2EMAA

Solution structure of the c2h2 type zinc finger (region 312-344) of human zinc finger protein 347
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 312-344) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emaA01
2LT7A 2JP9A 2NABA 2VRDA 2YTPA 5KL4A 3UK3C 2CSHA 2EOXA 2EQ3A 4R2RA 2EMBA 2EM9A 2YTOA 2R1FA 2LO3A 1Z1BA 1RMDA 3EPHA 2EOOA 1G2FC 2YTNA 2EOFA 2LCEA 2EPXA 2GHFA 2EN2A 4R2EA 1X6HA 1UN6B 1A1LA 2YTJA 4F6MA 2A25A 2EOJA 2M9AA 5KL3A 1X6EA 2EJ4A 2EPPA 2ENAA 2EMCA 1A1KA 2EL6A 4FK5C 2EM8A 2CTDA 5KL7A 2EMIA 3MHSC 1A1IA 1BB8A 1NCSA 1A1FA 2EOEA 2EMGA 4M9VC 1ZAAC 2EPZA 2LV2A 4R2PA 5KL2A 1YUJA 2EM2A 3MHHC 1G2DC 2EM0A 2EQ1A 2YTGA 4IJDA 2DLKA 1X3CA 2HGHA 1A1HA 2MDGA 2EMLA 2RPCA 4GZNC 2E72A 2EPAA 1P47A 1F2IG 2EOIA 2EMKA 2EOMA 2WCC3 1TF3A 2CT1A 2EL5A 1LLMC 1DGCA 4X9JA 2EMWA 4F6NA 2MKDA 1TF6A 2EMZA 2YU5A 1JK2A 2ENCA 2EN7A 1JK1A 2EPCA 2YRMA 2DRPA 2EL4A 2BB8A 2DMIA 4WSGA 2EN6A 2EPUA 2EOZA 2LVHA 1YSAC 2YTFA 2ELZA 2EQ0A 2EM6A 2YTIA 2ELYA 2EORA 3EPLA 2YTQA 2EM3A 2EE8A 1WJPA 1X6FA 1ZU1A 2EN1A 2EOYA 4F2JC 3EPJA 2GLIA 2ADRA 2YTEA 2EOQA 3M99B 2JPAA 1TN9A 3VHTB 2EMHA 4R2DA 1AAYA 2RSIA 2WBTA 2PRTA 2EN8A 2WBUA 2EMXA 4R2AA 2EOSA 2MKNA 2EN3A 2DGCA 1A1GA 1A1JA 1YUIA 1B69A 4R2CA 2EMAA 1BBOA 2EMYA 2EMFA 2EN4A 2DLQA 2ENHA 5KL5A 2EPRA 2EM4A 3EPKA 2EM7A 2YSOA 4R2QA 1ZR9A 2YTDA 2YSPA 2J7JA 2I13A 2WBSA 2EP3A 2EM5A 4IS1C 2EOHA 2YRHA 1MEYC 1KJKA 4R2SA 1X5WA 2YRKA 2YU8A 2D9HA 5KL6A 1UBDC
chains in the Genus database with same CATH superfamily
5T6JA 4X64E 2VRDA 2YTPA 2EOXA 2LBSB 1HNXE 2MC5A 4B3ME 4WFTA 2EM9A 1YPNA 1EKZA 1PKPA 2LTSA 2YTNA 2EPXA 3H09A 4JV5E 4DV5E 4JI2E 2N3HA 1A1LA 5CFFE 1RC7A 2M9AA 1X6EA 1XMQE 4JI3E 1A1KA 4FK5C 5A6BD 3C6MA 1GZ6A 4BC9A 3THNA 5KL7A 3MHSC 2KONA 2RSMA 1NCSA 2M4IA 4GKKE 4R8OA 1XMOE 4O4KA 3FIGA 1YUJA 4DR4E 1G2DC 3RMPA 2R76A 1IMUA 3LMLA 2HGHA 2ODRC 2EWLA 2KHXA 1ZBQA 2VF1A 4NHRA 4LFBE 2L92A 5AE2A 1LLMC 1TF3A 4GEQB 4X9JA 1J26A 2B3TB 4DMIA 4GKJE 3DJWA 4BBYA 1TF6A 4JI0E 2LE2A 1JK1A 4K0KE 2KOUA 2BB8A 2HJJA 2LVHA 2EOZA 4NZVA 2EM6A 1ZBTA 4X65E 2DSYA 2EM3A 2GPIA 1X6FA 1ZU1A 4N4RB 2GLIA 4ZYHA 3EPJA 1O0WA 4MLQA 2ADRA 4P7DA 3M99B 2VQEE 1TN9A 4OX9E 2RSIA 2PRTA 3JU0A 2EN8A 2WBUA 2LUQA 4R2CA 1T38A 2NA2A 2LUPB 2EMFA 4B3RE 3QG5C 4DV6E 2L2MA 2UXDE 4R03A 2EM7A 4HTGA 4DR3E 4HEIA 2YZTA 4RH8A 4F9CB 2WBSA 2V85A 2MC6A 2EOHA 3C4BA 5BR8E 1EH6A 2YU8A 3VK6A 1IBME 2V8QB 3K6QA 3J7AG 4J8ZA 2LO3A 2EZ6A 2BBGA 5FLXC 3EPHA 2EOOA 4F9AB 4DV3E 3HPSA 2EOFA 4DV7E 5LMNE 4WYQB 2EPNA 1X47A 4F6MA 4O24A 2LMZA 2G7HA 5ADZA 2EJ4A 2EPPA 5IXMB 4Q28A 2EMCA 3JTZA 1QNTA 3L00A 1UILA 1A1IA 3LLHA 2HC5A 1N36E 3HXLA 4ZYDA 2LV2A 4R2PA 1UHZA 2EPMX 2YTGA 2UUAE 4JYAE 2DLKA 3T1HE 2MDGA 1L4SA 1GQEA 2RPCA 4DKKA 4LTYA 5AASA 2EMKA 2RS6A 2EOMA 2CT1A 3AUZA 1DGCA 3KWRA 2L3JA 1BBGA 2MKDA 4RHBB 5AC4A 4DR7E 3J80C 2DRPA 4LU9A 4WSGA 3THOB 2V86A 2DIXA 1YSAC 2YTFA 4WXCA 2YTIA 4LF9E 1EH8A 2YTQA 2NUFA 4BS9A 4JI1E 5LMUE 4DUZE 2JPAA 5LLQA 1FJGE 1N32E 4JI6E 2WBTA 2EMXA 2EOSA 1EH7A 1B69A 2V88A 3EQ1A 1WXRA 2LJUA 2DB2A 4ZYGA 2VE7C 4M30A 2NUGA 4I8OA 4B3TE 4DR2E 2FV4B 1IBLE 2YSOA 4R2QA 4X66E 1T4LB 4LF8E 1WRJA 3F6HA 2YSPA 2UUCE 2J7JA 4KHPE 1X49A 2EP3A 2EM5A 1KJKA 3ADLA 4R2SA 2D9HA 4BHCA 5TSEA 2FGGA 5KL6A 1KYQA 1UBDC 2LT7A 2JP9A 2NABA 1MGTA 1WHNA 5IWAE 4NXNE 4X62E 2K7IA 2R1FA 2V89A 2LRSA 2JWOA 4JI7E 2DMYA 4Q35B 4TUIA 3VYXA 3P1XA 2EN2A 4DUYE 2B7TA 3OMLA 1X6HA 2EOJA 5KL3A 2JXPA 4WPYA 2MDRA 2EM8A 2CTDA 1BB8A 2EOEA 3MSWA 3ECRA 1HNWE 2EMGA 1PDAA 4F9BB 5F3WA 2EPZA 4M9VC 2JY9A 2EM2A 3MHHC 2EM0A 1YFHA 1N33E 4L5NC 4M0VA 1X3CA 1A1HA 2EMLA 1PJSA 3ADJA 2YT4A 2E72A 4GZNC 1P47A 2EOIA 3BIDA 2WCC3 4MLVA 2EMWA 2ODRD 2EMZA 2YU5A 2ENCA 2B7VA 2EN7A 2V83A 2YRMA 2UUBE 2EL4A 4BC7A 2DMIA 4X8WA 1I94E 2EN6A 2EPUA 4DV4E 2EQ0A 2K4VA 5DNYA 2EORA 4P78A 2JVAA 4WXDA 5AE3A 2EE8A 2EOYA 1STUA 3C6KA 2VQFE 3T1YE 3HPZA 3BGHA 1T4NA 1N3GA 1SFEA 3VHTB 1YYWA 1XNQE 2H36X 2EMHA 4R2DA 3BF2A 1AAYA 4O43A 1HNZE 2L2KB 4R2AA 4DR1E 2MKNA 2EN3A 4KWYA 1A1JA 1YUIA 4JI8E 2EMAA 2NUEA 3IWBA 4TUGA 2EMYA 4LFAE 3F6GA 3BBGA 5IT9C 2EN4A 2DLQA 2IHR1 4AQYE 2JOBA 1X48A 1FKAE 5KL5A 2EPRA 3EPKA 1ZR9A 2V87A 3DF6A 2YTDA 2JOXA 4LFCE 1IQOA 2I13A 1AH5A 3HQ1A 4IS1C 1MEYC 1X5WA 2HHHE 1SR9A 3ZOQB 4DV2E 2E5LE 5A6BA 3J7Yp 2CPNA 5KL4A 3UK3C 4LF4E 2CSHA 2EQ3A 3AV0A 2YPNA 4OOGC 2EMBA 4R2RA 4DR6E 2YTOA 5A6JA 1Z1BA 2L33A 2L6MA 4ZYEA 1YZ9A 1RMDA 4DV1E 4LF6E 1G2FC 2LCEA 2I9IA 2GHFA 4R2EA 1UN6B 1RQ0A 2YTJA 4BCAA 1NEIA 3ADIA 2A25A 3IWDA 4L8NA 4DV0E 2JR1A 2RS7A 2ENAA 2EL6A 2N8XA 2B9DA 4YHHE 5AE1A 2EMIA 1A1FA 2UXCE 2UXBE 2M7QA 1PJTA 1ZAAC 5KL2A 5AC5A 2E1MA 2EQ1A 5A6AA 4IJDA 3ADGA 4M2ZA 2WZOA 4KZSA 4JI4E 2EPAA 5A6KA 2L2NA 1F2IG 2EL5A 2RQLA 1IQSA 1DI2A 4F6NA 1YYOA 1JK2A 3KZZA 1PJQA 1YYKA 2EPCA 1HR0E 2JYAA 2F4VE 5A69A 3JAMC 2ELZA 5A2QC 1T39A 4DR5E 5LL6R 2ELYA 1DQ3A 4WSPA 2L3CA 3EPLA 2FTXB 3KZYA 1WJPA 2RTXA 2EN1A 1IBKE 4F2JC 1WHQA 4LF5E 2Q8UA 2YTEA 1GTKA 2EOQA 4BHBA 2EPOA 2N3GA 3HTXA 5IV8B 3TQMA 3C4TA 2ZM6E 4O5GA 2DGCA 1A1GA 1T4OA 4YY3E 2EPLX 1XNRE 2EPKX 1BBOA 3IWCA 4BMJA 4WX9A 4F54A 4NXME 3VYYA 2ENHA 2LJHA 2UU9E 1QU6A 2EM4A 2M1SA 3OTOE 4LF7E 4B3SE 2L8TA 4JI5E 1N34E 1J5EE 2F8BA 2YRHA 2YRKA 2YWQA 2LTRA 3J81C
chains in the Genus database with same CATH topology
2LT7A 2JP9A 2NABA 2VRDA 2YTPA 5KL4A 3UK3C 2CSHA 2EOXA 2EQ3A 4R2RA 2EMBA 2EM9A 2YTOA 2R1FA 2LO3A 1Z1BA 1RMDA 3EPHA 2EOOA 1G2FC 2YTNA 2EOFA 2LCEA 2EPXA 2GHFA 2EN2A 4R2EA 1X6HA 1UN6B 1A1LA 2YTJA 4F6MA 2A25A 2EOJA 2M9AA 5KL3A 1X6EA 2EJ4A 2EPPA 2ENAA 2EMCA 1A1KA 2EL6A 4FK5C 2EM8A 2CTDA 5KL7A 2EMIA 3MHSC 1A1IA 1BB8A 1NCSA 1A1FA 2EOEA 2EMGA 4M9VC 1ZAAC 2EPZA 2LV2A 4R2PA 5KL2A 1YUJA 2EM2A 3MHHC 1G2DC 2EM0A 2EQ1A 2YTGA 4IJDA 2DLKA 1X3CA 2HGHA 1A1HA 2MDGA 2EMLA 2RPCA 4GZNC 2E72A 2EPAA 1P47A 1F2IG 2EOIA 2EMKA 2EOMA 2WCC3 1TF3A 2CT1A 2EL5A 1LLMC 1DGCA 4X9JA 2EMWA 4F6NA 2MKDA 1TF6A 2EMZA 2YU5A 1JK2A 2ENCA 2EN7A 1JK1A 2EPCA 2YRMA 2DRPA 2EL4A 2BB8A 2DMIA 4WSGA 2EN6A 2EPUA 2EOZA 2LVHA 1YSAC 2YTFA 2ELZA 2EQ0A 2EM6A 2YTIA 2ELYA 2EORA 3EPLA 2YTQA 2EM3A 2EE8A 1WJPA 1X6FA 1ZU1A 2EN1A 2EOYA 4F2JC 3EPJA 2GLIA 2ADRA 2YTEA 2EOQA 3M99B 2JPAA 1TN9A 3VHTB 2EMHA 4R2DA 1AAYA 2RSIA 2WBTA 2PRTA 2EN8A 2WBUA 2EMXA 4R2AA 2EOSA 2MKNA 2EN3A 2DGCA 1A1GA 1A1JA 1YUIA 1B69A 4R2CA 2EMAA 1BBOA 2EMYA 2EMFA 2EN4A 2DLQA 2ENHA 5KL5A 2EPRA 2EM4A 3EPKA 2EM7A 2YSOA 4R2QA 1ZR9A 2YTDA 2YSPA 2J7JA 2I13A 2WBSA 2EP3A 2EM5A 4IS1C 2EOHA 2YRHA 1MEYC 1KJKA 4R2SA 1X5WA 2YRKA 2YU8A 2D9HA 5KL6A 1UBDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT7 A;  2JP9 A;  2NAB A;  2VRD A;  2YTP A;  5KL4 A;  3UK3 C;  2CSH A;  2EOX A;  2EQ3 A;  4R2R A;  2EMB A;  2EM9 A;  2YTO A;  2R1F A;  2LO3 A;  1Z1B A;  1RMD A;  3EPH A;  2EOO A;  1G2F C;  2YTN A;  2EOF A;  2LCE A;  2EPX A;  2GHF A;  2EN2 A;  4R2E A;  1X6H A;  1UN6 B;  1A1L A;  2YTJ A;  4F6M A;  2A25 A;  2EOJ A;  2M9A A;  5KL3 A;  1X6E A;  2EJ4 A;  2EPP A;  2ENA A;  2EMC A;  1A1K A;  2EL6 A;  4FK5 C;  2EM8 A;  2CTD A;  5KL7 A;  2EMI A;  3MHS C;  1A1I A;  1BB8 A;  1NCS A;  1A1F A;  2EOE A;  2EMG A;  4M9V C;  1ZAA C;  2EPZ A;  2LV2 A;  4R2P A;  5KL2 A;  1YUJ A;  2EM2 A;  3MHH C;  1G2D C;  2EM0 A;  2EQ1 A;  2YTG A;  4IJD A;  2DLK A;  1X3C A;  2HGH A;  1A1H A;  2MDG A;  2EML A;  2RPC A;  4GZN C;  2E72 A;  2EPA A;  1P47 A;  1F2I G;  2EOI A;  2EMK A;  2EOM A;  2WCC 3;  1TF3 A;  2CT1 A;  2EL5 A;  1LLM C;  1DGC A;  4X9J A;  2EMW A;  4F6N A;  2MKD A;  1TF6 A;  2EMZ A;  2YU5 A;  1JK2 A;  2ENC A;  2EN7 A;  1JK1 A;  2EPC A;  2YRM A;  2DRP A;  2EL4 A;  2BB8 A;  2DMI A;  4WSG A;  2EN6 A;  2EPU A;  2EOZ A;  2LVH A;  1YSA C;  2YTF A;  2ELZ A;  2EQ0 A;  2EM6 A;  2YTI A;  2ELY A;  2EOR A;  3EPL A;  2YTQ A;  2EM3 A;  2EE8 A;  1WJP A;  1X6F A;  1ZU1 A;  2EN1 A;  2EOY A;  4F2J C;  3EPJ A;  2GLI A;  2ADR A;  2YTE A;  2EOQ A;  3M99 B;  2JPA A;  1TN9 A;  3VHT B;  2EMH A;  4R2D A;  1AAY A;  2RSI A;  2WBT A;  2PRT A;  2EN8 A;  2WBU A;  2EMX A;  4R2A A;  2EOS A;  2MKN A;  2EN3 A;  2DGC A;  1A1G A;  1A1J A;  1YUI A;  1B69 A;  4R2C A;  2EMA A;  1BBO A;  2EMY A;  2EMF A;  2EN4 A;  2DLQ A;  2ENH A;  5KL5 A;  2EPR A;  2EM4 A;  3EPK A;  2EM7 A;  2YSO A;  4R2Q A;  1ZR9 A;  2YTD A;  2YSP A;  2J7J A;  2I13 A;  2WBS A;  2EP3 A;  2EM5 A;  4IS1 C;  2EOH A;  2YRH A;  1MEY C;  1KJK A;  4R2S A;  1X5W A;  2YRK A;  2YU8 A;  2D9H A;  5KL6 A;  1UBD C; 
#chains in the Genus database with same CATH topology
 5T6J A;  4X64 E;  2VRD A;  2YTP A;  2EOX A;  2LBS B;  1HNX E;  2MC5 A;  4B3M E;  4WFT A;  2EM9 A;  1YPN A;  1EKZ A;  1PKP A;  2LTS A;  2YTN A;  2EPX A;  3H09 A;  4JV5 E;  4DV5 E;  4JI2 E;  2N3H A;  1A1L A;  5CFF E;  1RC7 A;  2M9A A;  1X6E A;  1XMQ E;  4JI3 E;  1A1K A;  4FK5 C;  5A6B D;  3C6M A;  1GZ6 A;  4BC9 A;  3THN A;  5KL7 A;  3MHS C;  2KON A;  2RSM A;  1NCS A;  2M4I A;  4GKK E;  4R8O A;  1XMO E;  4O4K A;  3FIG A;  1YUJ A;  4DR4 E;  1G2D C;  3RMP A;  2R76 A;  1IMU A;  3LML A;  2HGH A;  2ODR C;  2EWL A;  2KHX A;  1ZBQ A;  2VF1 A;  4NHR A;  4LFB E;  2L92 A;  5AE2 A;  1LLM C;  1TF3 A;  4GEQ B;  4X9J A;  1J26 A;  2B3T B;  4DMI A;  4GKJ E;  3DJW A;  4BBY A;  1TF6 A;  4JI0 E;  2LE2 A;  1JK1 A;  4K0K E;  2KOU A;  2BB8 A;  2HJJ A;  2LVH A;  2EOZ A;  4NZV A;  2EM6 A;  1ZBT A;  4X65 E;  2DSY A;  2EM3 A;  2GPI A;  1X6F A;  1ZU1 A;  4N4R B;  2GLI A;  4ZYH A;  3EPJ A;  1O0W A;  4MLQ A;  2ADR A;  4P7D A;  3M99 B;  2VQE E;  1TN9 A;  4OX9 E;  2RSI A;  2PRT A;  3JU0 A;  2EN8 A;  2WBU A;  2LUQ A;  4R2C A;  1T38 A;  2NA2 A;  2LUP B;  2EMF A;  4B3R E;  3QG5 C;  4DV6 E;  2L2M A;  2UXD E;  4R03 A;  2EM7 A;  4HTG A;  4DR3 E;  4HEI A;  2YZT A;  4RH8 A;  4F9C B;  2WBS A;  2V85 A;  2MC6 A;  2EOH A;  3C4B A;  5BR8 E;  1EH6 A;  2YU8 A;  3VK6 A;  1IBM E;  2V8Q B;  3K6Q A;  3J7A G;  4J8Z A;  2LO3 A;  2EZ6 A;  2BBG A;  5FLX C;  3EPH A;  2EOO A;  4F9A B;  4DV3 E;  3HPS A;  2EOF A;  4DV7 E;  5LMN E;  4WYQ B;  2EPN A;  1X47 A;  4F6M A;  4O24 A;  2LMZ A;  2G7H A;  5ADZ A;  2EJ4 A;  2EPP A;  5IXM B;  4Q28 A;  2EMC A;  3JTZ A;  1QNT A;  3L00 A;  1UIL A;  1A1I A;  3LLH A;  2HC5 A;  1N36 E;  3HXL A;  4ZYD A;  2LV2 A;  4R2P A;  1UHZ A;  2EPM X;  2YTG A;  2UUA E;  4JYA E;  2DLK A;  3T1H E;  2MDG A;  1L4S A;  1GQE A;  2RPC A;  4DKK A;  4LTY A;  5AAS A;  2EMK A;  2RS6 A;  2EOM A;  2CT1 A;  3AUZ A;  1DGC A;  3KWR A;  2L3J A;  1BBG A;  2MKD A;  4RHB B;  5AC4 A;  4DR7 E;  3J80 C;  2DRP A;  4LU9 A;  4WSG A;  3THO B;  2V86 A;  2DIX A;  1YSA C;  2YTF A;  4WXC A;  2YTI A;  4LF9 E;  1EH8 A;  2YTQ A;  2NUF A;  4BS9 A;  4JI1 E;  5LMU E;  4DUZ E;  2JPA A;  5LLQ A;  1FJG E;  1N32 E;  4JI6 E;  2WBT A;  2EMX A;  2EOS A;  1EH7 A;  1B69 A;  2V88 A;  3EQ1 A;  1WXR A;  2LJU A;  2DB2 A;  4ZYG A;  2VE7 C;  4M30 A;  2NUG A;  4I8O A;  4B3T E;  4DR2 E;  2FV4 B;  1IBL E;  2YSO A;  4R2Q A;  4X66 E;  1T4L B;  4LF8 E;  1WRJ A;  3F6H A;  2YSP A;  2UUC E;  2J7J A;  4KHP E;  1X49 A;  2EP3 A;  2EM5 A;  1KJK A;  3ADL A;  4R2S A;  2D9H A;  4BHC A;  5TSE A;  2FGG A;  5KL6 A;  1KYQ A;  1UBD C;  2LT7 A;  2JP9 A;  2NAB A;  1MGT A;  1WHN A;  5IWA E;  4NXN E;  4X62 E;  2K7I A;  2R1F A;  2V89 A;  2LRS A;  2JWO A;  4JI7 E;  2DMY A;  4Q35 B;  4TUI A;  3VYX A;  3P1X A;  2EN2 A;  4DUY E;  2B7T A;  3OML A;  1X6H A;  2EOJ A;  5KL3 A;  2JXP A;  4WPY A;  2MDR A;  2EM8 A;  2CTD A;  1BB8 A;  2EOE A;  3MSW A;  3ECR A;  1HNW E;  2EMG A;  1PDA A;  4F9B B;  5F3W A;  2EPZ A;  4M9V C;  2JY9 A;  2EM2 A;  3MHH C;  2EM0 A;  1YFH A;  1N33 E;  4L5N C;  4M0V A;  1X3C A;  1A1H A;  2EML A;  1PJS A;  3ADJ A;  2YT4 A;  2E72 A;  4GZN C;  1P47 A;  2EOI A;  3BID A;  2WCC 3;  4MLV A;  2EMW A;  2ODR D;  2EMZ A;  2YU5 A;  2ENC A;  2B7V A;  2EN7 A;  2V83 A;  2YRM A;  2UUB E;  2EL4 A;  4BC7 A;  2DMI A;  4X8W A;  1I94 E;  2EN6 A;  2EPU A;  4DV4 E;  2EQ0 A;  2K4V A;  5DNY A;  2EOR A;  4P78 A;  2JVA A;  4WXD A;  5AE3 A;  2EE8 A;  2EOY A;  1STU A;  3C6K A;  2VQF E;  3T1Y E;  3HPZ A;  3BGH A;  1T4N A;  1N3G A;  1SFE A;  3VHT B;  1YYW A;  1XNQ E;  2H36 X;  2EMH A;  4R2D A;  3BF2 A;  1AAY A;  4O43 A;  1HNZ E;  2L2K B;  4R2A A;  4DR1 E;  2MKN A;  2EN3 A;  4KWY A;  1A1J A;  1YUI A;  4JI8 E;  2EMA A;  2NUE A;  3IWB A;  4TUG A;  2EMY A;  4LFA E;  3F6G A;  3BBG A;  5IT9 C;  2EN4 A;  2DLQ A;  2IHR 1;  4AQY E;  2JOB A;  1X48 A;  1FKA E;  5KL5 A;  2EPR A;  3EPK A;  1ZR9 A;  2V87 A;  3DF6 A;  2YTD A;  2JOX A;  4LFC E;  1IQO A;  2I13 A;  1AH5 A;  3HQ1 A;  4IS1 C;  1MEY C;  1X5W A;  2HHH E;  1SR9 A;  3ZOQ B;  4DV2 E;  2E5L E;  5A6B A;  3J7Y p;  2CPN A;  5KL4 A;  3UK3 C;  4LF4 E;  2CSH A;  2EQ3 A;  3AV0 A;  2YPN A;  4OOG C;  2EMB A;  4R2R A;  4DR6 E;  2YTO A;  5A6J A;  1Z1B A;  2L33 A;  2L6M A;  4ZYE A;  1YZ9 A;  1RMD A;  4DV1 E;  4LF6 E;  1G2F C;  2LCE A;  2I9I A;  2GHF A;  4R2E A;  1UN6 B;  1RQ0 A;  2YTJ A;  4BCA A;  1NEI A;  3ADI A;  2A25 A;  3IWD A;  4L8N A;  4DV0 E;  2JR1 A;  2RS7 A;  2ENA A;  2EL6 A;  2N8X A;  2B9D A;  4YHH E;  5AE1 A;  2EMI A;  1A1F A;  2UXC E;  2UXB E;  2M7Q A;  1PJT A;  1ZAA C;  5KL2 A;  5AC5 A;  2E1M A;  2EQ1 A;  5A6A A;  4IJD A;  3ADG A;  4M2Z A;  2WZO A;  4KZS A;  4JI4 E;  2EPA A;  5A6K A;  2L2N A;  1F2I G;  2EL5 A;  2RQL A;  1IQS A;  1DI2 A;  4F6N A;  1YYO A;  1JK2 A;  3KZZ A;  1PJQ A;  1YYK A;  2EPC A;  1HR0 E;  2JYA A;  2F4V E;  5A69 A;  3JAM C;  2ELZ A;  5A2Q C;  1T39 A;  4DR5 E;  5LL6 R;  2ELY A;  1DQ3 A;  4WSP A;  2L3C A;  3EPL A;  2FTX B;  3KZY A;  1WJP A;  2RTX A;  2EN1 A;  1IBK E;  4F2J C;  1WHQ A;  4LF5 E;  2Q8U A;  2YTE A;  1GTK A;  2EOQ A;  4BHB A;  2EPO A;  2N3G A;  3HTX A;  5IV8 B;  3TQM A;  3C4T A;  2ZM6 E;  4O5G A;  2DGC A;  1A1G A;  1T4O A;  4YY3 E;  2EPL X;  1XNR E;  2EPK X;  1BBO A;  3IWC A;  4BMJ A;  4WX9 A;  4F54 A;  4NXM E;  3VYY A;  2ENH A;  2LJH A;  2UU9 E;  1QU6 A;  2EM4 A;  2M1S A;  3OTO E;  4LF7 E;  4B3S E;  2L8T A;  4JI5 E;  1N34 E;  1J5E E;  2F8B A;  2YRH A;  2YRK A;  2YWQ A;  2LTR A;  3J81 C; 
#chains in the Genus database with same CATH homology
 2LT7 A;  2JP9 A;  2NAB A;  2VRD A;  2YTP A;  5KL4 A;  3UK3 C;  2CSH A;  2EOX A;  2EQ3 A;  4R2R A;  2EMB A;  2EM9 A;  2YTO A;  2R1F A;  2LO3 A;  1Z1B A;  1RMD A;  3EPH A;  2EOO A;  1G2F C;  2YTN A;  2EOF A;  2LCE A;  2EPX A;  2GHF A;  2EN2 A;  4R2E A;  1X6H A;  1UN6 B;  1A1L A;  2YTJ A;  4F6M A;  2A25 A;  2EOJ A;  2M9A A;  5KL3 A;  1X6E A;  2EJ4 A;  2EPP A;  2ENA A;  2EMC A;  1A1K A;  2EL6 A;  4FK5 C;  2EM8 A;  2CTD A;  5KL7 A;  2EMI A;  3MHS C;  1A1I A;  1BB8 A;  1NCS A;  1A1F A;  2EOE A;  2EMG A;  4M9V C;  1ZAA C;  2EPZ A;  2LV2 A;  4R2P A;  5KL2 A;  1YUJ A;  2EM2 A;  3MHH C;  1G2D C;  2EM0 A;  2EQ1 A;  2YTG A;  4IJD A;  2DLK A;  1X3C A;  2HGH A;  1A1H A;  2MDG A;  2EML A;  2RPC A;  4GZN C;  2E72 A;  2EPA A;  1P47 A;  1F2I G;  2EOI A;  2EMK A;  2EOM A;  2WCC 3;  1TF3 A;  2CT1 A;  2EL5 A;  1LLM C;  1DGC A;  4X9J A;  2EMW A;  4F6N A;  2MKD A;  1TF6 A;  2EMZ A;  2YU5 A;  1JK2 A;  2ENC A;  2EN7 A;  1JK1 A;  2EPC A;  2YRM A;  2DRP A;  2EL4 A;  2BB8 A;  2DMI A;  4WSG A;  2EN6 A;  2EPU A;  2EOZ A;  2LVH A;  1YSA C;  2YTF A;  2ELZ A;  2EQ0 A;  2EM6 A;  2YTI A;  2ELY A;  2EOR A;  3EPL A;  2YTQ A;  2EM3 A;  2EE8 A;  1WJP A;  1X6F A;  1ZU1 A;  2EN1 A;  2EOY A;  4F2J C;  3EPJ A;  2GLI A;  2ADR A;  2YTE A;  2EOQ A;  3M99 B;  2JPA A;  1TN9 A;  3VHT B;  2EMH A;  4R2D A;  1AAY A;  2RSI A;  2WBT A;  2PRT A;  2EN8 A;  2WBU A;  2EMX A;  4R2A A;  2EOS A;  2MKN A;  2EN3 A;  2DGC A;  1A1G A;  1A1J A;  1YUI A;  1B69 A;  4R2C A;  2EMA A;  1BBO A;  2EMY A;  2EMF A;  2EN4 A;  2DLQ A;  2ENH A;  5KL5 A;  2EPR A;  2EM4 A;  3EPK A;  2EM7 A;  2YSO A;  4R2Q A;  1ZR9 A;  2YTD A;  2YSP A;  2J7J A;  2I13 A;  2WBS A;  2EP3 A;  2EM5 A;  4IS1 C;  2EOH A;  2YRH A;  1MEY C;  1KJK A;  4R2S A;  1X5W A;  2YRK A;  2YU8 A;  2D9H A;  5KL6 A;  1UBD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...