2M9AA

Solution nmr structure of e3 ubiquitin-protein ligase zfp91 from homo sapiens, northeast structural genomics consortium (nesg) target hr7784a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
HMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords E3 ubiquitin-protein ligase ZFP91
publication title Solution Structure of Hr7784A
rcsb
source organism Homo sapiens
total genus 23
structure length 89
sequence length 89
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA03
2EMFA 2EN7A 2LVHA 1MEYC 3M99B 1UN6B 2EN1A 2YSOA 2EP3A 2GLIA 4IS1C 2ENHA 1A1FA 4R2CA 1LLMC 2R1FA 2DMIA 2YU8A 1A1JA 2EN2A 4F2JC 2EE8A 2EM5A 2PRTA 2E72A 2EMHA 1G2DC 4IJDA 1TN9A 2EM4A 2EJ4A 2EMZA 2ELZA 5KL6A 1JK1A 1X6FA 2ELYA 2EM6A 1A1HA 2EOHA 1X6EA 1RMDA 2EOXA 2EL4A 2EN4A 2EQ1A 2YRMA 2I13A 3MHHC 2MKDA 2YTNA 2D9HA 2LV2A 2VRDA 2YU5A 2YTQA 2EM2A 2EMAA 2EOOA 2YTFA 2EMGA 2HGHA 2EM0A 2BB8A 3UK3C 2YRKA 2EPPA 2DRPA 2LO3A 2MKNA 2EOYA 2EMXA 2EOFA 2ADRA 1X5WA 2EM9A 2EOSA 5KL7A 1TF3A 5KL5A 2YTJA 2EN8A 2WBUA 4R2PA 5KL3A 1F2IG 2EOZA 2WBSA 2ENCA 2EPAA 4R2DA 1DGCA 2EQ0A 1YUIA 2RSIA 2YTOA 2EPUA 3EPJA 5KL4A 5KL2A 1X6HA 2M9AA 1KJKA 2EPCA 2NABA 2RPCA 2EL5A 2EM7A 1ZR9A 2ENAA 1TF6A 2EMKA 4F6MA 2YTGA 4FK5C 3VHTB 2GHFA 1NCSA 2EL6A 2WCC3 1BBOA 4WSGA 2EN6A 2EOIA 2CSHA 2EORA 4R2QA 1P47A 2DLQA 2EMCA 2YTEA 2CT1A 2YRHA 1WJPA 2A25A 2EOMA 1YUJA 2EPXA 2EMIA 2JPAA 2LCEA 2EMLA 1X3CA 2EPZA 3MHSC 1ZU1A 2EPRA 3EPLA 2EM8A 2EMBA 1BB8A 4R2EA 1A1IA 2YTPA 2EMWA 2YSPA 2EQ3A 2WBTA 2YTDA 2MDGA 2EOJA 3EPKA 2JP9A 4R2SA 4M9VC 1JK2A 4F6NA 4GZNC 2EOQA 2CTDA 3EPHA 1YSAC 1ZAAC 2EN3A 4R2RA 1G2FC 1A1LA 1A1GA 1AAYA 2DGCA 4X9JA 1B69A 2EM3A 2LT7A 2EMYA 2J7JA 1UBDC 2DLKA 2EOEA 4R2AA 1A1KA 1Z1BA 2YTIA
chains in the Genus database with same CATH superfamily
2EMFA 3F6HA 2EP3A 5DNYA 4IS1C 4R2CA 2EN2A 1I94E 2LBSB 2EM5A 4BS9A 2PRTA 2E72A 4IJDA 3OMLA 2JXPA 5KL6A 2ELZA 1JK1A 2UXDE 4NXNE 4YHHE 2EOHA 4RHBB 1RMDA 2I13A 1SFEA 2EZ6A 1HR0E 1DI2A 4O43A 4JI7E 2LTSA 1WXRA 4WFTA 2EMAA 1FJGE 2HGHA 2LO3A 2EOYA 2EPLX 3FIGA 2H36X 1X5WA 5KL7A 3AV0A 1TF3A 2ODRD 4B3TE 2WBUA 2E5LE 5KL3A 1IBKE 2B3TB 2WBSA 2HC5A 4X8WA 4R2DA 2B7TA 2EQ0A 2VE7C 1T39A 1YUIA 2RQLA 2RSIA 2EPUA 2EPMX 1O0WA 2Q8UA 2RS6A 4TUGA 4X65E 3T1HE 2DIXA 1KJKA 2EPCA 4DKKA 2EL5A 5A6JA 3P1XA 2EM7A 4OOGC 1XNRE 2N3HA 2YTGA 5LLQA 4HEIA 4JI5E 2EL6A 1BBOA 4WXDA 3J7AG 2EOIA 1WHNA 1P47A 2YTEA 4JI8E 4F9BB 2EOMA 5AE1A 3VYYA 5AC4A 2EPKX 2EPXA 2JPAA 2LCEA 1X3CA 1ZU1A 3BIDA 2LJHA 1N33E 1BB8A 4R2EA 2LMZA 2EMWA 2BBGA 2YSPA 4F9CB 3HTXA 2L3JA 2EOJA 2L2NA 4R2SA 1JK2A 4F6NA 2EOQA 4AQYE 5IV8B 4KHPE 5A6BA 5A6AA 1A1LA 4LFAE 2WZOA 2JWOA 4JI0E 4X9JA 3J81C 2K7IA 3MSWA 2J7JA 2DLKA 2L3CA 1Z1BA 2V88A 3HPZA 2JYAA 4ZYHA 2LVHA 2L92A 2EN1A 3IWCA 2VQEE 3LMLA 2R1FA 3ADGA 4JI4E 2YU8A 2EE8A 4LF7E 4LFBE 2JR1A 1QNTA 4DR1E 3IWBA 2YT4A 1A1HA 2ELYA 2EM6A 5AE3A 4N4RB 1X6EA 5F3WA 2EL4A 2EN4A 4X64E 2M4IA 3MHHC 2NUGA 3AUZA 2V85A 4NZVA 2D9HA 2VRDA 3KZZA 2YTQA 2EM2A 1HNZE 1YYOA 4P78A 1L4SA 2EM0A 2BB8A 3UK3C 2YRKA 2EPPA 3THOB 2MKNA 2RTXA 2V86A 1ZBQA 4DV3E 3ADJA 2EMXA 4WXCA 4ZYDA 2EM9A 2EOSA 4DV5E 2JOXA 2B7VA 5KL5A 2YTJA 5LL6R 1YPNA 5TSEA 2JOBA 2RS7A 3QG5C 1N32E 2HJJA 3EPJA 4LFCE 3RMPA 2RPCA 1ZR9A 3JTZA 4WYQB 3THNA 1TF6A 1IMUA 2RSMA 4FK5C 1NCSA 2EN6A 3HXLA 2KONA 4I8OA 2EORA 3BF2A 4HTGA 2NA2A 5IWAE 2DLQA 2V89A 1HNWE 1GZ6A 2L6MA 1WJPA 2A25A 2B9DA 2LUPB 4K0KE 3KWRA 3MHSC 1YYKA 1ZBTA 2EM8A 2EMBA 2UXCE 2I9IA 2LJUA 1PJTA 1XNQE 2WBTA 4M30A 5A69A 2UU9E 4O24A 4B3SE 4LF8E 4MLQA 5IXMB 4M9VC 4GZNC 4B3RE 1ZAAC 4R2RA 1UILA 1A1GA 4O5GA 3T1YE 2NUEA 5FLXC 1B69A 2YPNA 4GKKE 4BCAA 2EMYA 1GTKA 2DMYA 1A1KA 2YTIA 4DR5E 1UN6B 4B3ME 2L2MA 4M0VA 4DV2E 2JY9A 2MDRA 4NHRA 4F2JC 1STUA 2R76A 1G2DC 2EM4A 2E1MA 2EJ4A 5A2QC 2EMZA 1QU6A 2GPIA 1YFHA 1IBME 1XMQE 2UUCE 1X6FA 1YZ9A 4RH8A 5A6KA 3ECRA 1T38A 2LE2A 2F8BA 2YRMA 4Q35B 2MKDA 2CPNA 2YTNA 4WPYA 2LV2A 4F54A 2EOOA 5CFFE 1SR9A 3VK6A 2EWLA 4M2ZA 2ODRC 3VYXA 2M7QA 3BGHA 4KWYA 4DV0E 2KOUA 3ZOQB 2KHXA 1X49A 3HPSA 4P7DA 1UHZA 1F2IG 4WX9A 5A6BD 2V87A 4LF6E 1BBGA 2MC6A 2EPAA 1DGCA 4TUIA 3OTOE 3BBGA 4BC9A 1PJSA 4ZYEA 5KL2A 1X6HA 2M9AA 3DJWA 1J5EE 2LRSA 2EMKA 5T6JA 2FV4B 3VHTB 4KZSA 2GHFA 4L8NA 2EPNA 4DV1E 3H09A 5BR8E 5LMUE 4DV6E 2EMCA 4DV7E 1AH5A 2YRHA 1RQ0A 4LTYA 1YUJA 4JI2E 1EH8A 2EMIA 2EMLA 4DR7E 4JV5E 2EPRA 4R8OA 1NEIA 5LMNE 1KYQA 1T4OA 4YY3E 2EQ3A 3C6KA 3ADLA 3EPKA 4JI1E 2UUBE 1RC7A 1YSAC 3KZYA 4DR4E 4DR6E 2F4VE 1FKAE 1YYWA 2VF1A 2EM3A 3IWDA 4BHCA 1N34E 4LF9E 2EOEA 4R2AA 1N36E 2EN7A 1MEYC 3M99B 2YSOA 4X66E 3JU0A 2FGGA 2GLIA 2ENHA 1A1FA 3J80C 1LLMC 2MC5A 3HQ1A 2L8TA 2DMIA 2DB2A 1A1JA 3C4TA 1IQOA 4Q28A 4BBYA 2EMHA 5AC5A 3LLHA 1TN9A 2HHHE 1XMOE 4JI3E 1EH6A 2EOXA 2EQ1A 4BC7A 4NXME 1PKPA 2UXBE 2YU5A 1X48A 1N3GA 1EKZA 2YTFA 2EMGA 2DRPA 2M1SA 5IT9C 1WHQA 4GEQB 2EOFA 2ADRA 4LF4E 4DR3E 4J8ZA 4BMJA 3ADIA 3TQMA 4LU9A 2EN8A 2DSYA 4R2PA 2JVAA 4DUYE 2EOZA 2V83A 4LF5E 2N3GA 2ENCA 2V8QB 2LTRA 2UUAE 2YTOA 5KL4A 2L33A 2NABA 4X62E 2FTXB 3F6GA 1T4LB 2ENAA 2LUQA 4F6MA 5ADZA 3C6MA 4F9AB 2WCC3 4WSGA 4GKJE 2L2KB 2YWQA 4DUZE 2CSHA 1GQEA 4R2QA 2G7HA 4WSPA 4BHBA 2CT1A 3DF6A 2ZM6E 2NUFA 2K4VA 1WRJA 4DMIA 4O4KA 2N8XA 4ZYGA 2EPZA 1MGTA 3EPLA 4MLVA 4DR2E 1IBLE 3J7Yp 1A1IA 2YTPA 4JI6E 1PDAA 1PJQA 2YTDA 2EPOA 3L00A 2MDGA 2JP9A 1DQ3A 5AE2A 2IHR1 2CTDA 1HNXE 4L5NC 3EPHA 4OX9E 1T4NA 4R03A 2EN3A 4JYAE 1IQSA 1G2FC 1EH7A 3C4BA 1AAYA 2DGCA 2LT7A 2YZTA 3EQ1A 1X47A 3K6QA 5AASA 3JAMC 1UBDC 4DV4E 2VQFE 1J26A
chains in the Genus database with same CATH topology
2EMFA 2EN7A 2LVHA 1MEYC 3M99B 1UN6B 2EN1A 2YSOA 2EP3A 2GLIA 4IS1C 2ENHA 1A1FA 4R2CA 1LLMC 2R1FA 2DMIA 2YU8A 1A1JA 2EN2A 4F2JC 2EE8A 2EM5A 2PRTA 2E72A 2EMHA 1G2DC 4IJDA 1TN9A 2EM4A 2EJ4A 2EMZA 2ELZA 5KL6A 1JK1A 1X6FA 2ELYA 2EM6A 1A1HA 2EOHA 1X6EA 1RMDA 2EOXA 2EL4A 2EN4A 2EQ1A 2YRMA 2I13A 3MHHC 2MKDA 2YTNA 2D9HA 2LV2A 2VRDA 2YU5A 2YTQA 2EM2A 2EMAA 2EOOA 2YTFA 2EMGA 2HGHA 2EM0A 2BB8A 3UK3C 2YRKA 2EPPA 2DRPA 2LO3A 2MKNA 2EOYA 2EMXA 2EOFA 2ADRA 1X5WA 2EM9A 2EOSA 5KL7A 1TF3A 5KL5A 2YTJA 2EN8A 2WBUA 4R2PA 5KL3A 1F2IG 2EOZA 2WBSA 2ENCA 2EPAA 4R2DA 1DGCA 2EQ0A 1YUIA 2RSIA 2YTOA 2EPUA 3EPJA 5KL4A 5KL2A 1X6HA 2M9AA 1KJKA 2EPCA 2NABA 2RPCA 2EL5A 2EM7A 1ZR9A 2ENAA 1TF6A 2EMKA 4F6MA 2YTGA 4FK5C 3VHTB 2GHFA 1NCSA 2EL6A 2WCC3 1BBOA 4WSGA 2EN6A 2EOIA 2CSHA 2EORA 4R2QA 1P47A 2DLQA 2EMCA 2YTEA 2CT1A 2YRHA 1WJPA 2A25A 2EOMA 1YUJA 2EPXA 2EMIA 2JPAA 2LCEA 2EMLA 1X3CA 2EPZA 3MHSC 1ZU1A 2EPRA 3EPLA 2EM8A 2EMBA 1BB8A 4R2EA 1A1IA 2YTPA 2EMWA 2YSPA 2EQ3A 2WBTA 2YTDA 2MDGA 2EOJA 3EPKA 2JP9A 4R2SA 4M9VC 1JK2A 4F6NA 4GZNC 2EOQA 2CTDA 3EPHA 1YSAC 1ZAAC 2EN3A 4R2RA 1G2FC 1A1LA 1A1GA 1AAYA 2DGCA 4X9JA 1B69A 2EM3A 2LT7A 2EMYA 2J7JA 1UBDC 2DLKA 2EOEA 4R2AA 1A1KA 1Z1BA 2YTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMF A;  2EN7 A;  2LVH A;  1MEY C;  3M99 B;  1UN6 B;  2EN1 A;  2YSO A;  2EP3 A;  2GLI A;  4IS1 C;  2ENH A;  1A1F A;  4R2C A;  1LLM C;  2R1F A;  2DMI A;  2YU8 A;  1A1J A;  2EN2 A;  4F2J C;  2EE8 A;  2EM5 A;  2PRT A;  2E72 A;  2EMH A;  1G2D C;  4IJD A;  1TN9 A;  2EM4 A;  2EJ4 A;  2EMZ A;  2ELZ A;  5KL6 A;  1JK1 A;  1X6F A;  2ELY A;  2EM6 A;  1A1H A;  2EOH A;  1X6E A;  1RMD A;  2EOX A;  2EL4 A;  2EN4 A;  2EQ1 A;  2YRM A;  2I13 A;  3MHH C;  2MKD A;  2YTN A;  2D9H A;  2LV2 A;  2VRD A;  2YU5 A;  2YTQ A;  2EM2 A;  2EMA A;  2EOO A;  2YTF A;  2EMG A;  2HGH A;  2EM0 A;  2BB8 A;  3UK3 C;  2YRK A;  2EPP A;  2DRP A;  2LO3 A;  2MKN A;  2EOY A;  2EMX A;  2EOF A;  2ADR A;  1X5W A;  2EM9 A;  2EOS A;  5KL7 A;  1TF3 A;  5KL5 A;  2YTJ A;  2EN8 A;  2WBU A;  4R2P A;  5KL3 A;  1F2I G;  2EOZ A;  2WBS A;  2ENC A;  2EPA A;  4R2D A;  1DGC A;  2EQ0 A;  1YUI A;  2RSI A;  2YTO A;  2EPU A;  3EPJ A;  5KL4 A;  5KL2 A;  1X6H A;  2M9A A;  1KJK A;  2EPC A;  2NAB A;  2RPC A;  2EL5 A;  2EM7 A;  1ZR9 A;  2ENA A;  1TF6 A;  2EMK A;  4F6M A;  2YTG A;  4FK5 C;  3VHT B;  2GHF A;  1NCS A;  2EL6 A;  2WCC 3;  1BBO A;  4WSG A;  2EN6 A;  2EOI A;  2CSH A;  2EOR A;  4R2Q A;  1P47 A;  2DLQ A;  2EMC A;  2YTE A;  2CT1 A;  2YRH A;  1WJP A;  2A25 A;  2EOM A;  1YUJ A;  2EPX A;  2EMI A;  2JPA A;  2LCE A;  2EML A;  1X3C A;  2EPZ A;  3MHS C;  1ZU1 A;  2EPR A;  3EPL A;  2EM8 A;  2EMB A;  1BB8 A;  4R2E A;  1A1I A;  2YTP A;  2EMW A;  2YSP A;  2EQ3 A;  2WBT A;  2YTD A;  2MDG A;  2EOJ A;  3EPK A;  2JP9 A;  4R2S A;  4M9V C;  1JK2 A;  4F6N A;  4GZN C;  2EOQ A;  2CTD A;  3EPH A;  1YSA C;  1ZAA C;  2EN3 A;  4R2R A;  1G2F C;  1A1L A;  1A1G A;  1AAY A;  2DGC A;  4X9J A;  1B69 A;  2EM3 A;  2LT7 A;  2EMY A;  2J7J A;  1UBD C;  2DLK A;  2EOE A;  4R2A A;  1A1K A;  1Z1B A;  2YTI A; 
#chains in the Genus database with same CATH topology
 2EMF A;  3F6H A;  2EP3 A;  5DNY A;  4IS1 C;  4R2C A;  2EN2 A;  1I94 E;  2LBS B;  2EM5 A;  4BS9 A;  2PRT A;  2E72 A;  4IJD A;  3OML A;  2JXP A;  5KL6 A;  2ELZ A;  1JK1 A;  2UXD E;  4NXN E;  4YHH E;  2EOH A;  4RHB B;  1RMD A;  2I13 A;  1SFE A;  2EZ6 A;  1HR0 E;  1DI2 A;  4O43 A;  4JI7 E;  2LTS A;  1WXR A;  4WFT A;  2EMA A;  1FJG E;  2HGH A;  2LO3 A;  2EOY A;  2EPL X;  3FIG A;  2H36 X;  1X5W A;  5KL7 A;  3AV0 A;  1TF3 A;  2ODR D;  4B3T E;  2WBU A;  2E5L E;  5KL3 A;  1IBK E;  2B3T B;  2WBS A;  2HC5 A;  4X8W A;  4R2D A;  2B7T A;  2EQ0 A;  2VE7 C;  1T39 A;  1YUI A;  2RQL A;  2RSI A;  2EPU A;  2EPM X;  1O0W A;  2Q8U A;  2RS6 A;  4TUG A;  4X65 E;  3T1H E;  2DIX A;  1KJK A;  2EPC A;  4DKK A;  2EL5 A;  5A6J A;  3P1X A;  2EM7 A;  4OOG C;  1XNR E;  2N3H A;  2YTG A;  5LLQ A;  4HEI A;  4JI5 E;  2EL6 A;  1BBO A;  4WXD A;  3J7A G;  2EOI A;  1WHN A;  1P47 A;  2YTE A;  4JI8 E;  4F9B B;  2EOM A;  5AE1 A;  3VYY A;  5AC4 A;  2EPK X;  2EPX A;  2JPA A;  2LCE A;  1X3C A;  1ZU1 A;  3BID A;  2LJH A;  1N33 E;  1BB8 A;  4R2E A;  2LMZ A;  2EMW A;  2BBG A;  2YSP A;  4F9C B;  3HTX A;  2L3J A;  2EOJ A;  2L2N A;  4R2S A;  1JK2 A;  4F6N A;  2EOQ A;  4AQY E;  5IV8 B;  4KHP E;  5A6B A;  5A6A A;  1A1L A;  4LFA E;  2WZO A;  2JWO A;  4JI0 E;  4X9J A;  3J81 C;  2K7I A;  3MSW A;  2J7J A;  2DLK A;  2L3C A;  1Z1B A;  2V88 A;  3HPZ A;  2JYA A;  4ZYH A;  2LVH A;  2L92 A;  2EN1 A;  3IWC A;  2VQE E;  3LML A;  2R1F A;  3ADG A;  4JI4 E;  2YU8 A;  2EE8 A;  4LF7 E;  4LFB E;  2JR1 A;  1QNT A;  4DR1 E;  3IWB A;  2YT4 A;  1A1H A;  2ELY A;  2EM6 A;  5AE3 A;  4N4R B;  1X6E A;  5F3W A;  2EL4 A;  2EN4 A;  4X64 E;  2M4I A;  3MHH C;  2NUG A;  3AUZ A;  2V85 A;  4NZV A;  2D9H A;  2VRD A;  3KZZ A;  2YTQ A;  2EM2 A;  1HNZ E;  1YYO A;  4P78 A;  1L4S A;  2EM0 A;  2BB8 A;  3UK3 C;  2YRK A;  2EPP A;  3THO B;  2MKN A;  2RTX A;  2V86 A;  1ZBQ A;  4DV3 E;  3ADJ A;  2EMX A;  4WXC A;  4ZYD A;  2EM9 A;  2EOS A;  4DV5 E;  2JOX A;  2B7V A;  5KL5 A;  2YTJ A;  5LL6 R;  1YPN A;  5TSE A;  2JOB A;  2RS7 A;  3QG5 C;  1N32 E;  2HJJ A;  3EPJ A;  4LFC E;  3RMP A;  2RPC A;  1ZR9 A;  3JTZ A;  4WYQ B;  3THN A;  1TF6 A;  1IMU A;  2RSM A;  4FK5 C;  1NCS A;  2EN6 A;  3HXL A;  2KON A;  4I8O A;  2EOR A;  3BF2 A;  4HTG A;  2NA2 A;  5IWA E;  2DLQ A;  2V89 A;  1HNW E;  1GZ6 A;  2L6M A;  1WJP A;  2A25 A;  2B9D A;  2LUP B;  4K0K E;  3KWR A;  3MHS C;  1YYK A;  1ZBT A;  2EM8 A;  2EMB A;  2UXC E;  2I9I A;  2LJU A;  1PJT A;  1XNQ E;  2WBT A;  4M30 A;  5A69 A;  2UU9 E;  4O24 A;  4B3S E;  4LF8 E;  4MLQ A;  5IXM B;  4M9V C;  4GZN C;  4B3R E;  1ZAA C;  4R2R A;  1UIL A;  1A1G A;  4O5G A;  3T1Y E;  2NUE A;  5FLX C;  1B69 A;  2YPN A;  4GKK E;  4BCA A;  2EMY A;  1GTK A;  2DMY A;  1A1K A;  2YTI A;  4DR5 E;  1UN6 B;  4B3M E;  2L2M A;  4M0V A;  4DV2 E;  2JY9 A;  2MDR A;  4NHR A;  4F2J C;  1STU A;  2R76 A;  1G2D C;  2EM4 A;  2E1M A;  2EJ4 A;  5A2Q C;  2EMZ A;  1QU6 A;  2GPI A;  1YFH A;  1IBM E;  1XMQ E;  2UUC E;  1X6F A;  1YZ9 A;  4RH8 A;  5A6K A;  3ECR A;  1T38 A;  2LE2 A;  2F8B A;  2YRM A;  4Q35 B;  2MKD A;  2CPN A;  2YTN A;  4WPY A;  2LV2 A;  4F54 A;  2EOO A;  5CFF E;  1SR9 A;  3VK6 A;  2EWL A;  4M2Z A;  2ODR C;  3VYX A;  2M7Q A;  3BGH A;  4KWY A;  4DV0 E;  2KOU A;  3ZOQ B;  2KHX A;  1X49 A;  3HPS A;  4P7D A;  1UHZ A;  1F2I G;  4WX9 A;  5A6B D;  2V87 A;  4LF6 E;  1BBG A;  2MC6 A;  2EPA A;  1DGC A;  4TUI A;  3OTO E;  3BBG A;  4BC9 A;  1PJS A;  4ZYE A;  5KL2 A;  1X6H A;  2M9A A;  3DJW A;  1J5E E;  2LRS A;  2EMK A;  5T6J A;  2FV4 B;  3VHT B;  4KZS A;  2GHF A;  4L8N A;  2EPN A;  4DV1 E;  3H09 A;  5BR8 E;  5LMU E;  4DV6 E;  2EMC A;  4DV7 E;  1AH5 A;  2YRH A;  1RQ0 A;  4LTY A;  1YUJ A;  4JI2 E;  1EH8 A;  2EMI A;  2EML A;  4DR7 E;  4JV5 E;  2EPR A;  4R8O A;  1NEI A;  5LMN E;  1KYQ A;  1T4O A;  4YY3 E;  2EQ3 A;  3C6K A;  3ADL A;  3EPK A;  4JI1 E;  2UUB E;  1RC7 A;  1YSA C;  3KZY A;  4DR4 E;  4DR6 E;  2F4V E;  1FKA E;  1YYW A;  2VF1 A;  2EM3 A;  3IWD A;  4BHC A;  1N34 E;  4LF9 E;  2EOE A;  4R2A A;  1N36 E;  2EN7 A;  1MEY C;  3M99 B;  2YSO A;  4X66 E;  3JU0 A;  2FGG A;  2GLI A;  2ENH A;  1A1F A;  3J80 C;  1LLM C;  2MC5 A;  3HQ1 A;  2L8T A;  2DMI A;  2DB2 A;  1A1J A;  3C4T A;  1IQO A;  4Q28 A;  4BBY A;  2EMH A;  5AC5 A;  3LLH A;  1TN9 A;  2HHH E;  1XMO E;  4JI3 E;  1EH6 A;  2EOX A;  2EQ1 A;  4BC7 A;  4NXM E;  1PKP A;  2UXB E;  2YU5 A;  1X48 A;  1N3G A;  1EKZ A;  2YTF A;  2EMG A;  2DRP A;  2M1S A;  5IT9 C;  1WHQ A;  4GEQ B;  2EOF A;  2ADR A;  4LF4 E;  4DR3 E;  4J8Z A;  4BMJ A;  3ADI A;  3TQM A;  4LU9 A;  2EN8 A;  2DSY A;  4R2P A;  2JVA A;  4DUY E;  2EOZ A;  2V83 A;  4LF5 E;  2N3G A;  2ENC A;  2V8Q B;  2LTR A;  2UUA E;  2YTO A;  5KL4 A;  2L33 A;  2NAB A;  4X62 E;  2FTX B;  3F6G A;  1T4L B;  2ENA A;  2LUQ A;  4F6M A;  5ADZ A;  3C6M A;  4F9A B;  2WCC 3;  4WSG A;  4GKJ E;  2L2K B;  2YWQ A;  4DUZ E;  2CSH A;  1GQE A;  4R2Q A;  2G7H A;  4WSP A;  4BHB A;  2CT1 A;  3DF6 A;  2ZM6 E;  2NUF A;  2K4V A;  1WRJ A;  4DMI A;  4O4K A;  2N8X A;  4ZYG A;  2EPZ A;  1MGT A;  3EPL A;  4MLV A;  4DR2 E;  1IBL E;  3J7Y p;  1A1I A;  2YTP A;  4JI6 E;  1PDA A;  1PJQ A;  2YTD A;  2EPO A;  3L00 A;  2MDG A;  2JP9 A;  1DQ3 A;  5AE2 A;  2IHR 1;  2CTD A;  1HNX E;  4L5N C;  3EPH A;  4OX9 E;  1T4N A;  4R03 A;  2EN3 A;  4JYA E;  1IQS A;  1G2F C;  1EH7 A;  3C4B A;  1AAY A;  2DGC A;  2LT7 A;  2YZT A;  3EQ1 A;  1X47 A;  3K6Q A;  5AAS A;  3JAM C;  1UBD C;  4DV4 E;  2VQF E;  1J26 A; 
#chains in the Genus database with same CATH homology
 2EMF A;  2EN7 A;  2LVH A;  1MEY C;  3M99 B;  1UN6 B;  2EN1 A;  2YSO A;  2EP3 A;  2GLI A;  4IS1 C;  2ENH A;  1A1F A;  4R2C A;  1LLM C;  2R1F A;  2DMI A;  2YU8 A;  1A1J A;  2EN2 A;  4F2J C;  2EE8 A;  2EM5 A;  2PRT A;  2E72 A;  2EMH A;  1G2D C;  4IJD A;  1TN9 A;  2EM4 A;  2EJ4 A;  2EMZ A;  2ELZ A;  5KL6 A;  1JK1 A;  1X6F A;  2ELY A;  2EM6 A;  1A1H A;  2EOH A;  1X6E A;  1RMD A;  2EOX A;  2EL4 A;  2EN4 A;  2EQ1 A;  2YRM A;  2I13 A;  3MHH C;  2MKD A;  2YTN A;  2D9H A;  2LV2 A;  2VRD A;  2YU5 A;  2YTQ A;  2EM2 A;  2EMA A;  2EOO A;  2YTF A;  2EMG A;  2HGH A;  2EM0 A;  2BB8 A;  3UK3 C;  2YRK A;  2EPP A;  2DRP A;  2LO3 A;  2MKN A;  2EOY A;  2EMX A;  2EOF A;  2ADR A;  1X5W A;  2EM9 A;  2EOS A;  5KL7 A;  1TF3 A;  5KL5 A;  2YTJ A;  2EN8 A;  2WBU A;  4R2P A;  5KL3 A;  1F2I G;  2EOZ A;  2WBS A;  2ENC A;  2EPA A;  4R2D A;  1DGC A;  2EQ0 A;  1YUI A;  2RSI A;  2YTO A;  2EPU A;  3EPJ A;  5KL4 A;  5KL2 A;  1X6H A;  2M9A A;  1KJK A;  2EPC A;  2NAB A;  2RPC A;  2EL5 A;  2EM7 A;  1ZR9 A;  2ENA A;  1TF6 A;  2EMK A;  4F6M A;  2YTG A;  4FK5 C;  3VHT B;  2GHF A;  1NCS A;  2EL6 A;  2WCC 3;  1BBO A;  4WSG A;  2EN6 A;  2EOI A;  2CSH A;  2EOR A;  4R2Q A;  1P47 A;  2DLQ A;  2EMC A;  2YTE A;  2CT1 A;  2YRH A;  1WJP A;  2A25 A;  2EOM A;  1YUJ A;  2EPX A;  2EMI A;  2JPA A;  2LCE A;  2EML A;  1X3C A;  2EPZ A;  3MHS C;  1ZU1 A;  2EPR A;  3EPL A;  2EM8 A;  2EMB A;  1BB8 A;  4R2E A;  1A1I A;  2YTP A;  2EMW A;  2YSP A;  2EQ3 A;  2WBT A;  2YTD A;  2MDG A;  2EOJ A;  3EPK A;  2JP9 A;  4R2S A;  4M9V C;  1JK2 A;  4F6N A;  4GZN C;  2EOQ A;  2CTD A;  3EPH A;  1YSA C;  1ZAA C;  2EN3 A;  4R2R A;  1G2F C;  1A1L A;  1A1G A;  1AAY A;  2DGC A;  4X9J A;  1B69 A;  2EM3 A;  2LT7 A;  2EMY A;  2J7J A;  1UBD C;  2DLK A;  2EOE A;  4R2A A;  1A1K A;  1Z1B A;  2YTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...