5A 2EOFA 4IJDA 1TF3A 1X6FA 2EMFA 2EOIA 3MHSC 2DGCA 1A1HA 1NCSA 2YU8A 2EM7A 3EPHA 2EOJA 2MKNA 5KL3A 2CTDA 2EM0A 1DGCA 1RMDA 4X9JA 1MEYC 1ZAAC 2YRMA 2YTIA 2EPRA 2EMXA 3EPJA 2I13A 1YUIA 2EN1A 5KL7A 2YTEA 2EP3A 1YSAC 2GLIA 2ENHA 2PRTA 1A1LA 2EM9A 2LCEA 2EN2A 4WSGA 4R2CA 4F2JC 2VRDA 1AAYA 1G2DC 1X3CA 2YSOA 4F6MA 2EMWA 1UN6B 2EOOA 1G2FC 2DLQA 2JP9A 4R2PA 2WCC3 2EMLA 2E72A 2GHFA 4R2EA 5KL5A 4IS1C 2ENCA 2CT1A 2YTJA
chains in the Genus database with same CATH superfamily
5AASA 2LO3A 1AH5A 2N8XA 2EMIA 4JI6E 4LFAE 4R8OA 1XNQE 2LTSA 5A6KA 4DV3E 4L5NC 2EE8A 1A1IA 1PDAA 1I94E 2EORA 2NUGA 4HEIA 2V83A 2EL6A 4L8NA 4KZSA 5TSEA 2EMZA 1RQ0A 1IMUA 2Q8UA 2RSIA 1GZ6A 2EM4A 3AV0A 4F9CB 2DIXA 1HNXE 1EH7A 4LF5E 3EPKA 4ZYEA 2V86A 1EH6A 2EOQA 4J8ZA 4JI5E 4LF8E 1F2IG 2EOEA 2N3HA 2NUFA 2EL5A 2GPIA 1XMOE 1A1FA 2EPZA 4RHBB 5A6AA 4WFTA 1J5EE 2UXDE 4BC7A 2EN3A 4DR5E 4ZYHA 1N32E 4K0KE 1YFHA 2WBUA 4R2DA 2EOYA 3EQ1A 4B3ME 2FTXB 1BBOA 2UU9E 4BC9A 5FLXC 4BBYA 4ZYGA 2YU5A 4GKKE 2BB8A 4GZNC 4FK5C 4YY3E 2EOHA 5KL4A 4HTGA 1XMQE 3VYXA 2VQEE 3VHTB 3IWBA 4LU9A 4B3SE 2V87A 3H09A 2UUBE 5BR8E 2EM7A 3EPHA 3RMPA 5LLQA 4YHHE 1WXRA 1DGCA 3HPSA 1MEYC 3T1YE 2YRMA 2EPRA 3EPJA 2ZM6E 2EZ6A 3IWDA 1YSAC 2GLIA 2EM9A 3P1XA 2H36X 4DUZE 2YZTA 2MC6A 4WSGA 1N33E 2M1SA 5A69A 1GQEA 3ADJA 4M30A 1DQ3A 4WPYA 1N36E 2JVAA 2JP9A 4R2PA 1ZBTA 2G7HA 2WCC3 4DV2E 2EMLA 2JYAA 2KHXA 2I9IA 3C4TA 3TQMA 2E72A 4B3TE 2ENCA 2CT1A 2EOSA 3ECRA 4MLQA 2UUAE 5A2QC 3UK3C 2KOUA 4WXCA 5DNYA 2L2MA 4R2RA 4NHRA 2RS7A 5ADZA 3DF6A 4M0VA 5IXMB 2R76A 4LF9E 4DV1E 2DMIA 1T4NA 2MDGA 2HJJA 2VF1A 1YUJA 2DB2A 4JI3E 4DV4E 4X8WA 2EM8A 2M9AA 5T6JA 3BIDA 2EM6A 1JK2A 4NXNE 2RPCA 2L2KB 1T4OA 2UUCE 5A6BA 2UXCE 4RH8A 1YYOA 2EMGA 4KWYA 4X64E 3ADIA 2E1MA 1XNRE 4X65E 2LT7A 4F9BB 2EPUA 4JI1E 1WRJA 2V85A 2EOXA 5AE1A 4Q28A 3C6KA 2YWQA 1GTKA 1SR9A 1IQSA 3JU0A 2YTPA 2A25A 2DMYA 5F3WA 1UBDC 4X66E 1STUA 4OOGC 3J80C 5KL6A 2E5LE 2F4VE 2EPAA 2K7IA 4M2ZA 1T39A 2LJUA 4F9AB 2M4IA 2FGGA 2L8TA 4O24A 1IBME 2EPPA 3K6QA 1X6HA 2WBSA 4TUIA 3J7AG 1FJGE 2EM5A 1TF3A 2EMFA 4GEQB 2MC5A 3DJWA 4LF7E 4DR4E 2LRSA 3LLHA 1A1HA 2NUEA 4DR7E 2V8QB 1IBKE 4ZYDA 4WXDA 1RMDA 3FIGA 4X9JA 1ZAAC 5IT9C 2YTIA 2L6MA 2EN1A 2KONA 2L3JA 2ENHA 2PRTA 2RTXA 5A6BD 4R2CA 2BBGA 1X3CA 2N3GA 4F6MA 4NZVA 4JI7E 2EMWA 2WZOA 2EOOA 2JWOA 2LUPB 1N34E 4O5GA 1G2FC 3HTXA 2JOXA 3KZZA 1EH8A 4R2EA 5KL5A 1PKPA 3ADLA 2YTJA 1LLMC 2EMAA 2YSPA 3HQ1A 2EOMA 2CPNA 2ODRD 1WJPA 1T38A 2EJ4A 2EMCA 2HGHA 2YTFA 4JV5E 4JI2E 1BBGA 4R2SA 2LV2A 5A6JA 2LTRA 2HHHE 2EPKX 1UILA 2YTNA 1J26A 2LMZA 3HXLA 4DR1E 1NEIA 1X49A 4R2AA 2VQFE 4NXME 3JTZA 1PJTA 4WSPA 4JI0E 3THOB 4O43A 1DI2A 4BS9A 2YTDA 4DV5E 2ADRA 1ZR9A 2DLKA 3LMLA 4OX9E 3EPLA 2JXPA 3JAMC 1FKAE 1P47A 1ZU1A 2LBSB 2EPCA 4LFBE 3ADGA 5LL6R 3J7Yp 1HNZE 2CSHA 1YZ9A 1JK1A 1YPNA 4BHCA 2EQ0A 5AE2A 5LMUE 2M7QA 1WHNA 1IBLE 1SFEA 1A1GA 4F54A 4DMIA 2EQ3A 1A1JA 1HR0E 1TF6A 1A1KA 2WBTA 2EPLX 2V88A 4DR2E 3L00A 2YPNA 3MHHC 2B7VA 2R1FA 2EL4A 4LF4E 2EMBA 5AC5A 2FV4B 2EMKA 2JPAA 2EOFA 3VYYA 3MHSC 1X48A 1NCSA 1UHZA 2EOJA 2EPNA 3KWRA 5KL3A 1EKZA 1QU6A 2EM0A 2EPOA 4BMJA 2B7TA 2I13A 1YUIA 2YTEA 2EP3A 4GKJE 5IV8B 2RS6A 4X62E 2V89A 2UXBE 4JYAE 4BCAA 2LE2A 4F2JC 2VRDA 2YSOA 3THNA 2EPMX 5LMNE 1UN6B 4WX9A 2DLQA 3T1HE 2GHFA 4DUYE 4IS1C 3IWCA 2L3CA 2ELZA 3C4BA 3M99B 5AC4A 1ZBQA 5KL2A 4DV7E 1KJKA 2EOZA 4P78A 2YRHA 2ENAA 3AUZA 1KYQA 2EM2A 2EMYA 2RSMA 2YRKA 2EPXA 5CFFE 1B69A 2EWLA 1X47A 2B9DA 2YTOA 2YT4A 2ODRC 4AQYE 2LVHA 2J7JA 1WHQA 4DV0E 2D9HA 4M9VC 1BB8A 1X6EA 2EMHA 3BBGA 2JR1A 2MKDA 5IWAE 4MLVA 4N4RB 2NABA 5AE3A 2EN7A 3HPZA 1PJQA 2DRPA 3ZOQB 2EN6A 3OMLA 3J81C 1MGTA 3C6MA 4I8OA 2NA2A 1IQOA 2EN8A 4DV6E 4DR6E 2EQ1A 2ELYA 4B3RE 1TN9A 2L2NA 2L92A 4Q35B 1Z1BA 1L4SA 4R2QA 1O0WA 4F6NA 2EN4A 2EM3A 2B3TB 4LTYA 3VK6A 3F6GA 2YTGA 2YTQA 4KHPE 1X5WA 2IHR1 2RQLA 4JI4E 2JOBA 2DGCA 4IJDA 1X6FA 2EOIA 4O4KA 2L33A 1YYKA 3BGHA 2LJHA 3QG5C 2YU8A 2F8BA 2MKNA 4LF6E 1PJSA 2CTDA 1QNTA 4DKKA 4TUGA 3BF2A 3F6HA 4BHBA 4LFCE 2EMXA 4WYQB 5KL7A 1A1LA 2LCEA 4DR3E 2EN2A 4JI8E 4P7DA 3OTOE 3KZYA 1AAYA 1G2DC 4R03A 2DSYA 2HC5A 3MSWA 1RC7A 2LUQA 2MDRA 1T4LB 1HNWE 1YYWA 2VE7C 2K4VA 1N3GA 2JY9A
chains in the Genus database with same CATH topology
1LLMC 2EMAA 2EOSA 2YSPA 2EOMA 2ELZA 3M99B 3UK3C 2LO3A 5KL2A 1WJPA 1KJKA 2EJ4A 2EMCA 2EOZA 2HGHA 2YTFA 2EMIA 4R2SA 4R2RA 2YRHA 2LV2A 2ENAA 2EE8A 2EM2A 2EMYA 2YRKA 1A1IA 2YTNA 2EPXA 1B69A 2EORA 2YTOA 4R2AA 2DMIA 2EL6A 2LVHA 2MDGA 2J7JA 1YUJA 2EMZA 2YTDA 2D9HA 2EM8A 2M9AA 2ADRA 4M9VC 2RSIA 1ZR9A 1BB8A 2EM6A 1JK2A 1X6EA 2DLKA 2EMHA 2EM4A 2MKDA 2RPCA 3EPLA 2NABA 3EPKA 2EN7A 2EMGA 1P47A 1ZU1A 2EOQA 2DRPA 2EPCA 2EN6A 1F2IG 2EOEA 2EL5A 2LT7A 2CSHA 1A1FA 2EPUA 2EPZA 1JK1A 2EQ0A 2EOXA 2EN3A 2EN8A 2EQ1A 2ELYA 1TN9A 2YTPA 1A1GA 2A25A 1UBDC 2WBUA 4R2DA 2EQ3A 2EOYA 5KL6A 1Z1BA 1A1JA 2EPAA 4R2QA 1TF6A 1BBOA 4F6NA 2WBTA 1A1KA 2EN4A 2YU5A 2EM3A 2BB8A 4GZNC 3MHHC 4FK5C 2YTGA 2YTQA 5KL4A 2EOHA 2R1FA 2EPPA 1X6HA 2EL4A 2WBSA 2EMBA 1X5WA 2EMKA 2JPAA 3VHTB 2EM5A 2EOFA 4IJDA 1TF3A 1X6FA 2EMFA 2EOIA 3MHSC 2DGCA 1A1HA 1NCSA 2YU8A 2EM7A 3EPHA 2EOJA 2MKNA 5KL3A 2CTDA 2EM0A 1DGCA 1RMDA 4X9JA 1MEYC 1ZAAC 2YRMA 2YTIA 2EPRA 2EMXA 3EPJA 2I13A 1YUIA 2EN1A 5KL7A 2YTEA 2EP3A 1YSAC 2GLIA 2ENHA 2PRTA 1A1LA 2EM9A 2LCEA 2EN2A 4WSGA 4R2CA 4F2JC 2VRDA 1AAYA 1G2DC 1X3CA 2YSOA 4F6MA 2EMWA 1UN6B 2EOOA 1G2FC 2DLQA 2JP9A 4R2PA 2WCC3 2EMLA 2E72A 2GHFA 4R2EA 5KL5A 4IS1C 2ENCA 2CT1A 2YTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LLM C;  2EMA A;  2EOS A;  2YSP A;  2EOM A;  2ELZ A;  3M99 B;  3UK3 C;  2LO3 A;  5KL2 A;  1WJP A;  1KJK A;  2EJ4 A;  2EMC A;  2EOZ A;  2HGH A;  2YTF A;  2EMI A;  4R2S A;  4R2R A;  2YRH A;  2LV2 A;  2ENA A;  2EE8 A;  2EM2 A;  2EMY A;  2YRK A;  1A1I A;  2YTN A;  2EPX A;  1B69 A;  2EOR A;  2YTO A;  4R2A A;  2DMI A;  2EL6 A;  2LVH A;  2MDG A;  2J7J A;  1YUJ A;  2EMZ A;  2YTD A;  2D9H A;  2EM8 A;  2M9A A;  2ADR A;  4M9V C;  2RSI A;  1ZR9 A;  1BB8 A;  2EM6 A;  1JK2 A;  1X6E A;  2DLK A;  2EMH A;  2EM4 A;  2MKD A;  2RPC A;  3EPL A;  2NAB A;  3EPK A;  2EN7 A;  2EMG A;  1P47 A;  1ZU1 A;  2EOQ A;  2DRP A;  2EPC A;  2EN6 A;  1F2I G;  2EOE A;  2EL5 A;  2LT7 A;  2CSH A;  1A1F A;  2EPU A;  2EPZ A;  1JK1 A;  2EQ0 A;  2EOX A;  2EN3 A;  2EN8 A;  2EQ1 A;  2ELY A;  1TN9 A;  2YTP A;  1A1G A;  2A25 A;  1UBD C;  2WBU A;  4R2D A;  2EQ3 A;  2EOY A;  5KL6 A;  1Z1B A;  1A1J A;  2EPA A;  4R2Q A;  1TF6 A;  1BBO A;  4F6N A;  2WBT A;  1A1K A;  2EN4 A;  2YU5 A;  2EM3 A;  2BB8 A;  4GZN C;  3MHH C;  4FK5 C;  2YTG A;  2YTQ A;  5KL4 A;  2EOH A;  2R1F A;  2EPP A;  1X6H A;  2EL4 A;  2WBS A;  2EMB A;  1X5W A;  2EMK A;  2JPA A;  3VHT B;  2EM5 A;  2EOF A;  4IJD A;  1TF3 A;  1X6F A;  2EMF A;  2EOI A;  3MHS C;  2DGC A;  1A1H A;  1NCS A;  2YU8 A;  2EM7 A;  3EPH A;  2EOJ A;  2MKN A;  5KL3 A;  2CTD A;  2EM0 A;  1DGC A;  1RMD A;  4X9J A;  1MEY C;  1ZAA C;  2YRM A;  2YTI A;  2EPR A;  2EMX A;  3EPJ A;  2I13 A;  1YUI A;  2EN1 A;  5KL7 A;  2YTE A;  2EP3 A;  1YSA C;  2GLI A;  2ENH A;  2PRT A;  1A1L A;  2EM9 A;  2LCE A;  2EN2 A;  4WSG A;  4R2C A;  4F2J C;  2VRD A;  1AAY A;  1G2D C;  1X3C A;  2YSO A;  4F6M A;  2EMW A;  1UN6 B;  2EOO A;  1G2F C;  2DLQ A;  2JP9 A;  4R2P A;  2WCC 3;  2EML A;  2E72 A;  2GHF A;  4R2E A;  5KL5 A;  4IS1 C;  2ENC A;  2CT1 A;  2YTJ A; 
#chains in the Genus database with same CATH topology
 5AAS A;  2LO3 A;  1AH5 A;  2N8X A;  2EMI A;  4JI6 E;  4LFA E;  4R8O A;  1XNQ E;  2LTS A;  5A6K A;  4DV3 E;  4L5N C;  2EE8 A;  1A1I A;  1PDA A;  1I94 E;  2EOR A;  2NUG A;  4HEI A;  2V83 A;  2EL6 A;  4L8N A;  4KZS A;  5TSE A;  2EMZ A;  1RQ0 A;  1IMU A;  2Q8U A;  2RSI A;  1GZ6 A;  2EM4 A;  3AV0 A;  4F9C B;  2DIX A;  1HNX E;  1EH7 A;  4LF5 E;  3EPK A;  4ZYE A;  2V86 A;  1EH6 A;  2EOQ A;  4J8Z A;  4JI5 E;  4LF8 E;  1F2I G;  2EOE A;  2N3H A;  2NUF A;  2EL5 A;  2GPI A;  1XMO E;  1A1F A;  2EPZ A;  4RHB B;  5A6A A;  4WFT A;  1J5E E;  2UXD E;  4BC7 A;  2EN3 A;  4DR5 E;  4ZYH A;  1N32 E;  4K0K E;  1YFH A;  2WBU A;  4R2D A;  2EOY A;  3EQ1 A;  4B3M E;  2FTX B;  1BBO A;  2UU9 E;  4BC9 A;  5FLX C;  4BBY A;  4ZYG A;  2YU5 A;  4GKK E;  2BB8 A;  4GZN C;  4FK5 C;  4YY3 E;  2EOH A;  5KL4 A;  4HTG A;  1XMQ E;  3VYX A;  2VQE E;  3VHT B;  3IWB A;  4LU9 A;  4B3S E;  2V87 A;  3H09 A;  2UUB E;  5BR8 E;  2EM7 A;  3EPH A;  3RMP A;  5LLQ A;  4YHH E;  1WXR A;  1DGC A;  3HPS A;  1MEY C;  3T1Y E;  2YRM A;  2EPR A;  3EPJ A;  2ZM6 E;  2EZ6 A;  3IWD A;  1YSA C;  2GLI A;  2EM9 A;  3P1X A;  2H36 X;  4DUZ E;  2YZT A;  2MC6 A;  4WSG A;  1N33 E;  2M1S A;  5A69 A;  1GQE A;  3ADJ A;  4M30 A;  1DQ3 A;  4WPY A;  1N36 E;  2JVA A;  2JP9 A;  4R2P A;  1ZBT A;  2G7H A;  2WCC 3;  4DV2 E;  2EML A;  2JYA A;  2KHX A;  2I9I A;  3C4T A;  3TQM A;  2E72 A;  4B3T E;  2ENC A;  2CT1 A;  2EOS A;  3ECR A;  4MLQ A;  2UUA E;  5A2Q C;  3UK3 C;  2KOU A;  4WXC A;  5DNY A;  2L2M A;  4R2R A;  4NHR A;  2RS7 A;  5ADZ A;  3DF6 A;  4M0V A;  5IXM B;  2R76 A;  4LF9 E;  4DV1 E;  2DMI A;  1T4N A;  2MDG A;  2HJJ A;  2VF1 A;  1YUJ A;  2DB2 A;  4JI3 E;  4DV4 E;  4X8W A;  2EM8 A;  2M9A A;  5T6J A;  3BID A;  2EM6 A;  1JK2 A;  4NXN E;  2RPC A;  2L2K B;  1T4O A;  2UUC E;  5A6B A;  2UXC E;  4RH8 A;  1YYO A;  2EMG A;  4KWY A;  4X64 E;  3ADI A;  2E1M A;  1XNR E;  4X65 E;  2LT7 A;  4F9B B;  2EPU A;  4JI1 E;  1WRJ A;  2V85 A;  2EOX A;  5AE1 A;  4Q28 A;  3C6K A;  2YWQ A;  1GTK A;  1SR9 A;  1IQS A;  3JU0 A;  2YTP A;  2A25 A;  2DMY A;  5F3W A;  1UBD C;  4X66 E;  1STU A;  4OOG C;  3J80 C;  5KL6 A;  2E5L E;  2F4V E;  2EPA A;  2K7I A;  4M2Z A;  1T39 A;  2LJU A;  4F9A B;  2M4I A;  2FGG A;  2L8T A;  4O24 A;  1IBM E;  2EPP A;  3K6Q A;  1X6H A;  2WBS A;  4TUI A;  3J7A G;  1FJG E;  2EM5 A;  1TF3 A;  2EMF A;  4GEQ B;  2MC5 A;  3DJW A;  4LF7 E;  4DR4 E;  2LRS A;  3LLH A;  1A1H A;  2NUE A;  4DR7 E;  2V8Q B;  1IBK E;  4ZYD A;  4WXD A;  1RMD A;  3FIG A;  4X9J A;  1ZAA C;  5IT9 C;  2YTI A;  2L6M A;  2EN1 A;  2KON A;  2L3J A;  2ENH A;  2PRT A;  2RTX A;  5A6B D;  4R2C A;  2BBG A;  1X3C A;  2N3G A;  4F6M A;  4NZV A;  4JI7 E;  2EMW A;  2WZO A;  2EOO A;  2JWO A;  2LUP B;  1N34 E;  4O5G A;  1G2F C;  3HTX A;  2JOX A;  3KZZ A;  1EH8 A;  4R2E A;  5KL5 A;  1PKP A;  3ADL A;  2YTJ A;  1LLM C;  2EMA A;  2YSP A;  3HQ1 A;  2EOM A;  2CPN A;  2ODR D;  1WJP A;  1T38 A;  2EJ4 A;  2EMC A;  2HGH A;  2YTF A;  4JV5 E;  4JI2 E;  1BBG A;  4R2S A;  2LV2 A;  5A6J A;  2LTR A;  2HHH E;  2EPK X;  1UIL A;  2YTN A;  1J26 A;  2LMZ A;  3HXL A;  4DR1 E;  1NEI A;  1X49 A;  4R2A A;  2VQF E;  4NXM E;  3JTZ A;  1PJT A;  4WSP A;  4JI0 E;  3THO B;  4O43 A;  1DI2 A;  4BS9 A;  2YTD A;  4DV5 E;  2ADR A;  1ZR9 A;  2DLK A;  3LML A;  4OX9 E;  3EPL A;  2JXP A;  3JAM C;  1FKA E;  1P47 A;  1ZU1 A;  2LBS B;  2EPC A;  4LFB E;  3ADG A;  5LL6 R;  3J7Y p;  1HNZ E;  2CSH A;  1YZ9 A;  1JK1 A;  1YPN A;  4BHC A;  2EQ0 A;  5AE2 A;  5LMU E;  2M7Q A;  1WHN A;  1IBL E;  1SFE A;  1A1G A;  4F54 A;  4DMI A;  2EQ3 A;  1A1J A;  1HR0 E;  1TF6 A;  1A1K A;  2WBT A;  2EPL X;  2V88 A;  4DR2 E;  3L00 A;  2YPN A;  3MHH C;  2B7V A;  2R1F A;  2EL4 A;  4LF4 E;  2EMB A;  5AC5 A;  2FV4 B;  2EMK A;  2JPA A;  2EOF A;  3VYY A;  3MHS C;  1X48 A;  1NCS A;  1UHZ A;  2EOJ A;  2EPN A;  3KWR A;  5KL3 A;  1EKZ A;  1QU6 A;  2EM0 A;  2EPO A;  4BMJ A;  2B7T A;  2I13 A;  1YUI A;  2YTE A;  2EP3 A;  4GKJ E;  5IV8 B;  2RS6 A;  4X62 E;  2V89 A;  2UXB E;  4JYA E;  4BCA A;  2LE2 A;  4F2J C;  2VRD A;  2YSO A;  3THN A;  2EPM X;  5LMN E;  1UN6 B;  4WX9 A;  2DLQ A;  3T1H E;  2GHF A;  4DUY E;  4IS1 C;  3IWC A;  2L3C A;  2ELZ A;  3C4B A;  3M99 B;  5AC4 A;  1ZBQ A;  5KL2 A;  4DV7 E;  1KJK A;  2EOZ A;  4P78 A;  2YRH A;  2ENA A;  3AUZ A;  1KYQ A;  2EM2 A;  2EMY A;  2RSM A;  2YRK A;  2EPX A;  5CFF E;  1B69 A;  2EWL A;  1X47 A;  2B9D A;  2YTO A;  2YT4 A;  2ODR C;  4AQY E;  2LVH A;  2J7J A;  1WHQ A;  4DV0 E;  2D9H A;  4M9V C;  1BB8 A;  1X6E A;  2EMH A;  3BBG A;  2JR1 A;  2MKD A;  5IWA E;  4MLV A;  4N4R B;  2NAB A;  5AE3 A;  2EN7 A;  3HPZ A;  1PJQ A;  2DRP A;  3ZOQ B;  2EN6 A;  3OML A;  3J81 C;  1MGT A;  3C6M A;  4I8O A;  2NA2 A;  1IQO A;  2EN8 A;  4DV6 E;  4DR6 E;  2EQ1 A;  2ELY A;  4B3R E;  1TN9 A;  2L2N A;  2L92 A;  4Q35 B;  1Z1B A;  1L4S A;  4R2Q A;  1O0W A;  4F6N A;  2EN4 A;  2EM3 A;  2B3T B;  4LTY A;  3VK6 A;  3F6G A;  2YTG A;  2YTQ A;  4KHP E;  1X5W A;  2IHR 1;  2RQL A;  4JI4 E;  2JOB A;  2DGC A;  4IJD A;  1X6F A;  2EOI A;  4O4K A;  2L33 A;  1YYK A;  3BGH A;  2LJH A;  3QG5 C;  2YU8 A;  2F8B A;  2MKN A;  4LF6 E;  1PJS A;  2CTD A;  1QNT A;  4DKK A;  4TUG A;  3BF2 A;  3F6H A;  4BHB A;  4LFC E;  2EMX A;  4WYQ B;  5KL7 A;  1A1L A;  2LCE A;  4DR3 E;  2EN2 A;  4JI8 E;  4P7D A;  3OTO E;  3KZY A;  1AAY A;  1G2D C;  4R03 A;  2DSY A;  2HC5 A;  3MSW A;  1RC7 A;  2LUQ A;  2MDR A;  1T4L B;  1HNW E;  1YYW A;  2VE7 C;  2K4V A;  1N3G A;  2JY9 A; 
#chains in the Genus database with same CATH homology
 1LLM C;  2EMA A;  2EOS A;  2YSP A;  2EOM A;  2ELZ A;  3M99 B;  3UK3 C;  2LO3 A;  5KL2 A;  1WJP A;  1KJK A;  2EJ4 A;  2EMC A;  2EOZ A;  2HGH A;  2YTF A;  2EMI A;  4R2S A;  4R2R A;  2YRH A;  2LV2 A;  2ENA A;  2EE8 A;  2EM2 A;  2EMY A;  2YRK A;  1A1I A;  2YTN A;  2EPX A;  1B69 A;  2EOR A;  2YTO A;  4R2A A;  2DMI A;  2EL6 A;  2LVH A;  2MDG A;  2J7J A;  1YUJ A;  2EMZ A;  2YTD A;  2D9H A;  2EM8 A;  2M9A A;  2ADR A;  4M9V C;  2RSI A;  1ZR9 A;  1BB8 A;  2EM6 A;  1JK2 A;  1X6E A;  2DLK A;  2EMH A;  2EM4 A;  2MKD A;  2RPC A;  3EPL A;  2NAB A;  3EPK A;  2EN7 A;  2EMG A;  1P47 A;  1ZU1 A;  2EOQ A;  2DRP A;  2EPC A;  2EN6 A;  1F2I G;  2EOE A;  2EL5 A;  2LT7 A;  2CSH A;  1A1F A;  2EPU A;  2EPZ A;  1JK1 A;  2EQ0 A;  2EOX A;  2EN3 A;  2EN8 A;  2EQ1 A;  2ELY A;  1TN9 A;  2YTP A;  1A1G A;  2A25 A;  1UBD C;  2WBU A;  4R2D A;  2EQ3 A;  2EOY A;  5KL6 A;  1Z1B A;  1A1J A;  2EPA A;  4R2Q A;  1TF6 A;  1BBO A;  4F6N A;  2WBT A;  1A1K A;  2EN4 A;  2YU5 A;  2EM3 A;  2BB8 A;  4GZN C;  3MHH C;  4FK5 C;  2YTG A;  2YTQ A;  5KL4 A;  2EOH A;  2R1F A;  2EPP A;  1X6H A;  2EL4 A;  2WBS A;  2EMB A;  1X5W A;  2EMK A;  2JPA A;  3VHT B;  2EM5 A;  2EOF A;  4IJD A;  1TF3 A;  1X6F A;  2EMF A;  2EOI A;  3MHS C;  2DGC A;  1A1H A;  1NCS A;  2YU8 A;  2EM7 A;  3EPH A;  2EOJ A;  2MKN A;  5KL3 A;  2CTD A;  2EM0 A;  1DGC A;  1RMD A;  4X9J A;  1MEY C;  1ZAA C;  2YRM A;  2YTI A;  2EPR A;  2EMX A;  3EPJ A;  2I13 A;  1YUI A;  2EN1 A;  5KL7 A;  2YTE A;  2EP3 A;  1YSA C;  2GLI A;  2ENH A;  2PRT A;  1A1L A;  2EM9 A;  2LCE A;  2EN2 A;  4WSG A;  4R2C A;  4F2J C;  2VRD A;  1AAY A;  1G2D C;  1X3C A;  2YSO A;  4F6M A;  2EMW A;  1UN6 B;  2EOO A;  1G2F C;  2DLQ A;  2JP9 A;  4R2P A;  2WCC 3;  2EML A;  2E72 A;  2GHF A;  4R2E A;  5KL5 A;  4IS1 C;  2ENC A;  2CT1 A;  2YTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...