2EMAA

Solution structure of the c2h2 type zinc finger (region 312-344) of human zinc finger protein 347
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 312-344) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emaA01
2EN1A 1G2FC 2R1FA 2LO3A 1A1GA 4F2JC 1X6HA 2EN4A 2WBSA 2YTJA 2EM2A 2EQ0A 2VRDA 1A1FA 2EOOA 2EJ4A 2EM6A 2EOJA 2EMZA 2EM5A 2YSOA 2EM3A 2EN6A 2NABA 4R2DA 2EP3A 2CT1A 4R2QA 2YTFA 1F2IG 1JK2A 2WCC3 2EL5A 1TF6A 2LV2A 2ELZA 1KJKA 2EPPA 1UBDC 1BBOA 1TN9A 2EMYA 3M99B 3VHTB 2YTQA 2DMIA 2RPCA 2EOFA 2CSHA 4R2RA 4WSGA 2EE8A 5KL4A 2ENHA 1A1LA 2EQ1A 2BB8A 2ADRA 2YRHA 2EOZA 2YRKA 2EMGA 2EQ3A 1A1HA 1ZR9A 3EPKA 2YTEA 2YTOA 4X9JA 2EPRA 1LLMC 2EM9A 2EMAA 2EN7A 2EPCA 2YU8A 2HGHA 2EOHA 2EOXA 2YTGA 2JP9A 2DRPA 2DLKA 2GHFA 4IS1C 2ENCA 2LCEA 1AAYA 2MKNA 2YU5A 2YSPA 1DGCA 3MHSC 3UK3C 2ENAA 2YTDA 1X5WA 2EMWA 2YRMA 2EOEA 2I13A 2E72A 2LVHA 5KL6A 1Z1BA 2EMXA 2EN8A 5KL7A 1ZU1A 2EOYA 2ELYA 1X3CA 1RMDA 1X6EA 2YTNA 2RSIA 3EPHA 2YTPA 2YTIA 1G2DC 1BB8A 2EN3A 2EORA 1A1KA 4R2CA 2J7JA 2EPZA 4M9VC 2M9AA 3EPLA 2D9HA 2EMLA 2EPAA 2EMCA 1A1JA 2LT7A 1WJPA 1P47A 2EOIA 4FK5C 2EM7A 2A25A 1X6FA 1A1IA 5KL3A 2MDGA 1JK1A 2GLIA 4GZNC 3MHHC 2CTDA 4R2EA 2EMFA 2EPXA 2DGCA 2EMIA 2PRTA 2WBUA 2EPUA 2EM0A 2WBTA 1YUIA 2EMBA 2EN2A 3EPJA 1MEYC 5KL5A 2EOSA 1YSAC 2EM4A 4F6MA 2EMKA 4R2PA 2EOQA 1UN6B 2EL6A 2EMHA 1ZAAC 1NCSA 1B69A 2EOMA 2EM8A 5KL2A 2MKDA 4R2AA 4R2SA 4F6NA 2DLQA 4IJDA 2EL4A 1TF3A 2JPAA 1YUJA
chains in the Genus database with same CATH superfamily
2EN1A 2LO3A 2K7IA 2EN4A 1BBGA 4DUZE 2UUAE 4DR3E 5CFFE 2HHHE 3OMLA 2JYAA 3EQ1A 2NABA 1I94E 2YWQA 2CPNA 1FKAE 3TQMA 2EL5A 1IQOA 3VHTB 2EOFA 2DIXA 1WXRA 4R2RA 4WSGA 2EE8A 2VQFE 2ENHA 1UILA 2V8QB 4P78A 2EOZA 1KYQA 2EPRA 1LLMC 5FLXC 2EMAA 2YU8A 2M4IA 3THOB 2GHFA 2IHR1 1YYOA 1PJQA 4LF9E 4WXCA 3T1HE 1IMUA 3HQ1A 4BHBA 4B3SE 1GQEA 2YRMA 4B3RE 1NEIA 2EMXA 2L92A 1N36E 1IBLE 5AC5A 1UHZA 2YTIA 1G2DC 2LE2A 4DV7E 2EN3A 3KWRA 4HEIA 4M9VC 2M9AA 2NUEA 2D9HA 2MDRA 1HR0E 1WJPA 2JXPA 1N34E 1P47A 4DR6E 2EOIA 3C6KA 2EPLX 2N3GA 1EH6A 1X6FA 5A2QC 2L3CA 2MDGA 2GLIA 3H09A 2NUGA 1YFHA 4WXDA 4ZYEA 2EPMX 1IQSA 1EH8A 5A6JA 2CTDA 4R2EA 2EMFA 5BR8E 4DV6E 2PRTA 4K0KE 2EM0A 3HPZA 4DV5E 1YUIA 4OX9E 2EOSA 2HJJA 3C6MA 2JY9A 5A6BD 2EOQA 2EL6A 2EMHA 4B3ME 3BGHA 4M0VA 2EOMA 2EM8A 4OOGC 1HNZE 3VK6A 4JI0E 4F6NA 1DI2A 4IJDA 2LTSA 1TF3A 2JPAA 2ODRD 4JV5E 1AH5A 4J8ZA 2YTJA 1L4SA 1T4OA 2VRDA 4DMIA 2EOOA 1YPNA 3J7AG 2RS6A 3JU0A 1GTKA 2EM6A 1XMQE 2EMZA 4JI1E 2EPOA 2EM3A 2EWLA 4TUIA 2EP3A 2CT1A 2UXCE 1F2IG 2GPIA 3ADGA 3IWCA 2RSMA 5T6JA 2LV2A 3HPSA 1STUA 4Q35B 4Q28A 2DMIA 4L5NC 5AC4A 4JI4E 3J81C 1A1LA 1MGTA 3K6QA 2YTEA 3C4TA 2EM9A 2EN7A 2EPCA 4P7DA 2YTGA 2DLKA 4DR5E 2UUCE 4X66E 2ENCA 2YU5A 5TSEA 1HNWE 1DGCA 4DR4E 4LFBE 2L6MA 2V87A 2L8TA 1SFEA 4YHHE 2LJHA 2JOXA 4R8OA 1X5WA 2DMYA 4O4KA 2FV4B 2LVHA 4GKJE 3BBGA 2VQEE 1RC7A 2F8BA 4JI8E 4LTYA 4NXNE 1X6EA 2L2MA 4BMJA 3JTZA 5F3WA 4F9AB 3EPHA 2JOBA 5ADZA 4HTGA 1O0WA 1BB8A 4RH8A 3LLHA 1GZ6A 4R2CA 2I9IA 2EPZA 2DB2A 1T4NA 3L00A 4DV3E 2LT7A 2JWOA 2V83A 1ZBTA 2B7TA 2A25A 1A1IA 5LMNE 4DV2E 4O24A 3THNA 4JI5E 2HC5A 5AE3A 2EPXA 1T39A 1SR9A 3DF6A 1IBME 1T38A 2MC5A 1YSAC 2EM4A 4F6MA 2EMKA 4NHRA 1NCSA 1B69A 2DLQA 2EL4A 2R1FA 4DKKA 1A1GA 2LUQA 3QG5C 1X6HA 4WSPA 2B3TB 2EQ0A 1A1FA 1HNXE 2NA2A 4N4RB 2N8XA 2EM5A 2WZOA 2L2NA 2L2KB 4LF5E 2E1MA 1PDAA 4R2DA 3KZYA 3ZOQB 2YTFA 2R76A 1EKZA 2ELZA 1KJKA 2EPPA 2DSYA 3VYYA 1UBDC 1TN9A 2YTQA 4JI3E 2CSHA 4F9CB 1EH7A 4L8NA 1XNRE 3AV0A 2FGGA 4O43A 2YRKA 2EMGA 3EPKA 3J7Yp 2N3HA 1WHQA 2KHXA 2HGHA 2H36X 3C4BA 2JP9A 2JR1A 4WPYA 4JYAE 4I8OA 4KZSA 1AAYA 1YYKA 4F9BB 3UK3C 4LF4E 4BHCA 3RMPA 1YZ9A 1IBKE 1N3GA 4NZVA 1RQ0A 2L33A 4BBYA 2EMWA 2EOEA 2E72A 2UXBE 1Z1BA 5KL6A 2EN8A 3LMLA 1X47A 2EOYA 4X8WA 1X3CA 1RMDA 2RSIA 2V86A 1XNQE 4LF7E 2VE7C 2V89A 2VF1A 2YTPA 1FJGE 1A1KA 3HTXA 4TUGA 2J7JA 5IT9C 2LMZA 1XMOE 2EMLA 2EMCA 1A1JA 4X65E 4DV0E 4NXME 1J5EE 3J80C 5AE2A 3FIGA 4LFCE 3KZZA 4LU9A 5KL3A 3F6GA 2MC6A 4GKKE 4LF6E 2RQLA 3DJWA 2EPKX 3BIDA 4ZYHA 5AE1A 2DGCA 4DV4E 2JVAA 2WBUA 2ODRC 2LRSA 2LUPB 2M7QA 5A6KA 2EMBA 3EPJA 4DR7E 1PJTA 5KL5A 2L3JA 1ZBQA 4LF8E 4WYQB 4ZYGA 5A69A 4JI2E 2EZ6A 4R2AA 2UUBE 5LMUE 4X62E 5AASA 1G2FC 4F2JC 1DQ3A 1YYWA 1N32E 2WBSA 3ADIA 4DR2E 2EM2A 1J26A 4O5GA 2EJ4A 4BC7A 2EOJA 3ADLA 2RS7A 2YSOA 2EN6A 4BS9A 4R2QA 1JK2A 2WCC3 1TF6A 4WX9A 2K4VA 2YZTA 4ZYDA 1BBOA 2EMYA 4JI6E 3M99B 2B9DA 2RPCA 3T1YE 5KL4A 3AUZA 2EQ1A 4MLQA 2BB8A 1X48A 2ADRA 2YRHA 1A1HA 2EQ3A 2KONA 2NUFA 1ZR9A 5IV8B 2YTOA 3ECRA 1QU6A 4X9JA 2Q8UA 2EOHA 2EOXA 3IWBA 2DRPA 5A6AA 4IS1C 2BBGA 2LCEA 4YY3E 4JI7E 4X64E 2MKNA 2EPNA 4F54A 3ADJA 2YSPA 3MHSC 2G7HA 2ENAA 2YTDA 4KHPE 2I13A 4WFTA 2UU9E 1X49A 4BC9A 4AQYE 4R03A 2FTXB 2M1SA 1ZU1A 2V88A 4KWYA 5KL7A 1WRJA 2ELYA 3BF2A 4BCAA 4MLVA 2YTNA 2KOUA 2EORA 5DNYA 2UXDE 3MSWA 4B3TE 4DUYE 2LJUA 3EPLA 2EPAA 2RTXA 4DR1E 3IWDA 4FK5C 2EM7A 3P1XA 2YT4A 1JK1A 4GZNC 4LFAE 3MHHC 4DV1E 5A6BA 2EMIA 1PKPA 4GEQB 3JAMC 2ZM6E 2EPUA 3VYXA 5IXMB 1T4LB 1WHNA 2LBSB 2WBTA 2B7VA 5LL6R 2EN2A 1MEYC 4M2ZA 3HXLA 2LTRA 5LLQA 4RHBB 2E5LE 1QNTA 4R2PA 3OTOE 2YPNA 1UN6B 5IWAE 1ZAAC 2V85A 3F6HA 4M30A 1N33E 5KL2A 2MKDA 1PJSA 4R2SA 2F4VE 1YUJA
chains in the Genus database with same CATH topology
2EN1A 1G2FC 2R1FA 2LO3A 1A1GA 4F2JC 1X6HA 2EN4A 2WBSA 2YTJA 2EM2A 2EQ0A 2VRDA 1A1FA 2EOOA 2EJ4A 2EM6A 2EOJA 2EMZA 2EM5A 2YSOA 2EM3A 2EN6A 2NABA 4R2DA 2EP3A 2CT1A 4R2QA 2YTFA 1F2IG 1JK2A 2WCC3 2EL5A 1TF6A 2LV2A 2ELZA 1KJKA 2EPPA 1UBDC 1BBOA 1TN9A 2EMYA 3M99B 3VHTB 2YTQA 2DMIA 2RPCA 2EOFA 2CSHA 4R2RA 4WSGA 2EE8A 5KL4A 2ENHA 1A1LA 2EQ1A 2BB8A 2ADRA 2YRHA 2EOZA 2YRKA 2EMGA 2EQ3A 1A1HA 1ZR9A 3EPKA 2YTEA 2YTOA 4X9JA 2EPRA 1LLMC 2EM9A 2EMAA 2EN7A 2EPCA 2YU8A 2HGHA 2EOHA 2EOXA 2YTGA 2JP9A 2DRPA 2DLKA 2GHFA 4IS1C 2ENCA 2LCEA 1AAYA 2MKNA 2YU5A 2YSPA 1DGCA 3MHSC 3UK3C 2ENAA 2YTDA 1X5WA 2EMWA 2YRMA 2EOEA 2I13A 2E72A 2LVHA 5KL6A 1Z1BA 2EMXA 2EN8A 5KL7A 1ZU1A 2EOYA 2ELYA 1X3CA 1RMDA 1X6EA 2YTNA 2RSIA 3EPHA 2YTPA 2YTIA 1G2DC 1BB8A 2EN3A 2EORA 1A1KA 4R2CA 2J7JA 2EPZA 4M9VC 2M9AA 3EPLA 2D9HA 2EMLA 2EPAA 2EMCA 1A1JA 2LT7A 1WJPA 1P47A 2EOIA 4FK5C 2EM7A 2A25A 1X6FA 1A1IA 5KL3A 2MDGA 1JK1A 2GLIA 4GZNC 3MHHC 2CTDA 4R2EA 2EMFA 2EPXA 2DGCA 2EMIA 2PRTA 2WBUA 2EPUA 2EM0A 2WBTA 1YUIA 2EMBA 2EN2A 3EPJA 1MEYC 5KL5A 2EOSA 1YSAC 2EM4A 4F6MA 2EMKA 4R2PA 2EOQA 1UN6B 2EL6A 2EMHA 1ZAAC 1NCSA 1B69A 2EOMA 2EM8A 5KL2A 2MKDA 4R2AA 4R2SA 4F6NA 2DLQA 4IJDA 2EL4A 1TF3A 2JPAA 1YUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN1 A;  1G2F C;  2R1F A;  2LO3 A;  1A1G A;  4F2J C;  1X6H A;  2EN4 A;  2WBS A;  2YTJ A;  2EM2 A;  2EQ0 A;  2VRD A;  1A1F A;  2EOO A;  2EJ4 A;  2EM6 A;  2EOJ A;  2EMZ A;  2EM5 A;  2YSO A;  2EM3 A;  2EN6 A;  2NAB A;  4R2D A;  2EP3 A;  2CT1 A;  4R2Q A;  2YTF A;  1F2I G;  1JK2 A;  2WCC 3;  2EL5 A;  1TF6 A;  2LV2 A;  2ELZ A;  1KJK A;  2EPP A;  1UBD C;  1BBO A;  1TN9 A;  2EMY A;  3M99 B;  3VHT B;  2YTQ A;  2DMI A;  2RPC A;  2EOF A;  2CSH A;  4R2R A;  4WSG A;  2EE8 A;  5KL4 A;  2ENH A;  1A1L A;  2EQ1 A;  2BB8 A;  2ADR A;  2YRH A;  2EOZ A;  2YRK A;  2EMG A;  2EQ3 A;  1A1H A;  1ZR9 A;  3EPK A;  2YTE A;  2YTO A;  4X9J A;  2EPR A;  1LLM C;  2EM9 A;  2EMA A;  2EN7 A;  2EPC A;  2YU8 A;  2HGH A;  2EOH A;  2EOX A;  2YTG A;  2JP9 A;  2DRP A;  2DLK A;  2GHF A;  4IS1 C;  2ENC A;  2LCE A;  1AAY A;  2MKN A;  2YU5 A;  2YSP A;  1DGC A;  3MHS C;  3UK3 C;  2ENA A;  2YTD A;  1X5W A;  2EMW A;  2YRM A;  2EOE A;  2I13 A;  2E72 A;  2LVH A;  5KL6 A;  1Z1B A;  2EMX A;  2EN8 A;  5KL7 A;  1ZU1 A;  2EOY A;  2ELY A;  1X3C A;  1RMD A;  1X6E A;  2YTN A;  2RSI A;  3EPH A;  2YTP A;  2YTI A;  1G2D C;  1BB8 A;  2EN3 A;  2EOR A;  1A1K A;  4R2C A;  2J7J A;  2EPZ A;  4M9V C;  2M9A A;  3EPL A;  2D9H A;  2EML A;  2EPA A;  2EMC A;  1A1J A;  2LT7 A;  1WJP A;  1P47 A;  2EOI A;  4FK5 C;  2EM7 A;  2A25 A;  1X6F A;  1A1I A;  5KL3 A;  2MDG A;  1JK1 A;  2GLI A;  4GZN C;  3MHH C;  2CTD A;  4R2E A;  2EMF A;  2EPX A;  2DGC A;  2EMI A;  2PRT A;  2WBU A;  2EPU A;  2EM0 A;  2WBT A;  1YUI A;  2EMB A;  2EN2 A;  3EPJ A;  1MEY C;  5KL5 A;  2EOS A;  1YSA C;  2EM4 A;  4F6M A;  2EMK A;  4R2P A;  2EOQ A;  1UN6 B;  2EL6 A;  2EMH A;  1ZAA C;  1NCS A;  1B69 A;  2EOM A;  2EM8 A;  5KL2 A;  2MKD A;  4R2A A;  4R2S A;  4F6N A;  2DLQ A;  4IJD A;  2EL4 A;  1TF3 A;  2JPA A;  1YUJ A; 
#chains in the Genus database with same CATH topology
 2EN1 A;  2LO3 A;  2K7I A;  2EN4 A;  1BBG A;  4DUZ E;  2UUA E;  4DR3 E;  5CFF E;  2HHH E;  3OML A;  2JYA A;  3EQ1 A;  2NAB A;  1I94 E;  2YWQ A;  2CPN A;  1FKA E;  3TQM A;  2EL5 A;  1IQO A;  3VHT B;  2EOF A;  2DIX A;  1WXR A;  4R2R A;  4WSG A;  2EE8 A;  2VQF E;  2ENH A;  1UIL A;  2V8Q B;  4P78 A;  2EOZ A;  1KYQ A;  2EPR A;  1LLM C;  5FLX C;  2EMA A;  2YU8 A;  2M4I A;  3THO B;  2GHF A;  2IHR 1;  1YYO A;  1PJQ A;  4LF9 E;  4WXC A;  3T1H E;  1IMU A;  3HQ1 A;  4BHB A;  4B3S E;  1GQE A;  2YRM A;  4B3R E;  1NEI A;  2EMX A;  2L92 A;  1N36 E;  1IBL E;  5AC5 A;  1UHZ A;  2YTI A;  1G2D C;  2LE2 A;  4DV7 E;  2EN3 A;  3KWR A;  4HEI A;  4M9V C;  2M9A A;  2NUE A;  2D9H A;  2MDR A;  1HR0 E;  1WJP A;  2JXP A;  1N34 E;  1P47 A;  4DR6 E;  2EOI A;  3C6K A;  2EPL X;  2N3G A;  1EH6 A;  1X6F A;  5A2Q C;  2L3C A;  2MDG A;  2GLI A;  3H09 A;  2NUG A;  1YFH A;  4WXD A;  4ZYE A;  2EPM X;  1IQS A;  1EH8 A;  5A6J A;  2CTD A;  4R2E A;  2EMF A;  5BR8 E;  4DV6 E;  2PRT A;  4K0K E;  2EM0 A;  3HPZ A;  4DV5 E;  1YUI A;  4OX9 E;  2EOS A;  2HJJ A;  3C6M A;  2JY9 A;  5A6B D;  2EOQ A;  2EL6 A;  2EMH A;  4B3M E;  3BGH A;  4M0V A;  2EOM A;  2EM8 A;  4OOG C;  1HNZ E;  3VK6 A;  4JI0 E;  4F6N A;  1DI2 A;  4IJD A;  2LTS A;  1TF3 A;  2JPA A;  2ODR D;  4JV5 E;  1AH5 A;  4J8Z A;  2YTJ A;  1L4S A;  1T4O A;  2VRD A;  4DMI A;  2EOO A;  1YPN A;  3J7A G;  2RS6 A;  3JU0 A;  1GTK A;  2EM6 A;  1XMQ E;  2EMZ A;  4JI1 E;  2EPO A;  2EM3 A;  2EWL A;  4TUI A;  2EP3 A;  2CT1 A;  2UXC E;  1F2I G;  2GPI A;  3ADG A;  3IWC A;  2RSM A;  5T6J A;  2LV2 A;  3HPS A;  1STU A;  4Q35 B;  4Q28 A;  2DMI A;  4L5N C;  5AC4 A;  4JI4 E;  3J81 C;  1A1L A;  1MGT A;  3K6Q A;  2YTE A;  3C4T A;  2EM9 A;  2EN7 A;  2EPC A;  4P7D A;  2YTG A;  2DLK A;  4DR5 E;  2UUC E;  4X66 E;  2ENC A;  2YU5 A;  5TSE A;  1HNW E;  1DGC A;  4DR4 E;  4LFB E;  2L6M A;  2V87 A;  2L8T A;  1SFE A;  4YHH E;  2LJH A;  2JOX A;  4R8O A;  1X5W A;  2DMY A;  4O4K A;  2FV4 B;  2LVH A;  4GKJ E;  3BBG A;  2VQE E;  1RC7 A;  2F8B A;  4JI8 E;  4LTY A;  4NXN E;  1X6E A;  2L2M A;  4BMJ A;  3JTZ A;  5F3W A;  4F9A B;  3EPH A;  2JOB A;  5ADZ A;  4HTG A;  1O0W A;  1BB8 A;  4RH8 A;  3LLH A;  1GZ6 A;  4R2C A;  2I9I A;  2EPZ A;  2DB2 A;  1T4N A;  3L00 A;  4DV3 E;  2LT7 A;  2JWO A;  2V83 A;  1ZBT A;  2B7T A;  2A25 A;  1A1I A;  5LMN E;  4DV2 E;  4O24 A;  3THN A;  4JI5 E;  2HC5 A;  5AE3 A;  2EPX A;  1T39 A;  1SR9 A;  3DF6 A;  1IBM E;  1T38 A;  2MC5 A;  1YSA C;  2EM4 A;  4F6M A;  2EMK A;  4NHR A;  1NCS A;  1B69 A;  2DLQ A;  2EL4 A;  2R1F A;  4DKK A;  1A1G A;  2LUQ A;  3QG5 C;  1X6H A;  4WSP A;  2B3T B;  2EQ0 A;  1A1F A;  1HNX E;  2NA2 A;  4N4R B;  2N8X A;  2EM5 A;  2WZO A;  2L2N A;  2L2K B;  4LF5 E;  2E1M A;  1PDA A;  4R2D A;  3KZY A;  3ZOQ B;  2YTF A;  2R76 A;  1EKZ A;  2ELZ A;  1KJK A;  2EPP A;  2DSY A;  3VYY A;  1UBD C;  1TN9 A;  2YTQ A;  4JI3 E;  2CSH A;  4F9C B;  1EH7 A;  4L8N A;  1XNR E;  3AV0 A;  2FGG A;  4O43 A;  2YRK A;  2EMG A;  3EPK A;  3J7Y p;  2N3H A;  1WHQ A;  2KHX A;  2HGH A;  2H36 X;  3C4B A;  2JP9 A;  2JR1 A;  4WPY A;  4JYA E;  4I8O A;  4KZS A;  1AAY A;  1YYK A;  4F9B B;  3UK3 C;  4LF4 E;  4BHC A;  3RMP A;  1YZ9 A;  1IBK E;  1N3G A;  4NZV A;  1RQ0 A;  2L33 A;  4BBY A;  2EMW A;  2EOE A;  2E72 A;  2UXB E;  1Z1B A;  5KL6 A;  2EN8 A;  3LML A;  1X47 A;  2EOY A;  4X8W A;  1X3C A;  1RMD A;  2RSI A;  2V86 A;  1XNQ E;  4LF7 E;  2VE7 C;  2V89 A;  2VF1 A;  2YTP A;  1FJG E;  1A1K A;  3HTX A;  4TUG A;  2J7J A;  5IT9 C;  2LMZ A;  1XMO E;  2EML A;  2EMC A;  1A1J A;  4X65 E;  4DV0 E;  4NXM E;  1J5E E;  3J80 C;  5AE2 A;  3FIG A;  4LFC E;  3KZZ A;  4LU9 A;  5KL3 A;  3F6G A;  2MC6 A;  4GKK E;  4LF6 E;  2RQL A;  3DJW A;  2EPK X;  3BID A;  4ZYH A;  5AE1 A;  2DGC A;  4DV4 E;  2JVA A;  2WBU A;  2ODR C;  2LRS A;  2LUP B;  2M7Q A;  5A6K A;  2EMB A;  3EPJ A;  4DR7 E;  1PJT A;  5KL5 A;  2L3J A;  1ZBQ A;  4LF8 E;  4WYQ B;  4ZYG A;  5A69 A;  4JI2 E;  2EZ6 A;  4R2A A;  2UUB E;  5LMU E;  4X62 E;  5AAS A;  1G2F C;  4F2J C;  1DQ3 A;  1YYW A;  1N32 E;  2WBS A;  3ADI A;  4DR2 E;  2EM2 A;  1J26 A;  4O5G A;  2EJ4 A;  4BC7 A;  2EOJ A;  3ADL A;  2RS7 A;  2YSO A;  2EN6 A;  4BS9 A;  4R2Q A;  1JK2 A;  2WCC 3;  1TF6 A;  4WX9 A;  2K4V A;  2YZT A;  4ZYD A;  1BBO A;  2EMY A;  4JI6 E;  3M99 B;  2B9D A;  2RPC A;  3T1Y E;  5KL4 A;  3AUZ A;  2EQ1 A;  4MLQ A;  2BB8 A;  1X48 A;  2ADR A;  2YRH A;  1A1H A;  2EQ3 A;  2KON A;  2NUF A;  1ZR9 A;  5IV8 B;  2YTO A;  3ECR A;  1QU6 A;  4X9J A;  2Q8U A;  2EOH A;  2EOX A;  3IWB A;  2DRP A;  5A6A A;  4IS1 C;  2BBG A;  2LCE A;  4YY3 E;  4JI7 E;  4X64 E;  2MKN A;  2EPN A;  4F54 A;  3ADJ A;  2YSP A;  3MHS C;  2G7H A;  2ENA A;  2YTD A;  4KHP E;  2I13 A;  4WFT A;  2UU9 E;  1X49 A;  4BC9 A;  4AQY E;  4R03 A;  2FTX B;  2M1S A;  1ZU1 A;  2V88 A;  4KWY A;  5KL7 A;  1WRJ A;  2ELY A;  3BF2 A;  4BCA A;  4MLV A;  2YTN A;  2KOU A;  2EOR A;  5DNY A;  2UXD E;  3MSW A;  4B3T E;  4DUY E;  2LJU A;  3EPL A;  2EPA A;  2RTX A;  4DR1 E;  3IWD A;  4FK5 C;  2EM7 A;  3P1X A;  2YT4 A;  1JK1 A;  4GZN C;  4LFA E;  3MHH C;  4DV1 E;  5A6B A;  2EMI A;  1PKP A;  4GEQ B;  3JAM C;  2ZM6 E;  2EPU A;  3VYX A;  5IXM B;  1T4L B;  1WHN A;  2LBS B;  2WBT A;  2B7V A;  5LL6 R;  2EN2 A;  1MEY C;  4M2Z A;  3HXL A;  2LTR A;  5LLQ A;  4RHB B;  2E5L E;  1QNT A;  4R2P A;  3OTO E;  2YPN A;  1UN6 B;  5IWA E;  1ZAA C;  2V85 A;  3F6H A;  4M30 A;  1N33 E;  5KL2 A;  2MKD A;  1PJS A;  4R2S A;  2F4V E;  1YUJ A; 
#chains in the Genus database with same CATH homology
 2EN1 A;  1G2F C;  2R1F A;  2LO3 A;  1A1G A;  4F2J C;  1X6H A;  2EN4 A;  2WBS A;  2YTJ A;  2EM2 A;  2EQ0 A;  2VRD A;  1A1F A;  2EOO A;  2EJ4 A;  2EM6 A;  2EOJ A;  2EMZ A;  2EM5 A;  2YSO A;  2EM3 A;  2EN6 A;  2NAB A;  4R2D A;  2EP3 A;  2CT1 A;  4R2Q A;  2YTF A;  1F2I G;  1JK2 A;  2WCC 3;  2EL5 A;  1TF6 A;  2LV2 A;  2ELZ A;  1KJK A;  2EPP A;  1UBD C;  1BBO A;  1TN9 A;  2EMY A;  3M99 B;  3VHT B;  2YTQ A;  2DMI A;  2RPC A;  2EOF A;  2CSH A;  4R2R A;  4WSG A;  2EE8 A;  5KL4 A;  2ENH A;  1A1L A;  2EQ1 A;  2BB8 A;  2ADR A;  2YRH A;  2EOZ A;  2YRK A;  2EMG A;  2EQ3 A;  1A1H A;  1ZR9 A;  3EPK A;  2YTE A;  2YTO A;  4X9J A;  2EPR A;  1LLM C;  2EM9 A;  2EMA A;  2EN7 A;  2EPC A;  2YU8 A;  2HGH A;  2EOH A;  2EOX A;  2YTG A;  2JP9 A;  2DRP A;  2DLK A;  2GHF A;  4IS1 C;  2ENC A;  2LCE A;  1AAY A;  2MKN A;  2YU5 A;  2YSP A;  1DGC A;  3MHS C;  3UK3 C;  2ENA A;  2YTD A;  1X5W A;  2EMW A;  2YRM A;  2EOE A;  2I13 A;  2E72 A;  2LVH A;  5KL6 A;  1Z1B A;  2EMX A;  2EN8 A;  5KL7 A;  1ZU1 A;  2EOY A;  2ELY A;  1X3C A;  1RMD A;  1X6E A;  2YTN A;  2RSI A;  3EPH A;  2YTP A;  2YTI A;  1G2D C;  1BB8 A;  2EN3 A;  2EOR A;  1A1K A;  4R2C A;  2J7J A;  2EPZ A;  4M9V C;  2M9A A;  3EPL A;  2D9H A;  2EML A;  2EPA A;  2EMC A;  1A1J A;  2LT7 A;  1WJP A;  1P47 A;  2EOI A;  4FK5 C;  2EM7 A;  2A25 A;  1X6F A;  1A1I A;  5KL3 A;  2MDG A;  1JK1 A;  2GLI A;  4GZN C;  3MHH C;  2CTD A;  4R2E A;  2EMF A;  2EPX A;  2DGC A;  2EMI A;  2PRT A;  2WBU A;  2EPU A;  2EM0 A;  2WBT A;  1YUI A;  2EMB A;  2EN2 A;  3EPJ A;  1MEY C;  5KL5 A;  2EOS A;  1YSA C;  2EM4 A;  4F6M A;  2EMK A;  4R2P A;  2EOQ A;  1UN6 B;  2EL6 A;  2EMH A;  1ZAA C;  1NCS A;  1B69 A;  2EOM A;  2EM8 A;  5KL2 A;  2MKD A;  4R2A A;  4R2S A;  4F6N A;  2DLQ A;  4IJD A;  2EL4 A;  1TF3 A;  2JPA A;  1YUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...