2M9AA

Solution nmr structure of e3 ubiquitin-protein ligase zfp91 from homo sapiens, northeast structural genomics consortium (nesg) target hr7784a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
b'HMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase ZFP91
publication title Solution Structure of Hr7784A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 23
structure length 89
sequence length 89
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA03
2BB8A 2EN3A 2MKDA 2DLKA 1A1IA 2EMHA 2YRKA 2WBUA 2YTNA 2EN8A 2LV2A 2YU8A 2WBSA 2EMIA 1X6EA 2EM5A 4R2CA 2M9AA 1A1KA 2EOZA 2EPPA 2YTJA 2CT1A 5KL4A 2MDGA 4R2PA 2YTOA 1X6FA 2EORA 4R2DA 3MHHC 4GZNC 4F2JC 2YTEA 2YU5A 5KL7A 3EPJA 1TN9A 3EPHA 2YTQA 2EM8A 2JP9A 2MKNA 1B69A 4WSGA 2EMBA 2YSOA 2EOFA 1P47A 1YUJA 2EMCA 3VHTB 1F2IG 2LCEA 2YTIA 1A1JA 1YUIA 1JK1A 2EM2A 1X6HA 2EOIA 2EL5A 2NABA 2YTFA 1JK2A 2LT7A 2EM0A 1RMDA 2VRDA 2JPAA 2DMIA 1TF3A 2E72A 2LO3A 1DGCA 1ZAAC 2EL4A 2EL6A 2EN1A 2YRHA 1BBOA 2DRPA 2EMZA 2EMWA 4IS1C 1X5WA 2ADRA 2CSHA 2D9HA 2EOOA 4F6MA 3EPLA 4F6NA 3EPKA 2J7JA 2EPZA 1G2DC 1KJKA 2EJ4A 2EM4A 2EMGA 2PRTA 2YTPA 2EPCA 2EM3A 4R2QA 1ZU1A 2ELYA 2EMLA 3UK3C 5KL2A 3MHSC 1A1HA 5KL5A 2A25A 4R2SA 3M99B 2EP3A 1X3CA 1TF6A 2EOEA 2EOXA 2YTGA 1UN6B 4FK5C 1MEYC 2EOHA 2EM9A 2I13A 1NCSA 2EPRA 2GLIA 2EM7A 2WBTA 2EOQA 4R2AA 1G2FC 2HGHA 2EOMA 2EQ0A 2LVHA 2EM6A 1AAYA 4M9VC 2EMAA 2YSPA 1LLMC 2EMXA 1WJPA 2DGCA 2YTDA 2EMFA 2EMKA 1UBDC 1A1LA 2EN6A 4X9JA 1A1GA 2R1FA 4R2RA 2RPCA 2EMYA 2DLQA 2EN4A 2EOJA 2ELZA 2RSIA 2EOSA 2ENCA 2YRMA 4IJDA 4R2EA 5KL3A 2WCC3 1A1FA 2CTDA 2EPUA 2EQ1A 2EN2A 1BB8A 1ZR9A 2ENAA 2ENHA 2EQ3A 2GHFA 2EPAA 5KL6A 2EOYA 2EE8A 1YSAC 1Z1BA 2EN7A 2EPXA
chains in the Genus database with same CATH superfamily
2DLKA 1IBME 2EMHA 2M4IA 1WHNA 2YTNA 1MGTA 2EMIA 2JR1A 4BC9A 2YTJA 4JI7E 2WZOA 5LMUE 4M2ZA 4R2PA 3H09A 4B3SE 4LFAE 4R2DA 2EORA 4LTYA 3MHHC 2YTEA 4I8OA 5KL7A 3EPJA 3VYXA 1O0WA 4F54A 1WXRA 1EKZA 4LF7E 2EOFA 1P47A 5AASA 1EH7A 1YUJA 3ADJA 3VHTB 1F2IG 1YUIA 2JWOA 2LUQA 4JI1E 4DV4E 2H36X 4BBYA 2L33A 2YTFA 2HJJA 2LRSA 2VRDA 1DQ3A 1TF3A 4ZYDA 1PJTA 2EL6A 2EN1A 3EQ1A 2DRPA 2BBGA 4DV3E 4DR1E 2EMZA 2EMWA 3FIGA 2K4VA 1SFEA 2EOOA 2FGGA 1FKAE 2N8XA 4F6NA 4O24A 4NXME 1KJKA 3IWDA 2EMGA 1XMOE 2EM3A 2YZTA 2B3TB 3UK3C 5KL2A 1A1HA 3OMLA 5KL5A 4M0VA 2A25A 4BS9A 4DV2E 2EP3A 1UN6B 5TSEA 4B3TE 2GLIA 4JI3E 2EM7A 2VQEE 2B9DA 3K6QA 4R2AA 5AC4A 1GZ6A 1QU6A 1AAYA 1IBKE 4M9VC 4DMIA 2YSPA 4HTGA 1N34E 2EPNA 2DGCA 2FV4B 1HNXE 3JTZA 4DV0E 5A6JA 5BR8E 5IV8B 2EN6A 4X9JA 4R2RA 2DLQA 4DR6E 2EOSA 4R2EA 3ECRA 5IWAE 4DR5E 1ZR9A 3RMPA 2L2NA 1WRJA 2ENAA 2GHFA 2EZ6A 5KL6A 4X62E 4WXDA 2EPOA 5A6BA 4F9CB 3F6HA 2UU9E 2RS6A 2WBUA 2EN8A 2WBSA 2EOZA 2DMYA 5KL4A 3C6KA 2YTOA 4DKKA 3J7Yp 4LFCE 3EPHA 4BCAA 1QNTA 5AE3A 4MLVA 5DNYA 2UUBE 2JP9A 1IBLE 3KZYA 3BF2A 1PJSA 4YHHE 5IXMB 4BHCA 1A1JA 4WFTA 1JK1A 4Q28A 3T1YE 1N33E 3C6MA 4DV6E 1JK2A 2N3GA 3ZOQB 1KYQA 3J81C 3BGHA 1GTKA 2ZM6E 4JI4E 2V83A 2UXDE 2YT4A 2UUAE 2M1SA 4JI8E 2VE7C 2CSHA 2I9IA 3EPLA 3T1HE 2J7JA 4F9AB 4R03A 1PDAA 2PRTA 4R2QA 2V89A 4WX9A 2UXCE 3LMLA 4NXNE 3M99B 1X49A 3IWCA 4JI6E 1FJGE 4KHPE 2EOEA 2L8TA 4NZVA 5T6JA 4GKKE 1YYOA 1MEYC 2EM9A 1RC7A 2EPRA 3J80C 2EOQA 4LF9E 2JOBA 2E1MA 5A6AA 2EQ0A 3KZZA 4HEIA 2L6MA 1L4SA 4DR7E 1WJPA 2EMXA 3DF6A 2YTDA 2EWLA 1N36E 2LBSB 3ADIA 4ZYGA 5AE2A 1UBDC 2R1FA 2RPCA 2LUPB 1GQEA 2ELZA 2EOJA 2N3HA 2VQFE 1YYKA 5LMNE 1WHQA 2DB2A 2CTDA 3ADGA 2ENHA 3OTOE 4AQYE 4RHBB 2JOXA 1XMQE 2EOYA 4F9BB 2UUCE 4BHBA 4GEQB 4OX9E 2L92A 2YWQA 3BBGA 2B7TA 2YRKA 5ADZA 2YU8A 2M9AA 1A1KA 2EPPA 4DV5E 2CT1A 3BIDA 2MDGA 4ZYHA 3MSWA 4BC7A 3HXLA 2NUEA 2RSMA 2NA2A 4F2JC 5A69A 2YU5A 1RQ0A 2K7IA 2YTQA 2ODRD 4LU9A 4KZSA 2MKNA 1B69A 4WSGA 3C4TA 2E5LE 4X8WA 2EMCA 4DUYE 2UXBE 2JYAA 2LCEA 1X6HA 2EOIA 4TUIA 2NABA 3AV0A 2EM0A 4NHRA 1RMDA 2LTRA 2E72A 2LO3A 1ZAAC 2EL4A 4O5GA 3F6GA 4YY3E 2MC6A 1IQOA 3QG5C 1BBOA 2EPLX 1I94E 2LE2A 4WXCA 2L2KB 2ADRA 2D9HA 4JI5E 1DI2A 2L3JA 2EPZA 1G2DC 1PKPA 2EM4A 3THNA 1YZ9A 1ZU1A 2LJUA 2EMLA 3MHSC 4R8OA 1T38A 4R2SA 4L5NC 1T4NA 1T39A 1TF6A 2V88A 2RQLA 4BMJA 2YTGA 1IMUA 5A6KA 2HC5A 4B3ME 2I13A 1NCSA 2WBTA 2IHR1 4M30A 4J8ZA 4MLQA 1T4LB 3HTXA 1LLMC 4WYQB 1YPNA 4Q35B 3HPSA 2G7HA 2Q8UA 1PJQA 2EMKA 2F8BA 1A1LA 1A1GA 2EMYA 2EN4A 2RSIA 4N4RB 2YRMA 1A1FA 1SR9A 2EPUA 1ZBQA 1BB8A 4LF4E 2EPAA 5IT9C 4KWYA 5F3WA 4X64E 2EN7A 2FTXB 2EPXA 2EN2A 4WPYA 1N32E 2BB8A 2EN3A 2MKDA 3L00A 4DR2E 1A1IA 4X66E 2LV2A 1X6EA 2EM5A 4R2CA 1J26A 1X48A 1YFHA 1XNQE 4P78A 1UILA 4LF8E 1N3GA 1X6FA 2V85A 4GZNC 4DR4E 5LLQA 1TN9A 4GKJE 3JAMC 1YYWA 4JV5E 5LL6R 3THOB 2EM8A 4WSPA 3TQMA 2JY9A 2KOUA 2EMBA 1T4OA 2YSOA 4O43A 1ZBTA 2NUFA 2LMZA 2YTIA 4L8NA 2ODRC 2EM2A 3J7AG 2EL5A 4DV1E 2RTXA 2LT7A 1EH6A 4ZYEA 3VYYA 2JPAA 2DMIA 1DGCA 2JXPA 2KONA 2YRHA 3AUZA 2L2MA 2LJHA 3LLHA 4IS1C 1AH5A 1X5WA 2EPMX 4JI2E 4F6MA 4DR3E 3EPKA 1EH8A 2DIXA 2RS7A 3HQ1A 4DV7E 2EJ4A 2MDRA 4LF5E 2YTPA 2EPCA 1BBGA 1X47A 2ELYA 4LFBE 4JYAE 3ADLA 2YPNA 1HNZE 2DSYA 2JVAA 3IWBA 4K0KE 1X3CA 5FLXC 1STUA 3VK6A 1J5EE 2EOXA 2HHHE 5A2QC 1NEIA 5A6BD 2V86A 2KHXA 2L3CA 4FK5C 4P7DA 4O4KA 2EOHA 3P1XA 2LTSA 1G2FC 2HGHA 1XNRE 3HPZA 2EOMA 2VF1A 2LVHA 4B3RE 2EM6A 4OOGC 2EMAA 4DUZE 4X65E 2V8QB 3KWRA 5CFFE 3JU0A 3C4BA 2V87A 2EMFA 2EPKX 2M7QA 4JI0E 5AC5A 4IJDA 2WCC3 5KL3A 2ENCA 2R76A 2MC5A 2B7VA 2EQ1A 2F4VE 2EQ3A 2CPNA 4RH8A 4TUGA 1HNWE 2EE8A 1UHZA 3DJWA 2GPIA 1YSAC 1IQSA 5AE1A 2NUGA 1Z1BA 4LF6E 1HR0E
chains in the Genus database with same CATH topology
2BB8A 2EN3A 2MKDA 2DLKA 1A1IA 2EMHA 2YRKA 2WBUA 2YTNA 2EN8A 2LV2A 2YU8A 2WBSA 2EMIA 1X6EA 2EM5A 4R2CA 2M9AA 1A1KA 2EOZA 2EPPA 2YTJA 2CT1A 5KL4A 2MDGA 4R2PA 2YTOA 1X6FA 2EORA 4R2DA 3MHHC 4GZNC 4F2JC 2YTEA 2YU5A 5KL7A 3EPJA 1TN9A 3EPHA 2YTQA 2EM8A 2JP9A 2MKNA 1B69A 4WSGA 2EMBA 2YSOA 2EOFA 1P47A 1YUJA 2EMCA 3VHTB 1F2IG 2LCEA 2YTIA 1A1JA 1YUIA 1JK1A 2EM2A 1X6HA 2EOIA 2EL5A 2NABA 2YTFA 1JK2A 2LT7A 2EM0A 1RMDA 2VRDA 2JPAA 2DMIA 1TF3A 2E72A 2LO3A 1DGCA 1ZAAC 2EL4A 2EL6A 2EN1A 2YRHA 1BBOA 2DRPA 2EMZA 2EMWA 4IS1C 1X5WA 2ADRA 2CSHA 2D9HA 2EOOA 4F6MA 3EPLA 4F6NA 3EPKA 2J7JA 2EPZA 1G2DC 1KJKA 2EJ4A 2EM4A 2EMGA 2PRTA 2YTPA 2EPCA 2EM3A 4R2QA 1ZU1A 2ELYA 2EMLA 3UK3C 5KL2A 3MHSC 1A1HA 5KL5A 2A25A 4R2SA 3M99B 2EP3A 1X3CA 1TF6A 2EOEA 2EOXA 2YTGA 1UN6B 4FK5C 1MEYC 2EOHA 2EM9A 2I13A 1NCSA 2EPRA 2GLIA 2EM7A 2WBTA 2EOQA 4R2AA 1G2FC 2HGHA 2EOMA 2EQ0A 2LVHA 2EM6A 1AAYA 4M9VC 2EMAA 2YSPA 1LLMC 2EMXA 1WJPA 2DGCA 2YTDA 2EMFA 2EMKA 1UBDC 1A1LA 2EN6A 4X9JA 1A1GA 2R1FA 4R2RA 2RPCA 2EMYA 2DLQA 2EN4A 2EOJA 2ELZA 2RSIA 2EOSA 2ENCA 2YRMA 4IJDA 4R2EA 5KL3A 2WCC3 1A1FA 2CTDA 2EPUA 2EQ1A 2EN2A 1BB8A 1ZR9A 2ENAA 2ENHA 2EQ3A 2GHFA 2EPAA 5KL6A 2EOYA 2EE8A 1YSAC 1Z1BA 2EN7A 2EPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BB8 A;  2EN3 A;  2MKD A;  2DLK A;  1A1I A;  2EMH A;  2YRK A;  2WBU A;  2YTN A;  2EN8 A;  2LV2 A;  2YU8 A;  2WBS A;  2EMI A;  1X6E A;  2EM5 A;  4R2C A;  2M9A A;  1A1K A;  2EOZ A;  2EPP A;  2YTJ A;  2CT1 A;  5KL4 A;  2MDG A;  4R2P A;  2YTO A;  1X6F A;  2EOR A;  4R2D A;  3MHH C;  4GZN C;  4F2J C;  2YTE A;  2YU5 A;  5KL7 A;  3EPJ A;  1TN9 A;  3EPH A;  2YTQ A;  2EM8 A;  2JP9 A;  2MKN A;  1B69 A;  4WSG A;  2EMB A;  2YSO A;  2EOF A;  1P47 A;  1YUJ A;  2EMC A;  3VHT B;  1F2I G;  2LCE A;  2YTI A;  1A1J A;  1YUI A;  1JK1 A;  2EM2 A;  1X6H A;  2EOI A;  2EL5 A;  2NAB A;  2YTF A;  1JK2 A;  2LT7 A;  2EM0 A;  1RMD A;  2VRD A;  2JPA A;  2DMI A;  1TF3 A;  2E72 A;  2LO3 A;  1DGC A;  1ZAA C;  2EL4 A;  2EL6 A;  2EN1 A;  2YRH A;  1BBO A;  2DRP A;  2EMZ A;  2EMW A;  4IS1 C;  1X5W A;  2ADR A;  2CSH A;  2D9H A;  2EOO A;  4F6M A;  3EPL A;  4F6N A;  3EPK A;  2J7J A;  2EPZ A;  1G2D C;  1KJK A;  2EJ4 A;  2EM4 A;  2EMG A;  2PRT A;  2YTP A;  2EPC A;  2EM3 A;  4R2Q A;  1ZU1 A;  2ELY A;  2EML A;  3UK3 C;  5KL2 A;  3MHS C;  1A1H A;  5KL5 A;  2A25 A;  4R2S A;  3M99 B;  2EP3 A;  1X3C A;  1TF6 A;  2EOE A;  2EOX A;  2YTG A;  1UN6 B;  4FK5 C;  1MEY C;  2EOH A;  2EM9 A;  2I13 A;  1NCS A;  2EPR A;  2GLI A;  2EM7 A;  2WBT A;  2EOQ A;  4R2A A;  1G2F C;  2HGH A;  2EOM A;  2EQ0 A;  2LVH A;  2EM6 A;  1AAY A;  4M9V C;  2EMA A;  2YSP A;  1LLM C;  2EMX A;  1WJP A;  2DGC A;  2YTD A;  2EMF A;  2EMK A;  1UBD C;  1A1L A;  2EN6 A;  4X9J A;  1A1G A;  2R1F A;  4R2R A;  2RPC A;  2EMY A;  2DLQ A;  2EN4 A;  2EOJ A;  2ELZ A;  2RSI A;  2EOS A;  2ENC A;  2YRM A;  4IJD A;  4R2E A;  5KL3 A;  2WCC 3;  1A1F A;  2CTD A;  2EPU A;  2EQ1 A;  2EN2 A;  1BB8 A;  1ZR9 A;  2ENA A;  2ENH A;  2EQ3 A;  2GHF A;  2EPA A;  5KL6 A;  2EOY A;  2EE8 A;  1YSA C;  1Z1B A;  2EN7 A;  2EPX A; 
#chains in the Genus database with same CATH topology
 2DLK A;  1IBM E;  2EMH A;  2M4I A;  1WHN A;  2YTN A;  1MGT A;  2EMI A;  2JR1 A;  4BC9 A;  2YTJ A;  4JI7 E;  2WZO A;  5LMU E;  4M2Z A;  4R2P A;  3H09 A;  4B3S E;  4LFA E;  4R2D A;  2EOR A;  4LTY A;  3MHH C;  2YTE A;  4I8O A;  5KL7 A;  3EPJ A;  3VYX A;  1O0W A;  4F54 A;  1WXR A;  1EKZ A;  4LF7 E;  2EOF A;  1P47 A;  5AAS A;  1EH7 A;  1YUJ A;  3ADJ A;  3VHT B;  1F2I G;  1YUI A;  2JWO A;  2LUQ A;  4JI1 E;  4DV4 E;  2H36 X;  4BBY A;  2L33 A;  2YTF A;  2HJJ A;  2LRS A;  2VRD A;  1DQ3 A;  1TF3 A;  4ZYD A;  1PJT A;  2EL6 A;  2EN1 A;  3EQ1 A;  2DRP A;  2BBG A;  4DV3 E;  4DR1 E;  2EMZ A;  2EMW A;  3FIG A;  2K4V A;  1SFE A;  2EOO A;  2FGG A;  1FKA E;  2N8X A;  4F6N A;  4O24 A;  4NXM E;  1KJK A;  3IWD A;  2EMG A;  1XMO E;  2EM3 A;  2YZT A;  2B3T B;  3UK3 C;  5KL2 A;  1A1H A;  3OML A;  5KL5 A;  4M0V A;  2A25 A;  4BS9 A;  4DV2 E;  2EP3 A;  1UN6 B;  5TSE A;  4B3T E;  2GLI A;  4JI3 E;  2EM7 A;  2VQE E;  2B9D A;  3K6Q A;  4R2A A;  5AC4 A;  1GZ6 A;  1QU6 A;  1AAY A;  1IBK E;  4M9V C;  4DMI A;  2YSP A;  4HTG A;  1N34 E;  2EPN A;  2DGC A;  2FV4 B;  1HNX E;  3JTZ A;  4DV0 E;  5A6J A;  5BR8 E;  5IV8 B;  2EN6 A;  4X9J A;  4R2R A;  2DLQ A;  4DR6 E;  2EOS A;  4R2E A;  3ECR A;  5IWA E;  4DR5 E;  1ZR9 A;  3RMP A;  2L2N A;  1WRJ A;  2ENA A;  2GHF A;  2EZ6 A;  5KL6 A;  4X62 E;  4WXD A;  2EPO A;  5A6B A;  4F9C B;  3F6H A;  2UU9 E;  2RS6 A;  2WBU A;  2EN8 A;  2WBS A;  2EOZ A;  2DMY A;  5KL4 A;  3C6K A;  2YTO A;  4DKK A;  3J7Y p;  4LFC E;  3EPH A;  4BCA A;  1QNT A;  5AE3 A;  4MLV A;  5DNY A;  2UUB E;  2JP9 A;  1IBL E;  3KZY A;  3BF2 A;  1PJS A;  4YHH E;  5IXM B;  4BHC A;  1A1J A;  4WFT A;  1JK1 A;  4Q28 A;  3T1Y E;  1N33 E;  3C6M A;  4DV6 E;  1JK2 A;  2N3G A;  3ZOQ B;  1KYQ A;  3J81 C;  3BGH A;  1GTK A;  2ZM6 E;  4JI4 E;  2V83 A;  2UXD E;  2YT4 A;  2UUA E;  2M1S A;  4JI8 E;  2VE7 C;  2CSH A;  2I9I A;  3EPL A;  3T1H E;  2J7J A;  4F9A B;  4R03 A;  1PDA A;  2PRT A;  4R2Q A;  2V89 A;  4WX9 A;  2UXC E;  3LML A;  4NXN E;  3M99 B;  1X49 A;  3IWC A;  4JI6 E;  1FJG E;  4KHP E;  2EOE A;  2L8T A;  4NZV A;  5T6J A;  4GKK E;  1YYO A;  1MEY C;  2EM9 A;  1RC7 A;  2EPR A;  3J80 C;  2EOQ A;  4LF9 E;  2JOB A;  2E1M A;  5A6A A;  2EQ0 A;  3KZZ A;  4HEI A;  2L6M A;  1L4S A;  4DR7 E;  1WJP A;  2EMX A;  3DF6 A;  2YTD A;  2EWL A;  1N36 E;  2LBS B;  3ADI A;  4ZYG A;  5AE2 A;  1UBD C;  2R1F A;  2RPC A;  2LUP B;  1GQE A;  2ELZ A;  2EOJ A;  2N3H A;  2VQF E;  1YYK A;  5LMN E;  1WHQ A;  2DB2 A;  2CTD A;  3ADG A;  2ENH A;  3OTO E;  4AQY E;  4RHB B;  2JOX A;  1XMQ E;  2EOY A;  4F9B B;  2UUC E;  4BHB A;  4GEQ B;  4OX9 E;  2L92 A;  2YWQ A;  3BBG A;  2B7T A;  2YRK A;  5ADZ A;  2YU8 A;  2M9A A;  1A1K A;  2EPP A;  4DV5 E;  2CT1 A;  3BID A;  2MDG A;  4ZYH A;  3MSW A;  4BC7 A;  3HXL A;  2NUE A;  2RSM A;  2NA2 A;  4F2J C;  5A69 A;  2YU5 A;  1RQ0 A;  2K7I A;  2YTQ A;  2ODR D;  4LU9 A;  4KZS A;  2MKN A;  1B69 A;  4WSG A;  3C4T A;  2E5L E;  4X8W A;  2EMC A;  4DUY E;  2UXB E;  2JYA A;  2LCE A;  1X6H A;  2EOI A;  4TUI A;  2NAB A;  3AV0 A;  2EM0 A;  4NHR A;  1RMD A;  2LTR A;  2E72 A;  2LO3 A;  1ZAA C;  2EL4 A;  4O5G A;  3F6G A;  4YY3 E;  2MC6 A;  1IQO A;  3QG5 C;  1BBO A;  2EPL X;  1I94 E;  2LE2 A;  4WXC A;  2L2K B;  2ADR A;  2D9H A;  4JI5 E;  1DI2 A;  2L3J A;  2EPZ A;  1G2D C;  1PKP A;  2EM4 A;  3THN A;  1YZ9 A;  1ZU1 A;  2LJU A;  2EML A;  3MHS C;  4R8O A;  1T38 A;  4R2S A;  4L5N C;  1T4N A;  1T39 A;  1TF6 A;  2V88 A;  2RQL A;  4BMJ A;  2YTG A;  1IMU A;  5A6K A;  2HC5 A;  4B3M E;  2I13 A;  1NCS A;  2WBT A;  2IHR 1;  4M30 A;  4J8Z A;  4MLQ A;  1T4L B;  3HTX A;  1LLM C;  4WYQ B;  1YPN A;  4Q35 B;  3HPS A;  2G7H A;  2Q8U A;  1PJQ A;  2EMK A;  2F8B A;  1A1L A;  1A1G A;  2EMY A;  2EN4 A;  2RSI A;  4N4R B;  2YRM A;  1A1F A;  1SR9 A;  2EPU A;  1ZBQ A;  1BB8 A;  4LF4 E;  2EPA A;  5IT9 C;  4KWY A;  5F3W A;  4X64 E;  2EN7 A;  2FTX B;  2EPX A;  2EN2 A;  4WPY A;  1N32 E;  2BB8 A;  2EN3 A;  2MKD A;  3L00 A;  4DR2 E;  1A1I A;  4X66 E;  2LV2 A;  1X6E A;  2EM5 A;  4R2C A;  1J26 A;  1X48 A;  1YFH A;  1XNQ E;  4P78 A;  1UIL A;  4LF8 E;  1N3G A;  1X6F A;  2V85 A;  4GZN C;  4DR4 E;  5LLQ A;  1TN9 A;  4GKJ E;  3JAM C;  1YYW A;  4JV5 E;  5LL6 R;  3THO B;  2EM8 A;  4WSP A;  3TQM A;  2JY9 A;  2KOU A;  2EMB A;  1T4O A;  2YSO A;  4O43 A;  1ZBT A;  2NUF A;  2LMZ A;  2YTI A;  4L8N A;  2ODR C;  2EM2 A;  3J7A G;  2EL5 A;  4DV1 E;  2RTX A;  2LT7 A;  1EH6 A;  4ZYE A;  3VYY A;  2JPA A;  2DMI A;  1DGC A;  2JXP A;  2KON A;  2YRH A;  3AUZ A;  2L2M A;  2LJH A;  3LLH A;  4IS1 C;  1AH5 A;  1X5W A;  2EPM X;  4JI2 E;  4F6M A;  4DR3 E;  3EPK A;  1EH8 A;  2DIX A;  2RS7 A;  3HQ1 A;  4DV7 E;  2EJ4 A;  2MDR A;  4LF5 E;  2YTP A;  2EPC A;  1BBG A;  1X47 A;  2ELY A;  4LFB E;  4JYA E;  3ADL A;  2YPN A;  1HNZ E;  2DSY A;  2JVA A;  3IWB A;  4K0K E;  1X3C A;  5FLX C;  1STU A;  3VK6 A;  1J5E E;  2EOX A;  2HHH E;  5A2Q C;  1NEI A;  5A6B D;  2V86 A;  2KHX A;  2L3C A;  4FK5 C;  4P7D A;  4O4K A;  2EOH A;  3P1X A;  2LTS A;  1G2F C;  2HGH A;  1XNR E;  3HPZ A;  2EOM A;  2VF1 A;  2LVH A;  4B3R E;  2EM6 A;  4OOG C;  2EMA A;  4DUZ E;  4X65 E;  2V8Q B;  3KWR A;  5CFF E;  3JU0 A;  3C4B A;  2V87 A;  2EMF A;  2EPK X;  2M7Q A;  4JI0 E;  5AC5 A;  4IJD A;  2WCC 3;  5KL3 A;  2ENC A;  2R76 A;  2MC5 A;  2B7V A;  2EQ1 A;  2F4V E;  2EQ3 A;  2CPN A;  4RH8 A;  4TUG A;  1HNW E;  2EE8 A;  1UHZ A;  3DJW A;  2GPI A;  1YSA C;  1IQS A;  5AE1 A;  2NUG A;  1Z1B A;  4LF6 E;  1HR0 E; 
#chains in the Genus database with same CATH homology
 2BB8 A;  2EN3 A;  2MKD A;  2DLK A;  1A1I A;  2EMH A;  2YRK A;  2WBU A;  2YTN A;  2EN8 A;  2LV2 A;  2YU8 A;  2WBS A;  2EMI A;  1X6E A;  2EM5 A;  4R2C A;  2M9A A;  1A1K A;  2EOZ A;  2EPP A;  2YTJ A;  2CT1 A;  5KL4 A;  2MDG A;  4R2P A;  2YTO A;  1X6F A;  2EOR A;  4R2D A;  3MHH C;  4GZN C;  4F2J C;  2YTE A;  2YU5 A;  5KL7 A;  3EPJ A;  1TN9 A;  3EPH A;  2YTQ A;  2EM8 A;  2JP9 A;  2MKN A;  1B69 A;  4WSG A;  2EMB A;  2YSO A;  2EOF A;  1P47 A;  1YUJ A;  2EMC A;  3VHT B;  1F2I G;  2LCE A;  2YTI A;  1A1J A;  1YUI A;  1JK1 A;  2EM2 A;  1X6H A;  2EOI A;  2EL5 A;  2NAB A;  2YTF A;  1JK2 A;  2LT7 A;  2EM0 A;  1RMD A;  2VRD A;  2JPA A;  2DMI A;  1TF3 A;  2E72 A;  2LO3 A;  1DGC A;  1ZAA C;  2EL4 A;  2EL6 A;  2EN1 A;  2YRH A;  1BBO A;  2DRP A;  2EMZ A;  2EMW A;  4IS1 C;  1X5W A;  2ADR A;  2CSH A;  2D9H A;  2EOO A;  4F6M A;  3EPL A;  4F6N A;  3EPK A;  2J7J A;  2EPZ A;  1G2D C;  1KJK A;  2EJ4 A;  2EM4 A;  2EMG A;  2PRT A;  2YTP A;  2EPC A;  2EM3 A;  4R2Q A;  1ZU1 A;  2ELY A;  2EML A;  3UK3 C;  5KL2 A;  3MHS C;  1A1H A;  5KL5 A;  2A25 A;  4R2S A;  3M99 B;  2EP3 A;  1X3C A;  1TF6 A;  2EOE A;  2EOX A;  2YTG A;  1UN6 B;  4FK5 C;  1MEY C;  2EOH A;  2EM9 A;  2I13 A;  1NCS A;  2EPR A;  2GLI A;  2EM7 A;  2WBT A;  2EOQ A;  4R2A A;  1G2F C;  2HGH A;  2EOM A;  2EQ0 A;  2LVH A;  2EM6 A;  1AAY A;  4M9V C;  2EMA A;  2YSP A;  1LLM C;  2EMX A;  1WJP A;  2DGC A;  2YTD A;  2EMF A;  2EMK A;  1UBD C;  1A1L A;  2EN6 A;  4X9J A;  1A1G A;  2R1F A;  4R2R A;  2RPC A;  2EMY A;  2DLQ A;  2EN4 A;  2EOJ A;  2ELZ A;  2RSI A;  2EOS A;  2ENC A;  2YRM A;  4IJD A;  4R2E A;  5KL3 A;  2WCC 3;  1A1F A;  2CTD A;  2EPU A;  2EQ1 A;  2EN2 A;  1BB8 A;  1ZR9 A;  2ENA A;  2ENH A;  2EQ3 A;  2GHF A;  2EPA A;  5KL6 A;  2EOY A;  2EE8 A;  1YSA C;  1Z1B A;  2EN7 A;  2EPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...