2M9AA

Solution nmr structure of e3 ubiquitin-protein ligase zfp91 from homo sapiens, northeast structural genomics consortium (nesg) target hr7784a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
HMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase ZFP91
publication title Solution Structure of Hr7784A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 23
structure length 89
sequence length 89
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA03
2EPRA 2YTOA 1YUIA 2EOQA 2GHFA 2MKDA 4IJDA 3M99B 2CSHA 2EE8A 2ENHA 2EL5A 1F2IG 1BB8A 2EMCA 4R2RA 2YU5A 2YTJA 2EMGA 2WCC3 2YTGA 2MDGA 1KJKA 3VHTB 1YSAC 2YTNA 2EPUA 2EMIA 4F6MA 2EMKA 2EM4A 2WBTA 3MHSC 2LO3A 2EL4A 4R2SA 2EOIA 2VRDA 2MKNA 1X3CA 2DMIA 2E72A 1A1JA 1X6FA 2EPCA 1AAYA 2EM7A 2YRMA 1JK2A 1MEYC 2EL6A 2LV2A 1RMDA 2EN1A 2EM9A 4R2QA 1A1FA 2EOYA 2YTIA 5KL2A 2EQ0A 2EORA 2D9HA 1BBOA 2EM5A 2EPXA 2ADRA 3EPLA 2EN4A 4R2PA 1TN9A 2ELYA 2EMFA 2ENCA 5KL3A 2EOOA 1X6EA 2EMYA 2RSIA 2BB8A 2GLIA 1X5WA 2NABA 2YTPA 2YU8A 2EM2A 4M9VC 1A1LA 1ZU1A 4R2DA 2CT1A 1ZR9A 2YTDA 2EOEA 2EOHA 1A1HA 2EN7A 2DLKA 1YUJA 2M9AA 1G2DC 1TF6A 2EMXA 2EP3A 2PRTA 1ZAAC 1UBDC 2EMZA 5KL7A 2RPCA 2DRPA 2EPZA 2EOXA 2EOJA 4F6NA 4R2AA 3EPKA 2ELZA 2JPAA 2EM8A 2R1FA 2EM0A 5KL5A 1B69A 2LT7A 1A1IA 2DLQA 2YTEA 1G2FC 1LLMC 2LCEA 2JP9A 2EMAA 2YTFA 2YRKA 2I13A 2EM3A 2EMWA 2A25A 4WSGA 2YRHA 2EM6A 2EMLA 2EOFA 4R2EA 2EOMA 4GZNC 2EPPA 2WBUA 4X9JA 1P47A 2HGHA 2EMBA 2EN6A 1WJPA 1A1GA 2J7JA 2EMHA 2YSOA 4F2JC 5KL4A 2CTDA 1A1KA 3EPHA 5KL6A 4R2CA 1UN6B 2YSPA 2EOZA 1Z1BA 2YTQA 2EOSA 3EPJA 1DGCA 2LVHA 2DGCA 2EN8A 4IS1C 2EN2A 2ENAA 1NCSA 1JK1A 2EPAA 1TF3A 4FK5C 2EQ3A 2EQ1A 2EJ4A 2EN3A 3MHHC 3UK3C 2WBSA 1X6HA
chains in the Genus database with same CATH superfamily
4DV6E 2EZ6A 2L3CA 4DR2E 3FIGA 2GHFA 1YUIA 4DKKA 1EH6A 1BB8A 4R2RA 2F4VE 4WFTA 2WCC3 2YTGA 4R03A 4LF6E 4NXME 1YSAC 2EPUA 2MDRA 4MLVA 1HNWE 2LJUA 2N3GA 2EOIA 2B9DA 3IWCA 3IWBA 3AV0A 3RMPA 1AAYA 1X6FA 3VYYA 2FGGA 5A2QC 2DSYA 1JK2A 2V87A 4DV7E 1BBOA 2D9HA 4BC9A 4JI5E 5TSEA 2B7VA 3DF6A 2ADRA 2EN4A 4OOGC 2ENCA 5IXMB 1STUA 2EOOA 1SFEA 2YTPA 2KHXA 2NABA 2YU8A 4M9VC 1A1LA 4JYAE 1ZR9A 2EOHA 4DR6E 2IHR1 4ZYEA 2JXPA 2VQFE 1WHQA 2JOBA 2PRTA 1ZAAC 3HTXA 1UBDC 2FV4B 2DRPA 2EPLX 1N33E 4M2ZA 1X49A 1QNTA 2UU9E 1RC7A 2RTXA 2JPAA 4O24A 3IWDA 2LT7A 1A1IA 1GQEA 2ODRD 2YTEA 5CFFE 2YTFA 1KYQA 2LMZA 2V83A 2YRKA 4DV4E 1GTKA 2V89A 4WSGA 3OTOE 4O43A 2YRHA 2EMLA 2V8QB 2MC5A 4R2EA 4GZNC 2EPPA 2HJJA 2UXDE 1PJTA 2EMBA 3JTZA 4N4RB 1A1GA 2YSOA 3HQ1A 1MGTA 4WX9A 1UN6B 1I94E 4F9BB 2RQLA 3J7Yp 2EOSA 4HEIA 3J80C 5IT9C 2EPMX 2YT4A 2EN2A 2ENAA 2K7IA 4GKJE 1SR9A 2EQ1A 3C6KA 2EJ4A 3MHHC 5AE3A 3H09A 4K0KE 2ODRC 2GPIA 3OMLA 4DV1E 4DV5E 2MKDA 4IJDA 2CSHA 2EL5A 1L4SA 2EMCA 4GKKE 1KJKA 3HPZA 5BR8E 4F9CB 2YTNA 2EMIA 4JI3E 3MSWA 1J26A 5AC5A 1EH8A 4R2SA 4DR3E 2UUBE 4JI2E 4F54A 2L8TA 4WXDA 2E72A 5F3WA 2EPCA 3THNA 2EM7A 4ZYGA 2E1MA 2EL6A 2LV2A 1WRJA 1IBKE 1IMUA 4OX9E 2B3TB 1YFHA 4R2QA 1A1FA 2EOYA 5DNYA 1N3GA 2L33A 2JWOA 1T39A 2EPXA 5LL6R 2M7QA 3EPLA 4O4KA 1PKPA 2ELYA 1GZ6A 5A69A 2RSIA 2GLIA 1T4OA 1XNQE 1X5WA 4DR7E 4KWYA 5AE1A 2JR1A 2CT1A 4B3RE 2YWQA 2YTDA 4DV3E 2L2KB 4DR1E 1A1HA 1WHNA 2JOXA 1G2DC 4RHBB 1TF6A 2EMXA 2EP3A 1X47A 2EMZA 3ADJA 2NUFA 4JI4E 2N3HA 2EOXA 4LTYA 2EOJA 1BBGA 3L00A 4F6NA 4NZVA 3EPKA 2ELZA 4BHCA 2EM8A 2R1FA 4BCAA 3EQ1A 1HNZE 2NUGA 2KONA 2DLQA 1LLMC 2LCEA 1N32E 3AUZA 1PJQA 5IV8B 5LLQA 2JVAA 4AQYE 2EMWA 4F9AB 5ADZA 1PJSA 2EOFA 1HR0E 2YPNA 2LBSB 2WBUA 1ZBTA 4X9JA 2UUCE 2EN6A 4LFCE 2J7JA 2EMHA 4HTGA 1A1KA 5KL4A 1FJGE 5KL6A 2DMYA 2EOZA 4M30A 4LFAE 2DGCA 2EN8A 4IS1C 1PDAA 2MC6A 2YZTA 4X64E 1EKZA 1TF3A 4FK5C 5A6AA 2JYAA 4JV5E 2Q8UA 2HHHE 1X6HA 2EPRA 1IBME 2BBGA 5FLXC 4NHRA 4O5GA 2ENHA 1F2IG 2YTJA 1O0WA 2LTSA 4Q28A 3VHTB 4JI8E 1T4LB 4KZSA 4F6MA 2I9IA 2EMKA 2EM4A 2M4IA 2WBTA 4P7DA 4DUYE 2B7TA 2EL4A 2VRDA 3KZYA 3C6MA 2CPNA 2RS7A 4ZYDA 4B3ME 1X3CA 1A1JA 3P1XA 4BHBA 3C4TA 2RSMA 2YRMA 2ZM6E 4GEQB 4LF9E 4BC7A 5AC4A 2LUQA 3HPSA 2EM9A 5KL2A 2EORA 1QU6A 2EM5A 4JI6E 1TN9A 1IQOA 1X6EA 2EMYA 4BBYA 5A6BA 2L2NA 2EM2A 1ZU1A 1ZBQA 2M1SA 4R2DA 4DMIA 2EOEA 4X62E 4X8WA 3T1YE 2VE7C 3JAMC 2M9AA 2VQEE 3T1HE 4WXCA 2EPZA 4JI1E 4BS9A 2DIXA 5A6JA 3KZZA 3BBGA 4R2AA 2NA2A 5KL5A 4X66E 3BGHA 2G7HA 1B69A 2VF1A 1G2FC 4LF4E 2JP9A 3ADGA 2EMAA 1FKAE 3K6QA 3ADLA 2L2MA 4YHHE 1EH7A 2L6MA 2EPOA 1NEIA 4NXNE 4L8NA 4LFBE 4I8OA 3J7AG 2LUPB 1P47A 2H36X 1WJPA 3EPHA 1UHZA 2L3JA 2YSPA 1Z1BA 4LU9A 2YTQA 3EPJA 2FTXB 3LMLA 2UXBE 2LVHA 1YYKA 2JY9A 1NCSA 1JK1A 1DQ3A 2E5LE 1IBLE 4LF8E 3UK3C 4WYQB 2WBSA 1T38A 5LMUE 2YTOA 2EOQA 4RH8A 5IWAE 4DV0E 3M99B 4MLQA 2EE8A 4KHPE 4LF5E 2K4VA 1YYWA 2YU5A 2DB2A 4DR5E 1J5EE 2V85A 1YPNA 2EMGA 2UUAE 3C4BA 5AE2A 1N34E 2MDGA 2EPKX 2L92A 3MHSC 2LO3A 3ADIA 1XMQE 4DUZE 3ZOQB 2MKNA 2UXCE 1YZ9A 2DMIA 2LJHA 1IQSA 3JU0A 4B3TE 5AASA 2EPNA 1N36E 1MEYC 1RMDA 2EN1A 1T4NA 2YTIA 2EQ0A 4WSPA 3F6GA 4R8OA 4R2PA 3VYXA 2EMFA 2F8BA 5KL3A 4M0VA 4L5NC 2BB8A 4Q35B 2R76A 4DR4E 4BMJA 3F6HA 1XNRE 2LTRA 3KWRA 4JI0E 2EN7A 2DLKA 1YUJA 4DV2E 4TUIA 3LLHA 5A6KA 5KL7A 2RPCA 5A6BD 1DI2A 1YYOA 1HNXE 1WXRA 3QG5C 5LMNE 1RQ0A 3ECRA 2EM0A 2V86A 2V88A 2I13A 5T6JA 2EM3A 4YY3E 2A25A 3HXLA 2LE2A 2EM6A 2N8XA 2EOMA 2LRSA 1AH5A 2RS6A 2NUEA 3BF2A 1UILA 2HGHA 4ZYHA 1XMOE 3THOB 4LF7E 2EWLA 4TUGA 4F2JC 2CTDA 4R2CA 4B3SE 3J81C 1DGCA 4X65E 2WZOA 1X48A 4P78A 2HC5A 3TQMA 3DJWA 3BIDA 2EPAA 4JI7E 2KOUA 2EQ3A 4WPYA 2EN3A 3VK6A 4J8ZA
chains in the Genus database with same CATH topology
2EPRA 2YTOA 1YUIA 2EOQA 2GHFA 2MKDA 4IJDA 3M99B 2CSHA 2EE8A 2ENHA 2EL5A 1F2IG 1BB8A 2EMCA 4R2RA 2YU5A 2YTJA 2EMGA 2WCC3 2YTGA 2MDGA 1KJKA 3VHTB 1YSAC 2YTNA 2EPUA 2EMIA 4F6MA 2EMKA 2EM4A 2WBTA 3MHSC 2LO3A 2EL4A 4R2SA 2EOIA 2VRDA 2MKNA 1X3CA 2DMIA 2E72A 1A1JA 1X6FA 2EPCA 1AAYA 2EM7A 2YRMA 1JK2A 1MEYC 2EL6A 2LV2A 1RMDA 2EN1A 2EM9A 4R2QA 1A1FA 2EOYA 2YTIA 5KL2A 2EQ0A 2EORA 2D9HA 1BBOA 2EM5A 2EPXA 2ADRA 3EPLA 2EN4A 4R2PA 1TN9A 2ELYA 2EMFA 2ENCA 5KL3A 2EOOA 1X6EA 2EMYA 2RSIA 2BB8A 2GLIA 1X5WA 2NABA 2YTPA 2YU8A 2EM2A 4M9VC 1A1LA 1ZU1A 4R2DA 2CT1A 1ZR9A 2YTDA 2EOEA 2EOHA 1A1HA 2EN7A 2DLKA 1YUJA 2M9AA 1G2DC 1TF6A 2EMXA 2EP3A 2PRTA 1ZAAC 1UBDC 2EMZA 5KL7A 2RPCA 2DRPA 2EPZA 2EOXA 2EOJA 4F6NA 4R2AA 3EPKA 2ELZA 2JPAA 2EM8A 2R1FA 2EM0A 5KL5A 1B69A 2LT7A 1A1IA 2DLQA 2YTEA 1G2FC 1LLMC 2LCEA 2JP9A 2EMAA 2YTFA 2YRKA 2I13A 2EM3A 2EMWA 2A25A 4WSGA 2YRHA 2EM6A 2EMLA 2EOFA 4R2EA 2EOMA 4GZNC 2EPPA 2WBUA 4X9JA 1P47A 2HGHA 2EMBA 2EN6A 1WJPA 1A1GA 2J7JA 2EMHA 2YSOA 4F2JC 5KL4A 2CTDA 1A1KA 3EPHA 5KL6A 4R2CA 1UN6B 2YSPA 2EOZA 1Z1BA 2YTQA 2EOSA 3EPJA 1DGCA 2LVHA 2DGCA 2EN8A 4IS1C 2EN2A 2ENAA 1NCSA 1JK1A 2EPAA 1TF3A 4FK5C 2EQ3A 2EQ1A 2EJ4A 2EN3A 3MHHC 3UK3C 2WBSA 1X6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPR A;  2YTO A;  1YUI A;  2EOQ A;  2GHF A;  2MKD A;  4IJD A;  3M99 B;  2CSH A;  2EE8 A;  2ENH A;  2EL5 A;  1F2I G;  1BB8 A;  2EMC A;  4R2R A;  2YU5 A;  2YTJ A;  2EMG A;  2WCC 3;  2YTG A;  2MDG A;  1KJK A;  3VHT B;  1YSA C;  2YTN A;  2EPU A;  2EMI A;  4F6M A;  2EMK A;  2EM4 A;  2WBT A;  3MHS C;  2LO3 A;  2EL4 A;  4R2S A;  2EOI A;  2VRD A;  2MKN A;  1X3C A;  2DMI A;  2E72 A;  1A1J A;  1X6F A;  2EPC A;  1AAY A;  2EM7 A;  2YRM A;  1JK2 A;  1MEY C;  2EL6 A;  2LV2 A;  1RMD A;  2EN1 A;  2EM9 A;  4R2Q A;  1A1F A;  2EOY A;  2YTI A;  5KL2 A;  2EQ0 A;  2EOR A;  2D9H A;  1BBO A;  2EM5 A;  2EPX A;  2ADR A;  3EPL A;  2EN4 A;  4R2P A;  1TN9 A;  2ELY A;  2EMF A;  2ENC A;  5KL3 A;  2EOO A;  1X6E A;  2EMY A;  2RSI A;  2BB8 A;  2GLI A;  1X5W A;  2NAB A;  2YTP A;  2YU8 A;  2EM2 A;  4M9V C;  1A1L A;  1ZU1 A;  4R2D A;  2CT1 A;  1ZR9 A;  2YTD A;  2EOE A;  2EOH A;  1A1H A;  2EN7 A;  2DLK A;  1YUJ A;  2M9A A;  1G2D C;  1TF6 A;  2EMX A;  2EP3 A;  2PRT A;  1ZAA C;  1UBD C;  2EMZ A;  5KL7 A;  2RPC A;  2DRP A;  2EPZ A;  2EOX A;  2EOJ A;  4F6N A;  4R2A A;  3EPK A;  2ELZ A;  2JPA A;  2EM8 A;  2R1F A;  2EM0 A;  5KL5 A;  1B69 A;  2LT7 A;  1A1I A;  2DLQ A;  2YTE A;  1G2F C;  1LLM C;  2LCE A;  2JP9 A;  2EMA A;  2YTF A;  2YRK A;  2I13 A;  2EM3 A;  2EMW A;  2A25 A;  4WSG A;  2YRH A;  2EM6 A;  2EML A;  2EOF A;  4R2E A;  2EOM A;  4GZN C;  2EPP A;  2WBU A;  4X9J A;  1P47 A;  2HGH A;  2EMB A;  2EN6 A;  1WJP A;  1A1G A;  2J7J A;  2EMH A;  2YSO A;  4F2J C;  5KL4 A;  2CTD A;  1A1K A;  3EPH A;  5KL6 A;  4R2C A;  1UN6 B;  2YSP A;  2EOZ A;  1Z1B A;  2YTQ A;  2EOS A;  3EPJ A;  1DGC A;  2LVH A;  2DGC A;  2EN8 A;  4IS1 C;  2EN2 A;  2ENA A;  1NCS A;  1JK1 A;  2EPA A;  1TF3 A;  4FK5 C;  2EQ3 A;  2EQ1 A;  2EJ4 A;  2EN3 A;  3MHH C;  3UK3 C;  2WBS A;  1X6H A; 
#chains in the Genus database with same CATH topology
 4DV6 E;  2EZ6 A;  2L3C A;  4DR2 E;  3FIG A;  2GHF A;  1YUI A;  4DKK A;  1EH6 A;  1BB8 A;  4R2R A;  2F4V E;  4WFT A;  2WCC 3;  2YTG A;  4R03 A;  4LF6 E;  4NXM E;  1YSA C;  2EPU A;  2MDR A;  4MLV A;  1HNW E;  2LJU A;  2N3G A;  2EOI A;  2B9D A;  3IWC A;  3IWB A;  3AV0 A;  3RMP A;  1AAY A;  1X6F A;  3VYY A;  2FGG A;  5A2Q C;  2DSY A;  1JK2 A;  2V87 A;  4DV7 E;  1BBO A;  2D9H A;  4BC9 A;  4JI5 E;  5TSE A;  2B7V A;  3DF6 A;  2ADR A;  2EN4 A;  4OOG C;  2ENC A;  5IXM B;  1STU A;  2EOO A;  1SFE A;  2YTP A;  2KHX A;  2NAB A;  2YU8 A;  4M9V C;  1A1L A;  4JYA E;  1ZR9 A;  2EOH A;  4DR6 E;  2IHR 1;  4ZYE A;  2JXP A;  2VQF E;  1WHQ A;  2JOB A;  2PRT A;  1ZAA C;  3HTX A;  1UBD C;  2FV4 B;  2DRP A;  2EPL X;  1N33 E;  4M2Z A;  1X49 A;  1QNT A;  2UU9 E;  1RC7 A;  2RTX A;  2JPA A;  4O24 A;  3IWD A;  2LT7 A;  1A1I A;  1GQE A;  2ODR D;  2YTE A;  5CFF E;  2YTF A;  1KYQ A;  2LMZ A;  2V83 A;  2YRK A;  4DV4 E;  1GTK A;  2V89 A;  4WSG A;  3OTO E;  4O43 A;  2YRH A;  2EML A;  2V8Q B;  2MC5 A;  4R2E A;  4GZN C;  2EPP A;  2HJJ A;  2UXD E;  1PJT A;  2EMB A;  3JTZ A;  4N4R B;  1A1G A;  2YSO A;  3HQ1 A;  1MGT A;  4WX9 A;  1UN6 B;  1I94 E;  4F9B B;  2RQL A;  3J7Y p;  2EOS A;  4HEI A;  3J80 C;  5IT9 C;  2EPM X;  2YT4 A;  2EN2 A;  2ENA A;  2K7I A;  4GKJ E;  1SR9 A;  2EQ1 A;  3C6K A;  2EJ4 A;  3MHH C;  5AE3 A;  3H09 A;  4K0K E;  2ODR C;  2GPI A;  3OML A;  4DV1 E;  4DV5 E;  2MKD A;  4IJD A;  2CSH A;  2EL5 A;  1L4S A;  2EMC A;  4GKK E;  1KJK A;  3HPZ A;  5BR8 E;  4F9C B;  2YTN A;  2EMI A;  4JI3 E;  3MSW A;  1J26 A;  5AC5 A;  1EH8 A;  4R2S A;  4DR3 E;  2UUB E;  4JI2 E;  4F54 A;  2L8T A;  4WXD A;  2E72 A;  5F3W A;  2EPC A;  3THN A;  2EM7 A;  4ZYG A;  2E1M A;  2EL6 A;  2LV2 A;  1WRJ A;  1IBK E;  1IMU A;  4OX9 E;  2B3T B;  1YFH A;  4R2Q A;  1A1F A;  2EOY A;  5DNY A;  1N3G A;  2L33 A;  2JWO A;  1T39 A;  2EPX A;  5LL6 R;  2M7Q A;  3EPL A;  4O4K A;  1PKP A;  2ELY A;  1GZ6 A;  5A69 A;  2RSI A;  2GLI A;  1T4O A;  1XNQ E;  1X5W A;  4DR7 E;  4KWY A;  5AE1 A;  2JR1 A;  2CT1 A;  4B3R E;  2YWQ A;  2YTD A;  4DV3 E;  2L2K B;  4DR1 E;  1A1H A;  1WHN A;  2JOX A;  1G2D C;  4RHB B;  1TF6 A;  2EMX A;  2EP3 A;  1X47 A;  2EMZ A;  3ADJ A;  2NUF A;  4JI4 E;  2N3H A;  2EOX A;  4LTY A;  2EOJ A;  1BBG A;  3L00 A;  4F6N A;  4NZV A;  3EPK A;  2ELZ A;  4BHC A;  2EM8 A;  2R1F A;  4BCA A;  3EQ1 A;  1HNZ E;  2NUG A;  2KON A;  2DLQ A;  1LLM C;  2LCE A;  1N32 E;  3AUZ A;  1PJQ A;  5IV8 B;  5LLQ A;  2JVA A;  4AQY E;  2EMW A;  4F9A B;  5ADZ A;  1PJS A;  2EOF A;  1HR0 E;  2YPN A;  2LBS B;  2WBU A;  1ZBT A;  4X9J A;  2UUC E;  2EN6 A;  4LFC E;  2J7J A;  2EMH A;  4HTG A;  1A1K A;  5KL4 A;  1FJG E;  5KL6 A;  2DMY A;  2EOZ A;  4M30 A;  4LFA E;  2DGC A;  2EN8 A;  4IS1 C;  1PDA A;  2MC6 A;  2YZT A;  4X64 E;  1EKZ A;  1TF3 A;  4FK5 C;  5A6A A;  2JYA A;  4JV5 E;  2Q8U A;  2HHH E;  1X6H A;  2EPR A;  1IBM E;  2BBG A;  5FLX C;  4NHR A;  4O5G A;  2ENH A;  1F2I G;  2YTJ A;  1O0W A;  2LTS A;  4Q28 A;  3VHT B;  4JI8 E;  1T4L B;  4KZS A;  4F6M A;  2I9I A;  2EMK A;  2EM4 A;  2M4I A;  2WBT A;  4P7D A;  4DUY E;  2B7T A;  2EL4 A;  2VRD A;  3KZY A;  3C6M A;  2CPN A;  2RS7 A;  4ZYD A;  4B3M E;  1X3C A;  1A1J A;  3P1X A;  4BHB A;  3C4T A;  2RSM A;  2YRM A;  2ZM6 E;  4GEQ B;  4LF9 E;  4BC7 A;  5AC4 A;  2LUQ A;  3HPS A;  2EM9 A;  5KL2 A;  2EOR A;  1QU6 A;  2EM5 A;  4JI6 E;  1TN9 A;  1IQO A;  1X6E A;  2EMY A;  4BBY A;  5A6B A;  2L2N A;  2EM2 A;  1ZU1 A;  1ZBQ A;  2M1S A;  4R2D A;  4DMI A;  2EOE A;  4X62 E;  4X8W A;  3T1Y E;  2VE7 C;  3JAM C;  2M9A A;  2VQE E;  3T1H E;  4WXC A;  2EPZ A;  4JI1 E;  4BS9 A;  2DIX A;  5A6J A;  3KZZ A;  3BBG A;  4R2A A;  2NA2 A;  5KL5 A;  4X66 E;  3BGH A;  2G7H A;  1B69 A;  2VF1 A;  1G2F C;  4LF4 E;  2JP9 A;  3ADG A;  2EMA A;  1FKA E;  3K6Q A;  3ADL A;  2L2M A;  4YHH E;  1EH7 A;  2L6M A;  2EPO A;  1NEI A;  4NXN E;  4L8N A;  4LFB E;  4I8O A;  3J7A G;  2LUP B;  1P47 A;  2H36 X;  1WJP A;  3EPH A;  1UHZ A;  2L3J A;  2YSP A;  1Z1B A;  4LU9 A;  2YTQ A;  3EPJ A;  2FTX B;  3LML A;  2UXB E;  2LVH A;  1YYK A;  2JY9 A;  1NCS A;  1JK1 A;  1DQ3 A;  2E5L E;  1IBL E;  4LF8 E;  3UK3 C;  4WYQ B;  2WBS A;  1T38 A;  5LMU E;  2YTO A;  2EOQ A;  4RH8 A;  5IWA E;  4DV0 E;  3M99 B;  4MLQ A;  2EE8 A;  4KHP E;  4LF5 E;  2K4V A;  1YYW A;  2YU5 A;  2DB2 A;  4DR5 E;  1J5E E;  2V85 A;  1YPN A;  2EMG A;  2UUA E;  3C4B A;  5AE2 A;  1N34 E;  2MDG A;  2EPK X;  2L92 A;  3MHS C;  2LO3 A;  3ADI A;  1XMQ E;  4DUZ E;  3ZOQ B;  2MKN A;  2UXC E;  1YZ9 A;  2DMI A;  2LJH A;  1IQS A;  3JU0 A;  4B3T E;  5AAS A;  2EPN A;  1N36 E;  1MEY C;  1RMD A;  2EN1 A;  1T4N A;  2YTI A;  2EQ0 A;  4WSP A;  3F6G A;  4R8O A;  4R2P A;  3VYX A;  2EMF A;  2F8B A;  5KL3 A;  4M0V A;  4L5N C;  2BB8 A;  4Q35 B;  2R76 A;  4DR4 E;  4BMJ A;  3F6H A;  1XNR E;  2LTR A;  3KWR A;  4JI0 E;  2EN7 A;  2DLK A;  1YUJ A;  4DV2 E;  4TUI A;  3LLH A;  5A6K A;  5KL7 A;  2RPC A;  5A6B D;  1DI2 A;  1YYO A;  1HNX E;  1WXR A;  3QG5 C;  5LMN E;  1RQ0 A;  3ECR A;  2EM0 A;  2V86 A;  2V88 A;  2I13 A;  5T6J A;  2EM3 A;  4YY3 E;  2A25 A;  3HXL A;  2LE2 A;  2EM6 A;  2N8X A;  2EOM A;  2LRS A;  1AH5 A;  2RS6 A;  2NUE A;  3BF2 A;  1UIL A;  2HGH A;  4ZYH A;  1XMO E;  3THO B;  4LF7 E;  2EWL A;  4TUG A;  4F2J C;  2CTD A;  4R2C A;  4B3S E;  3J81 C;  1DGC A;  4X65 E;  2WZO A;  1X48 A;  4P78 A;  2HC5 A;  3TQM A;  3DJW A;  3BID A;  2EPA A;  4JI7 E;  2KOU A;  2EQ3 A;  4WPY A;  2EN3 A;  3VK6 A;  4J8Z A; 
#chains in the Genus database with same CATH homology
 2EPR A;  2YTO A;  1YUI A;  2EOQ A;  2GHF A;  2MKD A;  4IJD A;  3M99 B;  2CSH A;  2EE8 A;  2ENH A;  2EL5 A;  1F2I G;  1BB8 A;  2EMC A;  4R2R A;  2YU5 A;  2YTJ A;  2EMG A;  2WCC 3;  2YTG A;  2MDG A;  1KJK A;  3VHT B;  1YSA C;  2YTN A;  2EPU A;  2EMI A;  4F6M A;  2EMK A;  2EM4 A;  2WBT A;  3MHS C;  2LO3 A;  2EL4 A;  4R2S A;  2EOI A;  2VRD A;  2MKN A;  1X3C A;  2DMI A;  2E72 A;  1A1J A;  1X6F A;  2EPC A;  1AAY A;  2EM7 A;  2YRM A;  1JK2 A;  1MEY C;  2EL6 A;  2LV2 A;  1RMD A;  2EN1 A;  2EM9 A;  4R2Q A;  1A1F A;  2EOY A;  2YTI A;  5KL2 A;  2EQ0 A;  2EOR A;  2D9H A;  1BBO A;  2EM5 A;  2EPX A;  2ADR A;  3EPL A;  2EN4 A;  4R2P A;  1TN9 A;  2ELY A;  2EMF A;  2ENC A;  5KL3 A;  2EOO A;  1X6E A;  2EMY A;  2RSI A;  2BB8 A;  2GLI A;  1X5W A;  2NAB A;  2YTP A;  2YU8 A;  2EM2 A;  4M9V C;  1A1L A;  1ZU1 A;  4R2D A;  2CT1 A;  1ZR9 A;  2YTD A;  2EOE A;  2EOH A;  1A1H A;  2EN7 A;  2DLK A;  1YUJ A;  2M9A A;  1G2D C;  1TF6 A;  2EMX A;  2EP3 A;  2PRT A;  1ZAA C;  1UBD C;  2EMZ A;  5KL7 A;  2RPC A;  2DRP A;  2EPZ A;  2EOX A;  2EOJ A;  4F6N A;  4R2A A;  3EPK A;  2ELZ A;  2JPA A;  2EM8 A;  2R1F A;  2EM0 A;  5KL5 A;  1B69 A;  2LT7 A;  1A1I A;  2DLQ A;  2YTE A;  1G2F C;  1LLM C;  2LCE A;  2JP9 A;  2EMA A;  2YTF A;  2YRK A;  2I13 A;  2EM3 A;  2EMW A;  2A25 A;  4WSG A;  2YRH A;  2EM6 A;  2EML A;  2EOF A;  4R2E A;  2EOM A;  4GZN C;  2EPP A;  2WBU A;  4X9J A;  1P47 A;  2HGH A;  2EMB A;  2EN6 A;  1WJP A;  1A1G A;  2J7J A;  2EMH A;  2YSO A;  4F2J C;  5KL4 A;  2CTD A;  1A1K A;  3EPH A;  5KL6 A;  4R2C A;  1UN6 B;  2YSP A;  2EOZ A;  1Z1B A;  2YTQ A;  2EOS A;  3EPJ A;  1DGC A;  2LVH A;  2DGC A;  2EN8 A;  4IS1 C;  2EN2 A;  2ENA A;  1NCS A;  1JK1 A;  2EPA A;  1TF3 A;  4FK5 C;  2EQ3 A;  2EQ1 A;  2EJ4 A;  2EN3 A;  3MHH C;  3UK3 C;  2WBS A;  1X6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...