2EMAA

Solution structure of the c2h2 type zinc finger (region 312-344) of human zinc finger protein 347
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 312-344) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emaA01
2EMBA 2EQ0A 1X6EA 1ZU1A 2DLKA 2EMYA 5KL7A 2EPPA 2EN1A 1A1GA 2EOFA 2EOMA 1NCSA 5KL5A 2A25A 2ENHA 2RPCA 5KL2A 2EQ3A 2EPXA 4X9JA 2YRHA 1A1LA 1AAYA 4IS1C 2YTFA 1BBOA 2GHFA 2EM5A 1B69A 2EN8A 2ELYA 2EMZA 2CT1A 1A1IA 2GLIA 2EM0A 2HGHA 4R2AA 1YUJA 1TN9A 5KL4A 2EOXA 2J7JA 2YTDA 4WSGA 1F2IG 2M9AA 2DGCA 2EM8A 2EN3A 2EPZA 2WCC3 3EPLA 2EMFA 2EOOA 1A1JA 1A1KA 1JK2A 2EOZA 2ENCA 2EL4A 2NABA 2YTQA 4M9VC 2EPAA 4F2JC 2EN6A 2EM2A 2EM7A 2EMHA 2LO3A 2EOHA 1UBDC 4R2DA 2WBTA 2EE8A 2JP9A 1UN6B 2CTDA 4R2QA 2EPRA 2EMKA 2EORA 2CSHA 2WBSA 2YTGA 2EM3A 2PRTA 3M99B 5KL3A 1YSAC 2BB8A 2WBUA 2R1FA 2EL6A 1YUIA 2LVHA 4R2CA 2EPCA 2DLQA 2E72A 2DMIA 2EM6A 2EJ4A 2YU5A 1DGCA 2EMAA 1JK1A 2EN4A 2LV2A 2YTJA 2EOEA 2I13A 5KL6A 2MKDA 2JPAA 2EPUA 1RMDA 2EOIA 2YTOA 2EOSA 4IJDA 4F6MA 1ZR9A 2YTEA 1P47A 3EPHA 2YSOA 1A1HA 1G2DC 1MEYC 2MDGA 1X5WA 2ELZA 4FK5C 1BB8A 2YTIA 2EN2A 3MHHC 2YTPA 2EN7A 3UK3C 1TF6A 2EP3A 4R2PA 2EOYA 2YRMA 2VRDA 3MHSC 2LCEA 2YTNA 4R2RA 4GZNC 2EMWA 1X6HA 1G2FC 2EMIA 1TF3A 1WJPA 2LT7A 4F6NA 2EMGA 1X6FA 2DRPA 1ZAAC 2EL5A 2ENAA 2EMXA 2EOQA 1LLMC 2EQ1A 3EPJA 2D9HA 2ADRA 2EOJA 1A1FA 1Z1BA 1X3CA 3VHTB 2EMLA 2YSPA 3EPKA 2MKNA 2RSIA 2EMCA 4R2EA 2EM4A 4R2SA 2YRKA 2EM9A 1KJKA 2YU8A
chains in the Genus database with same CATH superfamily
4B3RE 1GZ6A 2DLKA 4DV3E 4LF6E 3J80C 5KL7A 4KZSA 2DMYA 4X66E 2EOFA 2LUQA 5KL5A 2EQ3A 2I9IA 2WZOA 2YTFA 2L2KB 1FJGE 2N3HA 2B7VA 1B69A 2JOXA 2ELYA 4NZVA 5A2QC 4TUGA 4JI2E 2LMZA 3VK6A 3AUZA 5F3WA 4DV5E 2EMFA 3ECRA 1A1JA 4F9BB 3ADJA 1A1KA 2L6MA 2YTQA 4WFTA 3BGHA 4DV1E 2ODRD 2EN6A 1IBME 4P7DA 2WBTA 1XNRE 1N32E 4DV6E 2GPIA 2N3GA 2RQLA 4GKKE 1T4OA 4ZYEA 2EORA 2WBSA 2YTGA 2EM3A 2UXBE 2YPNA 3M99B 3J7Yp 2L92A 4RH8A 2F8BA 2R1FA 1YUIA 2EPCA 2DLQA 3C4TA 4O4KA 1T39A 3TQMA 2EJ4A 4DR5E 1JK1A 4F54A 4LFCE 2LRSA 2KOUA 4BBYA 1RMDA 5AC5A 2YTOA 4JI0E 2EOSA 3VYYA 4WX9A 2UXCE 3EPHA 2YSOA 2V85A 2Q8UA 5LLQA 4ZYDA 2M1SA 2EN2A 3MHHC 1PKPA 2EN7A 4LFAE 1G2FC 1WHNA 2YTNA 4GZNC 1X6HA 1TF3A 3JTZA 4F6NA 2EMGA 1ZAAC 2ENAA 1LLMC 4DR7E 1WRJA 2D9HA 1FKAE 2YSPA 3KWRA 1IBKE 2V86A 4JI3E 4R2EA 1UHZA 2YT4A 4NHRA 2EM9A 5ADZA 2HHHE 2UXDE 1HR0E 4B3SE 2EQ0A 1X6EA 2EN1A 1A1GA 1N34E 3IWBA 4JV5E 2RPCA 2LJHA 2EPXA 5AC4A 1T4LB 1ZBQA 4X9JA 4LF7E 2G7HA 2V89A 2M7QA 2FGGA 1BBOA 1IMUA 5IV8B 2MC6A 2EM5A 1N33E 2E1MA 4R2AA 2BBGA 4ZYHA 4DV7E 1TN9A 5KL4A 2UU9E 4WSGA 1F2IG 2JR1A 2DGCA 2EN3A 2LTSA 4DV4E 2ZM6E 5LL6R 3DF6A 2NUFA 4MLQA 2EOOA 3FIGA 4O5GA 1YYOA 2ODRC 1KYQA 2ENCA 4BHCA 2EL4A 2NABA 4M9VC 4MLVA 4M30A 2LTRA 4TUIA 2UUBE 2EMHA 2EOHA 1UILA 2V83A 4DUYE 2LJUA 5LMUE 2JP9A 2IHR1 3C6KA 4R2QA 4BC9A 2CSHA 3THNA 4Q28A 2EL6A 2YZTA 1PDAA 2E72A 2JWOA 2DMIA 3IWCA 2EM6A 2RSMA 2LBSB 2YU5A 4B3ME 1WHQA 4AQYE 5DNYA 2EPOA 1ZBTA 2DSYA 2LV2A 2EPNA 4O24A 2DB2A 4LF8E 4BHBA 2V87A 3C4BA 4F6MA 4ZYGA 4L5NC 3P1XA 4L8NA 1X47A 2MDGA 2EPKX 2MDRA 2YTIA 4LTYA 4JI7E 3C6MA 1EH6A 2FTXB 4DKKA 1PJTA 2EOYA 3MHSC 4R8OA 2LCEA 2EMWA 2EMIA 4WXDA 1X6FA 3EQ1A 2EMXA 2EOQA 2EOJA 4DUZE 1X3CA 2EMLA 2HC5A 1L4SA 2MKNA 2RSIA 4R2SA 4Q35B 2V88A 3K6QA 2E5LE 2EMBA 4OX9E 4X62E 2L3CA 1ZU1A 2K7IA 2EOMA 5KL2A 5IT9C 3H09A 3BIDA 5A6BD 1A1LA 4X8WA 1T38A 2EWLA 4JI8E 3ADIA 4X64E 2EN8A 4I8OA 2CT1A 3VYXA 2GLIA 2EM0A 1PJQA 3J7AG 1EH8A 2EPMX 1YUJA 3L00A 4DR6E 1PJSA 2JVAA 2B9DA 4LFBE 3ADLA 3EPLA 3ADGA 5T6JA 2EOZA 4F9AB 2NUGA 2JXPA 2KHXA 5A69A 4F2JC 4WXCA 2RS7A 5AE1A 4NXNE 2EM7A 4DR4E 4JI6E 2JY9A 5IWAE 1QNTA 2VF1A 4R2DA 2EE8A 2L2NA 2CTDA 4O43A 2UUCE 3LLHA 2EPRA 2EMKA 4DV2E 4NXME 2PRTA 1QU6A 2BB8A 3F6HA 2MC5A 2LVHA 4R2CA 2HJJA 4BC7A 2L8TA 1IQSA 4M2ZA 1J26A 3BBGA 1NEIA 1N36E 3T1HE 3JU0A 1DGCA 5A6BA 2EMAA 4BMJA 3KZZA 2YTJA 2MKDA 2JPAA 2EPUA 1RQ0A 2EOIA 2RS6A 4IJDA 1ZR9A 4P78A 1P47A 3ZOQB 1A1HA 4WSPA 1G2DC 1MEYC 4DV0E 3IWDA 4M0VA 1BB8A 1WXRA 3UK3C 1J5EE 1HNXE 2JOBA 1YZ9A 1BBGA 4R2PA 4R2RA 1IBLE 2LT7A 1XNQE 2DRPA 2EL5A 2DIXA 2EQ1A 2F4VE 4B3TE 2L33A 4YY3E 3VHTB 2FV4B 2YRKA 1XMQE 5AASA 2VE7C 4HTGA 2UUAE 2EZ6A 3AV0A 1GQEA 1YYKA 2CPNA 2EMYA 1XMOE 2EPPA 4DR2E 2KONA 1NCSA 4LU9A 2A25A 2ENHA 4BS9A 4K0KE 1EKZA 2NUEA 5LMNE 1X48A 3J81C 3RMPA 1RC7A 4LF4E 1AAYA 2YRHA 4IS1C 4R03A 2GHFA 2H36X 4WPYA 2L3JA 3HTXA 1T4NA 2EMZA 2NA2A 1A1IA 2RTXA 2HGHA 4LF9E 5A6AA 2YWQA 5IXMB 2EOXA 3MSWA 2J7JA 2YTDA 3HPSA 2M9AA 2EM8A 3OMLA 2EPZA 4GEQB 3JAMC 2WCC3 3HXLA 3THOB 4OOGC 4LF5E 3F6GA 3HQ1A 1JK2A 2M4IA 4YHHE 2EPAA 2N8XA 1HNWE 2EM2A 2LO3A 1UBDC 5FLXC 3OTOE 4JI5E 1AH5A 1DQ3A 4BCAA 1UN6B 4WYQB 4JYAE 1YYWA 1IQOA 3LMLA 4N4RB 2VQEE 4KWYA 5AE2A 1SR9A 5KL3A 2B7TA 2VQFE 1YSAC 2WBUA 2L2MA 1EH7A 2JYAA 2EPLX 2EN4A 2I13A 2EOEA 5KL6A 1I94E 1SFEA 4GKJE 2V8QB 4F9CB 1GTKA 1YPNA 5TSEA 4KHPE 5BR8E 2YTEA 3T1YE 5A6JA 2B3TB 4JI1E 4HEIA 1X5WA 2ELZA 1N3GA 4FK5C 2LE2A 1O0WA 1HNZE 1DI2A 2YTPA 1TF6A 1X49A 2EP3A 2R76A 2YRMA 2VRDA 3DJWA 4X65E 1MGTA 4DR3E 1WJPA 4DMIA 2K4VA 2LUPB 3EPJA 4JI4E 2ADRA 1A1FA 1Z1BA 1STUA 3KZYA 3EPKA 4DR1E 1YFHA 4J8ZA 2EMCA 2EM4A 5A6KA 4RHBB 5AE3A 3QG5C 3HPZA 3BF2A 1KJKA 2YU8A 5CFFE
chains in the Genus database with same CATH topology
2EMBA 2EQ0A 1X6EA 1ZU1A 2DLKA 2EMYA 5KL7A 2EPPA 2EN1A 1A1GA 2EOFA 2EOMA 1NCSA 5KL5A 2A25A 2ENHA 2RPCA 5KL2A 2EQ3A 2EPXA 4X9JA 2YRHA 1A1LA 1AAYA 4IS1C 2YTFA 1BBOA 2GHFA 2EM5A 1B69A 2EN8A 2ELYA 2EMZA 2CT1A 1A1IA 2GLIA 2EM0A 2HGHA 4R2AA 1YUJA 1TN9A 5KL4A 2EOXA 2J7JA 2YTDA 4WSGA 1F2IG 2M9AA 2DGCA 2EM8A 2EN3A 2EPZA 2WCC3 3EPLA 2EMFA 2EOOA 1A1JA 1A1KA 1JK2A 2EOZA 2ENCA 2EL4A 2NABA 2YTQA 4M9VC 2EPAA 4F2JC 2EN6A 2EM2A 2EM7A 2EMHA 2LO3A 2EOHA 1UBDC 4R2DA 2WBTA 2EE8A 2JP9A 1UN6B 2CTDA 4R2QA 2EPRA 2EMKA 2EORA 2CSHA 2WBSA 2YTGA 2EM3A 2PRTA 3M99B 5KL3A 1YSAC 2BB8A 2WBUA 2R1FA 2EL6A 1YUIA 2LVHA 4R2CA 2EPCA 2DLQA 2E72A 2DMIA 2EM6A 2EJ4A 2YU5A 1DGCA 2EMAA 1JK1A 2EN4A 2LV2A 2YTJA 2EOEA 2I13A 5KL6A 2MKDA 2JPAA 2EPUA 1RMDA 2EOIA 2YTOA 2EOSA 4IJDA 4F6MA 1ZR9A 2YTEA 1P47A 3EPHA 2YSOA 1A1HA 1G2DC 1MEYC 2MDGA 1X5WA 2ELZA 4FK5C 1BB8A 2YTIA 2EN2A 3MHHC 2YTPA 2EN7A 3UK3C 1TF6A 2EP3A 4R2PA 2EOYA 2YRMA 2VRDA 3MHSC 2LCEA 2YTNA 4R2RA 4GZNC 2EMWA 1X6HA 1G2FC 2EMIA 1TF3A 1WJPA 2LT7A 4F6NA 2EMGA 1X6FA 2DRPA 1ZAAC 2EL5A 2ENAA 2EMXA 2EOQA 1LLMC 2EQ1A 3EPJA 2D9HA 2ADRA 2EOJA 1A1FA 1Z1BA 1X3CA 3VHTB 2EMLA 2YSPA 3EPKA 2MKNA 2RSIA 2EMCA 4R2EA 2EM4A 4R2SA 2YRKA 2EM9A 1KJKA 2YU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMB A;  2EQ0 A;  1X6E A;  1ZU1 A;  2DLK A;  2EMY A;  5KL7 A;  2EPP A;  2EN1 A;  1A1G A;  2EOF A;  2EOM A;  1NCS A;  5KL5 A;  2A25 A;  2ENH A;  2RPC A;  5KL2 A;  2EQ3 A;  2EPX A;  4X9J A;  2YRH A;  1A1L A;  1AAY A;  4IS1 C;  2YTF A;  1BBO A;  2GHF A;  2EM5 A;  1B69 A;  2EN8 A;  2ELY A;  2EMZ A;  2CT1 A;  1A1I A;  2GLI A;  2EM0 A;  2HGH A;  4R2A A;  1YUJ A;  1TN9 A;  5KL4 A;  2EOX A;  2J7J A;  2YTD A;  4WSG A;  1F2I G;  2M9A A;  2DGC A;  2EM8 A;  2EN3 A;  2EPZ A;  2WCC 3;  3EPL A;  2EMF A;  2EOO A;  1A1J A;  1A1K A;  1JK2 A;  2EOZ A;  2ENC A;  2EL4 A;  2NAB A;  2YTQ A;  4M9V C;  2EPA A;  4F2J C;  2EN6 A;  2EM2 A;  2EM7 A;  2EMH A;  2LO3 A;  2EOH A;  1UBD C;  4R2D A;  2WBT A;  2EE8 A;  2JP9 A;  1UN6 B;  2CTD A;  4R2Q A;  2EPR A;  2EMK A;  2EOR A;  2CSH A;  2WBS A;  2YTG A;  2EM3 A;  2PRT A;  3M99 B;  5KL3 A;  1YSA C;  2BB8 A;  2WBU A;  2R1F A;  2EL6 A;  1YUI A;  2LVH A;  4R2C A;  2EPC A;  2DLQ A;  2E72 A;  2DMI A;  2EM6 A;  2EJ4 A;  2YU5 A;  1DGC A;  2EMA A;  1JK1 A;  2EN4 A;  2LV2 A;  2YTJ A;  2EOE A;  2I13 A;  5KL6 A;  2MKD A;  2JPA A;  2EPU A;  1RMD A;  2EOI A;  2YTO A;  2EOS A;  4IJD A;  4F6M A;  1ZR9 A;  2YTE A;  1P47 A;  3EPH A;  2YSO A;  1A1H A;  1G2D C;  1MEY C;  2MDG A;  1X5W A;  2ELZ A;  4FK5 C;  1BB8 A;  2YTI A;  2EN2 A;  3MHH C;  2YTP A;  2EN7 A;  3UK3 C;  1TF6 A;  2EP3 A;  4R2P A;  2EOY A;  2YRM A;  2VRD A;  3MHS C;  2LCE A;  2YTN A;  4R2R A;  4GZN C;  2EMW A;  1X6H A;  1G2F C;  2EMI A;  1TF3 A;  1WJP A;  2LT7 A;  4F6N A;  2EMG A;  1X6F A;  2DRP A;  1ZAA C;  2EL5 A;  2ENA A;  2EMX A;  2EOQ A;  1LLM C;  2EQ1 A;  3EPJ A;  2D9H A;  2ADR A;  2EOJ A;  1A1F A;  1Z1B A;  1X3C A;  3VHT B;  2EML A;  2YSP A;  3EPK A;  2MKN A;  2RSI A;  2EMC A;  4R2E A;  2EM4 A;  4R2S A;  2YRK A;  2EM9 A;  1KJK A;  2YU8 A; 
#chains in the Genus database with same CATH topology
 4B3R E;  1GZ6 A;  2DLK A;  4DV3 E;  4LF6 E;  3J80 C;  5KL7 A;  4KZS A;  2DMY A;  4X66 E;  2EOF A;  2LUQ A;  5KL5 A;  2EQ3 A;  2I9I A;  2WZO A;  2YTF A;  2L2K B;  1FJG E;  2N3H A;  2B7V A;  1B69 A;  2JOX A;  2ELY A;  4NZV A;  5A2Q C;  4TUG A;  4JI2 E;  2LMZ A;  3VK6 A;  3AUZ A;  5F3W A;  4DV5 E;  2EMF A;  3ECR A;  1A1J A;  4F9B B;  3ADJ A;  1A1K A;  2L6M A;  2YTQ A;  4WFT A;  3BGH A;  4DV1 E;  2ODR D;  2EN6 A;  1IBM E;  4P7D A;  2WBT A;  1XNR E;  1N32 E;  4DV6 E;  2GPI A;  2N3G A;  2RQL A;  4GKK E;  1T4O A;  4ZYE A;  2EOR A;  2WBS A;  2YTG A;  2EM3 A;  2UXB E;  2YPN A;  3M99 B;  3J7Y p;  2L92 A;  4RH8 A;  2F8B A;  2R1F A;  1YUI A;  2EPC A;  2DLQ A;  3C4T A;  4O4K A;  1T39 A;  3TQM A;  2EJ4 A;  4DR5 E;  1JK1 A;  4F54 A;  4LFC E;  2LRS A;  2KOU A;  4BBY A;  1RMD A;  5AC5 A;  2YTO A;  4JI0 E;  2EOS A;  3VYY A;  4WX9 A;  2UXC E;  3EPH A;  2YSO A;  2V85 A;  2Q8U A;  5LLQ A;  4ZYD A;  2M1S A;  2EN2 A;  3MHH C;  1PKP A;  2EN7 A;  4LFA E;  1G2F C;  1WHN A;  2YTN A;  4GZN C;  1X6H A;  1TF3 A;  3JTZ A;  4F6N A;  2EMG A;  1ZAA C;  2ENA A;  1LLM C;  4DR7 E;  1WRJ A;  2D9H A;  1FKA E;  2YSP A;  3KWR A;  1IBK E;  2V86 A;  4JI3 E;  4R2E A;  1UHZ A;  2YT4 A;  4NHR A;  2EM9 A;  5ADZ A;  2HHH E;  2UXD E;  1HR0 E;  4B3S E;  2EQ0 A;  1X6E A;  2EN1 A;  1A1G A;  1N34 E;  3IWB A;  4JV5 E;  2RPC A;  2LJH A;  2EPX A;  5AC4 A;  1T4L B;  1ZBQ A;  4X9J A;  4LF7 E;  2G7H A;  2V89 A;  2M7Q A;  2FGG A;  1BBO A;  1IMU A;  5IV8 B;  2MC6 A;  2EM5 A;  1N33 E;  2E1M A;  4R2A A;  2BBG A;  4ZYH A;  4DV7 E;  1TN9 A;  5KL4 A;  2UU9 E;  4WSG A;  1F2I G;  2JR1 A;  2DGC A;  2EN3 A;  2LTS A;  4DV4 E;  2ZM6 E;  5LL6 R;  3DF6 A;  2NUF A;  4MLQ A;  2EOO A;  3FIG A;  4O5G A;  1YYO A;  2ODR C;  1KYQ A;  2ENC A;  4BHC A;  2EL4 A;  2NAB A;  4M9V C;  4MLV A;  4M30 A;  2LTR A;  4TUI A;  2UUB E;  2EMH A;  2EOH A;  1UIL A;  2V83 A;  4DUY E;  2LJU A;  5LMU E;  2JP9 A;  2IHR 1;  3C6K A;  4R2Q A;  4BC9 A;  2CSH A;  3THN A;  4Q28 A;  2EL6 A;  2YZT A;  1PDA A;  2E72 A;  2JWO A;  2DMI A;  3IWC A;  2EM6 A;  2RSM A;  2LBS B;  2YU5 A;  4B3M E;  1WHQ A;  4AQY E;  5DNY A;  2EPO A;  1ZBT A;  2DSY A;  2LV2 A;  2EPN A;  4O24 A;  2DB2 A;  4LF8 E;  4BHB A;  2V87 A;  3C4B A;  4F6M A;  4ZYG A;  4L5N C;  3P1X A;  4L8N A;  1X47 A;  2MDG A;  2EPK X;  2MDR A;  2YTI A;  4LTY A;  4JI7 E;  3C6M A;  1EH6 A;  2FTX B;  4DKK A;  1PJT A;  2EOY A;  3MHS C;  4R8O A;  2LCE A;  2EMW A;  2EMI A;  4WXD A;  1X6F A;  3EQ1 A;  2EMX A;  2EOQ A;  2EOJ A;  4DUZ E;  1X3C A;  2EML A;  2HC5 A;  1L4S A;  2MKN A;  2RSI A;  4R2S A;  4Q35 B;  2V88 A;  3K6Q A;  2E5L E;  2EMB A;  4OX9 E;  4X62 E;  2L3C A;  1ZU1 A;  2K7I A;  2EOM A;  5KL2 A;  5IT9 C;  3H09 A;  3BID A;  5A6B D;  1A1L A;  4X8W A;  1T38 A;  2EWL A;  4JI8 E;  3ADI A;  4X64 E;  2EN8 A;  4I8O A;  2CT1 A;  3VYX A;  2GLI A;  2EM0 A;  1PJQ A;  3J7A G;  1EH8 A;  2EPM X;  1YUJ A;  3L00 A;  4DR6 E;  1PJS A;  2JVA A;  2B9D A;  4LFB E;  3ADL A;  3EPL A;  3ADG A;  5T6J A;  2EOZ A;  4F9A B;  2NUG A;  2JXP A;  2KHX A;  5A69 A;  4F2J C;  4WXC A;  2RS7 A;  5AE1 A;  4NXN E;  2EM7 A;  4DR4 E;  4JI6 E;  2JY9 A;  5IWA E;  1QNT A;  2VF1 A;  4R2D A;  2EE8 A;  2L2N A;  2CTD A;  4O43 A;  2UUC E;  3LLH A;  2EPR A;  2EMK A;  4DV2 E;  4NXM E;  2PRT A;  1QU6 A;  2BB8 A;  3F6H A;  2MC5 A;  2LVH A;  4R2C A;  2HJJ A;  4BC7 A;  2L8T A;  1IQS A;  4M2Z A;  1J26 A;  3BBG A;  1NEI A;  1N36 E;  3T1H E;  3JU0 A;  1DGC A;  5A6B A;  2EMA A;  4BMJ A;  3KZZ A;  2YTJ A;  2MKD A;  2JPA A;  2EPU A;  1RQ0 A;  2EOI A;  2RS6 A;  4IJD A;  1ZR9 A;  4P78 A;  1P47 A;  3ZOQ B;  1A1H A;  4WSP A;  1G2D C;  1MEY C;  4DV0 E;  3IWD A;  4M0V A;  1BB8 A;  1WXR A;  3UK3 C;  1J5E E;  1HNX E;  2JOB A;  1YZ9 A;  1BBG A;  4R2P A;  4R2R A;  1IBL E;  2LT7 A;  1XNQ E;  2DRP A;  2EL5 A;  2DIX A;  2EQ1 A;  2F4V E;  4B3T E;  2L33 A;  4YY3 E;  3VHT B;  2FV4 B;  2YRK A;  1XMQ E;  5AAS A;  2VE7 C;  4HTG A;  2UUA E;  2EZ6 A;  3AV0 A;  1GQE A;  1YYK A;  2CPN A;  2EMY A;  1XMO E;  2EPP A;  4DR2 E;  2KON A;  1NCS A;  4LU9 A;  2A25 A;  2ENH A;  4BS9 A;  4K0K E;  1EKZ A;  2NUE A;  5LMN E;  1X48 A;  3J81 C;  3RMP A;  1RC7 A;  4LF4 E;  1AAY A;  2YRH A;  4IS1 C;  4R03 A;  2GHF A;  2H36 X;  4WPY A;  2L3J A;  3HTX A;  1T4N A;  2EMZ A;  2NA2 A;  1A1I A;  2RTX A;  2HGH A;  4LF9 E;  5A6A A;  2YWQ A;  5IXM B;  2EOX A;  3MSW A;  2J7J A;  2YTD A;  3HPS A;  2M9A A;  2EM8 A;  3OML A;  2EPZ A;  4GEQ B;  3JAM C;  2WCC 3;  3HXL A;  3THO B;  4OOG C;  4LF5 E;  3F6G A;  3HQ1 A;  1JK2 A;  2M4I A;  4YHH E;  2EPA A;  2N8X A;  1HNW E;  2EM2 A;  2LO3 A;  1UBD C;  5FLX C;  3OTO E;  4JI5 E;  1AH5 A;  1DQ3 A;  4BCA A;  1UN6 B;  4WYQ B;  4JYA E;  1YYW A;  1IQO A;  3LML A;  4N4R B;  2VQE E;  4KWY A;  5AE2 A;  1SR9 A;  5KL3 A;  2B7T A;  2VQF E;  1YSA C;  2WBU A;  2L2M A;  1EH7 A;  2JYA A;  2EPL X;  2EN4 A;  2I13 A;  2EOE A;  5KL6 A;  1I94 E;  1SFE A;  4GKJ E;  2V8Q B;  4F9C B;  1GTK A;  1YPN A;  5TSE A;  4KHP E;  5BR8 E;  2YTE A;  3T1Y E;  5A6J A;  2B3T B;  4JI1 E;  4HEI A;  1X5W A;  2ELZ A;  1N3G A;  4FK5 C;  2LE2 A;  1O0W A;  1HNZ E;  1DI2 A;  2YTP A;  1TF6 A;  1X49 A;  2EP3 A;  2R76 A;  2YRM A;  2VRD A;  3DJW A;  4X65 E;  1MGT A;  4DR3 E;  1WJP A;  4DMI A;  2K4V A;  2LUP B;  3EPJ A;  4JI4 E;  2ADR A;  1A1F A;  1Z1B A;  1STU A;  3KZY A;  3EPK A;  4DR1 E;  1YFH A;  4J8Z A;  2EMC A;  2EM4 A;  5A6K A;  4RHB B;  5AE3 A;  3QG5 C;  3HPZ A;  3BF2 A;  1KJK A;  2YU8 A;  5CFF E; 
#chains in the Genus database with same CATH homology
 2EMB A;  2EQ0 A;  1X6E A;  1ZU1 A;  2DLK A;  2EMY A;  5KL7 A;  2EPP A;  2EN1 A;  1A1G A;  2EOF A;  2EOM A;  1NCS A;  5KL5 A;  2A25 A;  2ENH A;  2RPC A;  5KL2 A;  2EQ3 A;  2EPX A;  4X9J A;  2YRH A;  1A1L A;  1AAY A;  4IS1 C;  2YTF A;  1BBO A;  2GHF A;  2EM5 A;  1B69 A;  2EN8 A;  2ELY A;  2EMZ A;  2CT1 A;  1A1I A;  2GLI A;  2EM0 A;  2HGH A;  4R2A A;  1YUJ A;  1TN9 A;  5KL4 A;  2EOX A;  2J7J A;  2YTD A;  4WSG A;  1F2I G;  2M9A A;  2DGC A;  2EM8 A;  2EN3 A;  2EPZ A;  2WCC 3;  3EPL A;  2EMF A;  2EOO A;  1A1J A;  1A1K A;  1JK2 A;  2EOZ A;  2ENC A;  2EL4 A;  2NAB A;  2YTQ A;  4M9V C;  2EPA A;  4F2J C;  2EN6 A;  2EM2 A;  2EM7 A;  2EMH A;  2LO3 A;  2EOH A;  1UBD C;  4R2D A;  2WBT A;  2EE8 A;  2JP9 A;  1UN6 B;  2CTD A;  4R2Q A;  2EPR A;  2EMK A;  2EOR A;  2CSH A;  2WBS A;  2YTG A;  2EM3 A;  2PRT A;  3M99 B;  5KL3 A;  1YSA C;  2BB8 A;  2WBU A;  2R1F A;  2EL6 A;  1YUI A;  2LVH A;  4R2C A;  2EPC A;  2DLQ A;  2E72 A;  2DMI A;  2EM6 A;  2EJ4 A;  2YU5 A;  1DGC A;  2EMA A;  1JK1 A;  2EN4 A;  2LV2 A;  2YTJ A;  2EOE A;  2I13 A;  5KL6 A;  2MKD A;  2JPA A;  2EPU A;  1RMD A;  2EOI A;  2YTO A;  2EOS A;  4IJD A;  4F6M A;  1ZR9 A;  2YTE A;  1P47 A;  3EPH A;  2YSO A;  1A1H A;  1G2D C;  1MEY C;  2MDG A;  1X5W A;  2ELZ A;  4FK5 C;  1BB8 A;  2YTI A;  2EN2 A;  3MHH C;  2YTP A;  2EN7 A;  3UK3 C;  1TF6 A;  2EP3 A;  4R2P A;  2EOY A;  2YRM A;  2VRD A;  3MHS C;  2LCE A;  2YTN A;  4R2R A;  4GZN C;  2EMW A;  1X6H A;  1G2F C;  2EMI A;  1TF3 A;  1WJP A;  2LT7 A;  4F6N A;  2EMG A;  1X6F A;  2DRP A;  1ZAA C;  2EL5 A;  2ENA A;  2EMX A;  2EOQ A;  1LLM C;  2EQ1 A;  3EPJ A;  2D9H A;  2ADR A;  2EOJ A;  1A1F A;  1Z1B A;  1X3C A;  3VHT B;  2EML A;  2YSP A;  3EPK A;  2MKN A;  2RSI A;  2EMC A;  4R2E A;  2EM4 A;  4R2S A;  2YRK A;  2EM9 A;  1KJK A;  2YU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...