2EMAA

Solution structure of the c2h2 type zinc finger (region 312-344) of human zinc finger protein 347
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 312-344) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 347
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emaA01
2EOOA 2MDGA 2EOMA 2I13A 4GZNC 1JK2A 2EPXA 1BBOA 1NCSA 2EM0A 5KL4A 2D9HA 2EMIA 2YTNA 3EPHA 1JK1A 3EPLA 2VRDA 2EOHA 4X9JA 2WCC3 4R2PA 2YRKA 4R2SA 2ADRA 1TF6A 2EJ4A 2EMGA 2ENHA 2EOQA 2DGCA 2CTDA 2EPRA 2EL5A 2YTIA 1A1KA 1KJKA 2EN6A 2YTQA 1F2IG 2EOXA 2EM8A 2EM3A 1G2DC 2EL4A 4FK5C 2EPAA 3VHTB 1WJPA 4IJDA 2LCEA 2EM4A 4R2DA 2CSHA 1A1IA 1X6FA 5KL7A 2EORA 2DMIA 2YTOA 2YU8A 2WBTA 1BB8A 2EMZA 1A1LA 2EOEA 1A1FA 2YSPA 2EMBA 2YTEA 2EM5A 5KL5A 1YUIA 2YRMA 2EQ3A 2RSIA 1Z1BA 2DRPA 2GLIA 2EP3A 2DLQA 1TF3A 2YTDA 1X5WA 3EPKA 1ZR9A 2PRTA 2EQ0A 5KL6A 2EMKA 1ZU1A 4R2AA 3UK3C 3M99B 2JP9A 2EE8A 1X6EA 2YTGA 4R2QA 1UN6B 2DLKA 2EN2A 1P47A 2YRHA 2YTPA 2EPUA 2J7JA 2EMWA 2EPCA 2EMFA 4IS1C 2LV2A 2EMAA 1TN9A 1YSAC 2LO3A 2LT7A 2EN1A 2YU5A 2ELYA 2CT1A 4WSGA 2HGHA 2WBSA 2EQ1A 1B69A 2EN4A 2EM7A 2NABA 2M9AA 2GHFA 2MKNA 3MHHC 4R2CA 2EOJA 2BB8A 2EM6A 2WBUA 2R1FA 2EN7A 2E72A 2EMXA 2EMHA 2YTFA 2ENAA 3MHSC 4F6MA 2ELZA 2EPPA 2EOFA 2EL6A 2EPZA 1A1HA 2YSOA 1UBDC 1X3CA 2EN3A 2LVHA 4F2JC 4F6NA 1LLMC 2EOYA 1YUJA 2RPCA 4R2RA 1AAYA 5KL2A 2EM9A 1A1GA 1G2FC 2EN8A 1ZAAC 2EOZA 1X6HA 1RMDA 4R2EA 4M9VC 2MKDA 5KL3A 2A25A 2JPAA 2EMLA 2EOSA 1A1JA 2EM2A 1DGCA 2EMCA 3EPJA 2EOIA 2ENCA 2EMYA 1MEYC 2YTJA
chains in the Genus database with same CATH superfamily
5IWAE 4DV6E 1JK2A 4BHBA 5LMNE 2L92A 1DQ3A 3IWBA 4L8NA 2LUPB 2L2KB 5KL4A 3VYYA 3EQ1A 4M30A 3EPLA 4HEIA 4DR5E 1TF6A 3F6GA 2DGCA 4LTYA 4JYAE 2EPRA 2EL5A 1KJKA 2EN6A 1QU6A 2EL4A 4FK5C 5DNYA 1WJPA 3ZOQB 2EPOA 3IWDA 2LCEA 2EM4A 4R2DA 4J8ZA 1X6FA 1T4NA 1QNTA 2YT4A 1I94E 3DJWA 2N3GA 2YZTA 4DR7E 3VYXA 3JAMC 4LU9A 2JXPA 4LF8E 1XMQE 2DLQA 1X5WA 1IMUA 2PRTA 2EQ0A 2EMKA 5A2QC 2RS7A 4R2AA 2L3CA 3M99B 2VE7C 2JP9A 1X6EA 4R2QA 2DLKA 5AC4A 2NUEA 1YFHA 2EPUA 4DKKA 4LF9E 4IS1C 4LFBE 2LV2A 2L2NA 4B3ME 3IWCA 2JVAA 2EN1A 2FV4B 2LT7A 1IQSA 2WBSA 4JI7E 5T6JA 4YY3E 2MKNA 2DB2A 5IV8B 2EM6A 2JOXA 4DUZE 2EN7A 2V88A 1N33E 2E72A 1BBGA 2EMXA 3BGHA 2EMHA 3H09A 4DV5E 1WXRA 2YPNA 3MSWA 4DR3E 1T39A 2EPZA 2LJHA 2UUBE 4B3SE 3ADLA 3C4TA 5AC5A 1T4LB 2LVHA 2V8QB 4Q28A 5AE3A 4YHHE 4GKKE 3ADGA 3LLHA 4R2RA 1FJGE 5A6KA 1FKAE 4R2EA 1RMDA 2NUGA 4JI2E 3J7Yp 3HPSA 4LF7E 2A25A 4HTGA 2UUAE 4GKJE 5AE2A 4DV7E 2GPIA 4P78A 2E1MA 2NA2A 5BR8E 1YYKA 4F9CB 4TUIA 2MDGA 4TUGA 5TSEA 2I13A 2EPXA 4X8WA 1NCSA 2LTSA 2EM0A 1YPNA 4DV0E 2EMIA 1GZ6A 2M4IA 1J5EE 2VRDA 1JK1A 2EOHA 4WPYA 2WCC3 3DF6A 4WXDA 1T38A 1IQOA 2ENHA 3F6HA 3KZYA 1A1KA 1XMOE 2YTQA 1F2IG 2EOXA 2EM8A 4NHRA 1WRJA 2EM3A 3J7AG 2DSYA 3HTXA 3VHTB 3BBGA 4WX9A 3HXLA 1SFEA 5KL7A 2EORA 2LE2A 2YU8A 2WBTA 4B3RE 2EMZA 4OOGC 2EWLA 3FIGA 2EZ6A 2EOEA 1A1FA 2YSPA 2EMBA 2HJJA 2L2MA 2YTEA 5KL5A 2JWOA 2YRMA 1YUIA 2EQ3A 4DR4E 3BIDA 2RSIA 1Z1BA 2GLIA 1XNQE 1TF3A 5A6JA 4LFAE 2B7VA 3JU0A 2UXDE 3QG5C 2LRSA 4KWYA 2NUFA 5A6BD 1X47A 1UN6B 2K4VA 2YRHA 2YTPA 5IT9C 2UU9E 1HNWE 5IXMB 2E5LE 4RHBB 4WSPA 2EPCA 4X66E 2RQLA 4BC7A 1TN9A 2IHR1 4K0KE 4O5GA 1UILA 3TQMA 2CT1A 5A6AA 4ZYHA 4GEQB 2GHFA 1XNRE 2EPNA 4R2CA 2V83A 2R1FA 2CPNA 1J26A 2B9DA 2JY9A 2RS6A 3LMLA 4MLQA 1YZ9A 4F6NA 2DIXA 4DR1E 5ADZA 4B3TE 2RPCA 4DMIA 1A1GA 1ZBTA 2H36X 4JI4E 3P1XA 4M9VC 5KL3A 1YYWA 4JI8E 2MC5A 2ODRC 3ADJA 4WYQB 1PDAA 3C4BA 2EOSA 4ZYEA 1A1JA 2EMCA 1N36E 2EOIA 3C6KA 2EOOA 2L6MA 4GZNC 4JV5E 2VF1A 1HR0E 1RC7A 2D9HA 4X62E 2YTNA 4MLVA 4ZYDA 4OX9E 4R03A 4X9JA 2YRKA 1UHZA 4R2SA 4JI1E 2EJ4A 2EOQA 4P7DA 2CTDA 2LBSB 4DV2E 2JYAA 2B3TB 3AUZA 3BF2A 1WHQA 1G2DC 1IBME 4M0VA 4LF6E 2L8TA 4NZVA 4L5NC 2DMIA 2YTOA 5A69A 4BHCA 1BB8A 2YWQA 1A1LA 1YYOA 4DV4E 2EM5A 4LF5E 4BBYA 4R8OA 2DRPA 2EP3A 4X64E 2YTDA 4ZYGA 1AH5A 2KOUA 1ZR9A 5KL6A 1ZU1A 5AE1A 2LUQA 1EH7A 4JI5E 2YTGA 4DR2E 1P47A 2F4VE 1MGTA 1GTKA 2J7JA 2EMWA 2M7QA 1EKZA 1L4SA 1YSAC 2LO3A 2V86A 4WSGA 5A6BA 2HGHA 3K6QA 4O43A 3T1HE 2N8XA 2NABA 3J80C 2FTXB 3MHHC 3J81C 3C6MA 1HNXE 1EH8A 3MHSC 4BC9A 4DV1E 2V85A 4KZSA 3AV0A 2L33A 2EOFA 2EL6A 4BS9A 4NXNE 1X49A 1N32E 1UBDC 1PJTA 2EN3A 4F2JC 3HQ1A 3OTOE 2ZM6E 2EOYA 1RQ0A 2UUCE 1YUJA 2HHHE 1AAYA 1DI2A 5KL2A 2EM9A 2LTRA 1ZAAC 2EOZA 1X6HA 4LFCE 2MKDA 2JPAA 2EMLA 2M1SA 2N3HA 4DR6E 4LF4E 3KWRA 1ZBQA 3THOB 5LL6R 2FGGA 5LLQA 3THNA 2ENCA 1PKPA 4DUYE 2DMYA 2EOMA 2KHXA 2ODRD 2RSMA 1BBOA 3KZZA 4O24A 1IBKE 5FLXC 4JI6E 3EPHA 1WHNA 2RTXA 1N3GA 4R2PA 1NEIA 2ADRA 2EMGA 2YTIA 1STUA 4AQYE 1HNZE 2EPAA 2KONA 4IJDA 1T4OA 2CSHA 1A1IA 1IBLE 2UXBE 4I8OA 2K7IA 2V87A 3OMLA 5LMUE 2BBGA 5CFFE 2EPLX 3ADIA 1EH6A 4RH8A 2G7HA 4N4RB 2F8BA 3RMPA 3EPKA 5AASA 2L3JA 1O0WA 4F9AB 2JOBA 3HPZA 1PJQA 3UK3C 2EE8A 5F3WA 2EN2A 1SR9A 4KHPE 2EMFA 4BCAA 2I9IA 2EMAA 4WXCA 2YU5A 2ELYA 2EQ1A 1B69A 4F9BB 2MC6A 2EN4A 2EM7A 4NXME 2M9AA 1GQEA 2UXCE 2EOJA 2BB8A 2HC5A 2LMZA 2Q8UA 2WBUA 4M2ZA 2YTFA 4F54A 2ENAA 4DV3E 4F6MA 2ELZA 2R76A 4JI0E 2EPPA 4O4KA 4JI3E 4X65E 1A1HA 2YSOA 2EPKX 2EPMX 1X3CA 1KYQA 2JR1A 2LJUA 3ECRA 1LLMC 3T1YE 4BMJA 2VQEE 1G2FC 2EN8A 3VK6A 2VQFE 2MDRA 1N34E 3JTZA 4Q35B 1X48A 2EM2A 2WZOA 2B7TA 2V89A 1DGCA 3EPJA 3L00A 4WFTA 1PJSA 2EMYA 1MEYC 2YTJA
chains in the Genus database with same CATH topology
2EOOA 2MDGA 2EOMA 2I13A 4GZNC 1JK2A 2EPXA 1BBOA 1NCSA 2EM0A 5KL4A 2D9HA 2EMIA 2YTNA 3EPHA 1JK1A 3EPLA 2VRDA 2EOHA 4X9JA 2WCC3 4R2PA 2YRKA 4R2SA 2ADRA 1TF6A 2EJ4A 2EMGA 2ENHA 2EOQA 2DGCA 2CTDA 2EPRA 2EL5A 2YTIA 1A1KA 1KJKA 2EN6A 2YTQA 1F2IG 2EOXA 2EM8A 2EM3A 1G2DC 2EL4A 4FK5C 2EPAA 3VHTB 1WJPA 4IJDA 2LCEA 2EM4A 4R2DA 2CSHA 1A1IA 1X6FA 5KL7A 2EORA 2DMIA 2YTOA 2YU8A 2WBTA 1BB8A 2EMZA 1A1LA 2EOEA 1A1FA 2YSPA 2EMBA 2YTEA 2EM5A 5KL5A 1YUIA 2YRMA 2EQ3A 2RSIA 1Z1BA 2DRPA 2GLIA 2EP3A 2DLQA 1TF3A 2YTDA 1X5WA 3EPKA 1ZR9A 2PRTA 2EQ0A 5KL6A 2EMKA 1ZU1A 4R2AA 3UK3C 3M99B 2JP9A 2EE8A 1X6EA 2YTGA 4R2QA 1UN6B 2DLKA 2EN2A 1P47A 2YRHA 2YTPA 2EPUA 2J7JA 2EMWA 2EPCA 2EMFA 4IS1C 2LV2A 2EMAA 1TN9A 1YSAC 2LO3A 2LT7A 2EN1A 2YU5A 2ELYA 2CT1A 4WSGA 2HGHA 2WBSA 2EQ1A 1B69A 2EN4A 2EM7A 2NABA 2M9AA 2GHFA 2MKNA 3MHHC 4R2CA 2EOJA 2BB8A 2EM6A 2WBUA 2R1FA 2EN7A 2E72A 2EMXA 2EMHA 2YTFA 2ENAA 3MHSC 4F6MA 2ELZA 2EPPA 2EOFA 2EL6A 2EPZA 1A1HA 2YSOA 1UBDC 1X3CA 2EN3A 2LVHA 4F2JC 4F6NA 1LLMC 2EOYA 1YUJA 2RPCA 4R2RA 1AAYA 5KL2A 2EM9A 1A1GA 1G2FC 2EN8A 1ZAAC 2EOZA 1X6HA 1RMDA 4R2EA 4M9VC 2MKDA 5KL3A 2A25A 2JPAA 2EMLA 2EOSA 1A1JA 2EM2A 1DGCA 2EMCA 3EPJA 2EOIA 2ENCA 2EMYA 1MEYC 2YTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOO A;  2MDG A;  2EOM A;  2I13 A;  4GZN C;  1JK2 A;  2EPX A;  1BBO A;  1NCS A;  2EM0 A;  5KL4 A;  2D9H A;  2EMI A;  2YTN A;  3EPH A;  1JK1 A;  3EPL A;  2VRD A;  2EOH A;  4X9J A;  2WCC 3;  4R2P A;  2YRK A;  4R2S A;  2ADR A;  1TF6 A;  2EJ4 A;  2EMG A;  2ENH A;  2EOQ A;  2DGC A;  2CTD A;  2EPR A;  2EL5 A;  2YTI A;  1A1K A;  1KJK A;  2EN6 A;  2YTQ A;  1F2I G;  2EOX A;  2EM8 A;  2EM3 A;  1G2D C;  2EL4 A;  4FK5 C;  2EPA A;  3VHT B;  1WJP A;  4IJD A;  2LCE A;  2EM4 A;  4R2D A;  2CSH A;  1A1I A;  1X6F A;  5KL7 A;  2EOR A;  2DMI A;  2YTO A;  2YU8 A;  2WBT A;  1BB8 A;  2EMZ A;  1A1L A;  2EOE A;  1A1F A;  2YSP A;  2EMB A;  2YTE A;  2EM5 A;  5KL5 A;  1YUI A;  2YRM A;  2EQ3 A;  2RSI A;  1Z1B A;  2DRP A;  2GLI A;  2EP3 A;  2DLQ A;  1TF3 A;  2YTD A;  1X5W A;  3EPK A;  1ZR9 A;  2PRT A;  2EQ0 A;  5KL6 A;  2EMK A;  1ZU1 A;  4R2A A;  3UK3 C;  3M99 B;  2JP9 A;  2EE8 A;  1X6E A;  2YTG A;  4R2Q A;  1UN6 B;  2DLK A;  2EN2 A;  1P47 A;  2YRH A;  2YTP A;  2EPU A;  2J7J A;  2EMW A;  2EPC A;  2EMF A;  4IS1 C;  2LV2 A;  2EMA A;  1TN9 A;  1YSA C;  2LO3 A;  2LT7 A;  2EN1 A;  2YU5 A;  2ELY A;  2CT1 A;  4WSG A;  2HGH A;  2WBS A;  2EQ1 A;  1B69 A;  2EN4 A;  2EM7 A;  2NAB A;  2M9A A;  2GHF A;  2MKN A;  3MHH C;  4R2C A;  2EOJ A;  2BB8 A;  2EM6 A;  2WBU A;  2R1F A;  2EN7 A;  2E72 A;  2EMX A;  2EMH A;  2YTF A;  2ENA A;  3MHS C;  4F6M A;  2ELZ A;  2EPP A;  2EOF A;  2EL6 A;  2EPZ A;  1A1H A;  2YSO A;  1UBD C;  1X3C A;  2EN3 A;  2LVH A;  4F2J C;  4F6N A;  1LLM C;  2EOY A;  1YUJ A;  2RPC A;  4R2R A;  1AAY A;  5KL2 A;  2EM9 A;  1A1G A;  1G2F C;  2EN8 A;  1ZAA C;  2EOZ A;  1X6H A;  1RMD A;  4R2E A;  4M9V C;  2MKD A;  5KL3 A;  2A25 A;  2JPA A;  2EML A;  2EOS A;  1A1J A;  2EM2 A;  1DGC A;  2EMC A;  3EPJ A;  2EOI A;  2ENC A;  2EMY A;  1MEY C;  2YTJ A; 
#chains in the Genus database with same CATH topology
 5IWA E;  4DV6 E;  1JK2 A;  4BHB A;  5LMN E;  2L92 A;  1DQ3 A;  3IWB A;  4L8N A;  2LUP B;  2L2K B;  5KL4 A;  3VYY A;  3EQ1 A;  4M30 A;  3EPL A;  4HEI A;  4DR5 E;  1TF6 A;  3F6G A;  2DGC A;  4LTY A;  4JYA E;  2EPR A;  2EL5 A;  1KJK A;  2EN6 A;  1QU6 A;  2EL4 A;  4FK5 C;  5DNY A;  1WJP A;  3ZOQ B;  2EPO A;  3IWD A;  2LCE A;  2EM4 A;  4R2D A;  4J8Z A;  1X6F A;  1T4N A;  1QNT A;  2YT4 A;  1I94 E;  3DJW A;  2N3G A;  2YZT A;  4DR7 E;  3VYX A;  3JAM C;  4LU9 A;  2JXP A;  4LF8 E;  1XMQ E;  2DLQ A;  1X5W A;  1IMU A;  2PRT A;  2EQ0 A;  2EMK A;  5A2Q C;  2RS7 A;  4R2A A;  2L3C A;  3M99 B;  2VE7 C;  2JP9 A;  1X6E A;  4R2Q A;  2DLK A;  5AC4 A;  2NUE A;  1YFH A;  2EPU A;  4DKK A;  4LF9 E;  4IS1 C;  4LFB E;  2LV2 A;  2L2N A;  4B3M E;  3IWC A;  2JVA A;  2EN1 A;  2FV4 B;  2LT7 A;  1IQS A;  2WBS A;  4JI7 E;  5T6J A;  4YY3 E;  2MKN A;  2DB2 A;  5IV8 B;  2EM6 A;  2JOX A;  4DUZ E;  2EN7 A;  2V88 A;  1N33 E;  2E72 A;  1BBG A;  2EMX A;  3BGH A;  2EMH A;  3H09 A;  4DV5 E;  1WXR A;  2YPN A;  3MSW A;  4DR3 E;  1T39 A;  2EPZ A;  2LJH A;  2UUB E;  4B3S E;  3ADL A;  3C4T A;  5AC5 A;  1T4L B;  2LVH A;  2V8Q B;  4Q28 A;  5AE3 A;  4YHH E;  4GKK E;  3ADG A;  3LLH A;  4R2R A;  1FJG E;  5A6K A;  1FKA E;  4R2E A;  1RMD A;  2NUG A;  4JI2 E;  3J7Y p;  3HPS A;  4LF7 E;  2A25 A;  4HTG A;  2UUA E;  4GKJ E;  5AE2 A;  4DV7 E;  2GPI A;  4P78 A;  2E1M A;  2NA2 A;  5BR8 E;  1YYK A;  4F9C B;  4TUI A;  2MDG A;  4TUG A;  5TSE A;  2I13 A;  2EPX A;  4X8W A;  1NCS A;  2LTS A;  2EM0 A;  1YPN A;  4DV0 E;  2EMI A;  1GZ6 A;  2M4I A;  1J5E E;  2VRD A;  1JK1 A;  2EOH A;  4WPY A;  2WCC 3;  3DF6 A;  4WXD A;  1T38 A;  1IQO A;  2ENH A;  3F6H A;  3KZY A;  1A1K A;  1XMO E;  2YTQ A;  1F2I G;  2EOX A;  2EM8 A;  4NHR A;  1WRJ A;  2EM3 A;  3J7A G;  2DSY A;  3HTX A;  3VHT B;  3BBG A;  4WX9 A;  3HXL A;  1SFE A;  5KL7 A;  2EOR A;  2LE2 A;  2YU8 A;  2WBT A;  4B3R E;  2EMZ A;  4OOG C;  2EWL A;  3FIG A;  2EZ6 A;  2EOE A;  1A1F A;  2YSP A;  2EMB A;  2HJJ A;  2L2M A;  2YTE A;  5KL5 A;  2JWO A;  2YRM A;  1YUI A;  2EQ3 A;  4DR4 E;  3BID A;  2RSI A;  1Z1B A;  2GLI A;  1XNQ E;  1TF3 A;  5A6J A;  4LFA E;  2B7V A;  3JU0 A;  2UXD E;  3QG5 C;  2LRS A;  4KWY A;  2NUF A;  5A6B D;  1X47 A;  1UN6 B;  2K4V A;  2YRH A;  2YTP A;  5IT9 C;  2UU9 E;  1HNW E;  5IXM B;  2E5L E;  4RHB B;  4WSP A;  2EPC A;  4X66 E;  2RQL A;  4BC7 A;  1TN9 A;  2IHR 1;  4K0K E;  4O5G A;  1UIL A;  3TQM A;  2CT1 A;  5A6A A;  4ZYH A;  4GEQ B;  2GHF A;  1XNR E;  2EPN A;  4R2C A;  2V83 A;  2R1F A;  2CPN A;  1J26 A;  2B9D A;  2JY9 A;  2RS6 A;  3LML A;  4MLQ A;  1YZ9 A;  4F6N A;  2DIX A;  4DR1 E;  5ADZ A;  4B3T E;  2RPC A;  4DMI A;  1A1G A;  1ZBT A;  2H36 X;  4JI4 E;  3P1X A;  4M9V C;  5KL3 A;  1YYW A;  4JI8 E;  2MC5 A;  2ODR C;  3ADJ A;  4WYQ B;  1PDA A;  3C4B A;  2EOS A;  4ZYE A;  1A1J A;  2EMC A;  1N36 E;  2EOI A;  3C6K A;  2EOO A;  2L6M A;  4GZN C;  4JV5 E;  2VF1 A;  1HR0 E;  1RC7 A;  2D9H A;  4X62 E;  2YTN A;  4MLV A;  4ZYD A;  4OX9 E;  4R03 A;  4X9J A;  2YRK A;  1UHZ A;  4R2S A;  4JI1 E;  2EJ4 A;  2EOQ A;  4P7D A;  2CTD A;  2LBS B;  4DV2 E;  2JYA A;  2B3T B;  3AUZ A;  3BF2 A;  1WHQ A;  1G2D C;  1IBM E;  4M0V A;  4LF6 E;  2L8T A;  4NZV A;  4L5N C;  2DMI A;  2YTO A;  5A69 A;  4BHC A;  1BB8 A;  2YWQ A;  1A1L A;  1YYO A;  4DV4 E;  2EM5 A;  4LF5 E;  4BBY A;  4R8O A;  2DRP A;  2EP3 A;  4X64 E;  2YTD A;  4ZYG A;  1AH5 A;  2KOU A;  1ZR9 A;  5KL6 A;  1ZU1 A;  5AE1 A;  2LUQ A;  1EH7 A;  4JI5 E;  2YTG A;  4DR2 E;  1P47 A;  2F4V E;  1MGT A;  1GTK A;  2J7J A;  2EMW A;  2M7Q A;  1EKZ A;  1L4S A;  1YSA C;  2LO3 A;  2V86 A;  4WSG A;  5A6B A;  2HGH A;  3K6Q A;  4O43 A;  3T1H E;  2N8X A;  2NAB A;  3J80 C;  2FTX B;  3MHH C;  3J81 C;  3C6M A;  1HNX E;  1EH8 A;  3MHS C;  4BC9 A;  4DV1 E;  2V85 A;  4KZS A;  3AV0 A;  2L33 A;  2EOF A;  2EL6 A;  4BS9 A;  4NXN E;  1X49 A;  1N32 E;  1UBD C;  1PJT A;  2EN3 A;  4F2J C;  3HQ1 A;  3OTO E;  2ZM6 E;  2EOY A;  1RQ0 A;  2UUC E;  1YUJ A;  2HHH E;  1AAY A;  1DI2 A;  5KL2 A;  2EM9 A;  2LTR A;  1ZAA C;  2EOZ A;  1X6H A;  4LFC E;  2MKD A;  2JPA A;  2EML A;  2M1S A;  2N3H A;  4DR6 E;  4LF4 E;  3KWR A;  1ZBQ A;  3THO B;  5LL6 R;  2FGG A;  5LLQ A;  3THN A;  2ENC A;  1PKP A;  4DUY E;  2DMY A;  2EOM A;  2KHX A;  2ODR D;  2RSM A;  1BBO A;  3KZZ A;  4O24 A;  1IBK E;  5FLX C;  4JI6 E;  3EPH A;  1WHN A;  2RTX A;  1N3G A;  4R2P A;  1NEI A;  2ADR A;  2EMG A;  2YTI A;  1STU A;  4AQY E;  1HNZ E;  2EPA A;  2KON A;  4IJD A;  1T4O A;  2CSH A;  1A1I A;  1IBL E;  2UXB E;  4I8O A;  2K7I A;  2V87 A;  3OML A;  5LMU E;  2BBG A;  5CFF E;  2EPL X;  3ADI A;  1EH6 A;  4RH8 A;  2G7H A;  4N4R B;  2F8B A;  3RMP A;  3EPK A;  5AAS A;  2L3J A;  1O0W A;  4F9A B;  2JOB A;  3HPZ A;  1PJQ A;  3UK3 C;  2EE8 A;  5F3W A;  2EN2 A;  1SR9 A;  4KHP E;  2EMF A;  4BCA A;  2I9I A;  2EMA A;  4WXC A;  2YU5 A;  2ELY A;  2EQ1 A;  1B69 A;  4F9B B;  2MC6 A;  2EN4 A;  2EM7 A;  4NXM E;  2M9A A;  1GQE A;  2UXC E;  2EOJ A;  2BB8 A;  2HC5 A;  2LMZ A;  2Q8U A;  2WBU A;  4M2Z A;  2YTF A;  4F54 A;  2ENA A;  4DV3 E;  4F6M A;  2ELZ A;  2R76 A;  4JI0 E;  2EPP A;  4O4K A;  4JI3 E;  4X65 E;  1A1H A;  2YSO A;  2EPK X;  2EPM X;  1X3C A;  1KYQ A;  2JR1 A;  2LJU A;  3ECR A;  1LLM C;  3T1Y E;  4BMJ A;  2VQE E;  1G2F C;  2EN8 A;  3VK6 A;  2VQF E;  2MDR A;  1N34 E;  3JTZ A;  4Q35 B;  1X48 A;  2EM2 A;  2WZO A;  2B7T A;  2V89 A;  1DGC A;  3EPJ A;  3L00 A;  4WFT A;  1PJS A;  2EMY A;  1MEY C;  2YTJ A; 
#chains in the Genus database with same CATH homology
 2EOO A;  2MDG A;  2EOM A;  2I13 A;  4GZN C;  1JK2 A;  2EPX A;  1BBO A;  1NCS A;  2EM0 A;  5KL4 A;  2D9H A;  2EMI A;  2YTN A;  3EPH A;  1JK1 A;  3EPL A;  2VRD A;  2EOH A;  4X9J A;  2WCC 3;  4R2P A;  2YRK A;  4R2S A;  2ADR A;  1TF6 A;  2EJ4 A;  2EMG A;  2ENH A;  2EOQ A;  2DGC A;  2CTD A;  2EPR A;  2EL5 A;  2YTI A;  1A1K A;  1KJK A;  2EN6 A;  2YTQ A;  1F2I G;  2EOX A;  2EM8 A;  2EM3 A;  1G2D C;  2EL4 A;  4FK5 C;  2EPA A;  3VHT B;  1WJP A;  4IJD A;  2LCE A;  2EM4 A;  4R2D A;  2CSH A;  1A1I A;  1X6F A;  5KL7 A;  2EOR A;  2DMI A;  2YTO A;  2YU8 A;  2WBT A;  1BB8 A;  2EMZ A;  1A1L A;  2EOE A;  1A1F A;  2YSP A;  2EMB A;  2YTE A;  2EM5 A;  5KL5 A;  1YUI A;  2YRM A;  2EQ3 A;  2RSI A;  1Z1B A;  2DRP A;  2GLI A;  2EP3 A;  2DLQ A;  1TF3 A;  2YTD A;  1X5W A;  3EPK A;  1ZR9 A;  2PRT A;  2EQ0 A;  5KL6 A;  2EMK A;  1ZU1 A;  4R2A A;  3UK3 C;  3M99 B;  2JP9 A;  2EE8 A;  1X6E A;  2YTG A;  4R2Q A;  1UN6 B;  2DLK A;  2EN2 A;  1P47 A;  2YRH A;  2YTP A;  2EPU A;  2J7J A;  2EMW A;  2EPC A;  2EMF A;  4IS1 C;  2LV2 A;  2EMA A;  1TN9 A;  1YSA C;  2LO3 A;  2LT7 A;  2EN1 A;  2YU5 A;  2ELY A;  2CT1 A;  4WSG A;  2HGH A;  2WBS A;  2EQ1 A;  1B69 A;  2EN4 A;  2EM7 A;  2NAB A;  2M9A A;  2GHF A;  2MKN A;  3MHH C;  4R2C A;  2EOJ A;  2BB8 A;  2EM6 A;  2WBU A;  2R1F A;  2EN7 A;  2E72 A;  2EMX A;  2EMH A;  2YTF A;  2ENA A;  3MHS C;  4F6M A;  2ELZ A;  2EPP A;  2EOF A;  2EL6 A;  2EPZ A;  1A1H A;  2YSO A;  1UBD C;  1X3C A;  2EN3 A;  2LVH A;  4F2J C;  4F6N A;  1LLM C;  2EOY A;  1YUJ A;  2RPC A;  4R2R A;  1AAY A;  5KL2 A;  2EM9 A;  1A1G A;  1G2F C;  2EN8 A;  1ZAA C;  2EOZ A;  1X6H A;  1RMD A;  4R2E A;  4M9V C;  2MKD A;  5KL3 A;  2A25 A;  2JPA A;  2EML A;  2EOS A;  1A1J A;  2EM2 A;  1DGC A;  2EMC A;  3EPJ A;  2EOI A;  2ENC A;  2EMY A;  1MEY C;  2YTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...