2M9AA

Solution nmr structure of e3 ubiquitin-protein ligase zfp91 from homo sapiens, northeast structural genomics consortium (nesg) target hr7784a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
HMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase ZFP91
publication title Solution Structure of Hr7784A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 23
structure length 89
sequence length 89
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2m9aA03
2EN2A 4R2QA 2EMHA 2EMGA 2EORA 4R2RA 2EMFA 2LVHA 3M99B 2WCC3 1BBOA 2CSHA 2D9HA 5KL2A 2EOSA 2EOQA 1YUJA 2EN6A 2ENHA 1BB8A 2VRDA 4F6MA 2YTIA 2WBUA 2EMIA 2YRHA 4GZNC 2YTOA 2YSOA 2EM2A 3VHTB 2ENCA 2PRTA 2EL5A 2DLKA 2E72A 2ENAA 2EOEA 2EQ0A 1A1LA 1YSAC 3MHHC 2YTPA 1MEYC 2JP9A 2EMZA 2EM0A 2YTQA 1A1JA 2I13A 1TN9A 1X6FA 2LCEA 2EPRA 2ELYA 2EPXA 1JK2A 3EPLA 2EOXA 2YRKA 2EPCA 4F6NA 3EPKA 1X6EA 2GHFA 4R2EA 2YSPA 2RPCA 1A1KA 2MKDA 2EP3A 1NCSA 2EM8A 2M9AA 2R1FA 2EN3A 2YTJA 5KL7A 2EOJA 2DLQA 4FK5C 1P47A 1A1HA 1TF6A 3UK3C 2YU8A 1Z1BA 1X3CA 2EOMA 2YRMA 2WBSA 2YTNA 2DMIA 1UN6B 2EOZA 2EOYA 4R2SA 4R2AA 2EN1A 2LT7A 2RSIA 2EL6A 2EMXA 2EN8A 2EMKA 2EQ3A 1JK1A 2DRPA 2EOIA 2EE8A 2CTDA 1WJPA 2A25A 2EMCA 5KL3A 5KL5A 1ZU1A 1RMDA 4WSGA 2EMBA 1ZR9A 4F2JC 2EJ4A 4R2PA 3EPJA 1A1GA 3EPHA 4R2DA 2EMLA 2WBTA 1DGCA 2EM7A 2EMYA 1G2FC 2EPUA 5KL4A 2YU5A 2BB8A 2EN7A 4R2CA 2MDGA 1YUIA 2EPAA 1KJKA 2EM4A 2LV2A 2EPZA 2ELZA 4IJDA 1ZAAC 1X5WA 2LO3A 2YTEA 1B69A 2HGHA 2EOFA 2EN4A 2EOOA 2GLIA 2EM5A 2NABA 2YTFA 2EQ1A 4IS1C 1G2DC 2MKNA 1LLMC 2EL4A 2JPAA 4X9JA 2YTDA 4M9VC 2EM6A 2ADRA 1UBDC 1A1FA 1X6HA 1F2IG 2EMAA 1TF3A 2EPPA 5KL6A 2EM9A 1AAYA 2EOHA 1A1IA 2YTGA 2J7JA 3MHSC 2DGCA 2CT1A 2EMWA 2EM3A
chains in the Genus database with same CATH superfamily
4WFTA 5FLXC 2JWOA 4JI8E 1N32E 4R8OA 2CSHA 4K0KE 5LLQA 2JOBA 2EPLX 2EN6A 2ENHA 2V88A 2LE2A 4OOGC 2VRDA 5BR8E 4LF6E 3ADJA 2YTIA 1WHNA 4R03A 2YTOA 2YSOA 3VHTB 4GZNC 2LRSA 4BHBA 2EPMX 2EL5A 3P1XA 2PRTA 5T6JA 2NUEA 1MGTA 3HPSA 1N33E 2DMYA 4WSPA 2LBSB 2HC5A 3DJWA 4RHBB 2MDRA 2EMZA 2EM0A 3J80C 1TN9A 4GKJE 1JK2A 2EOXA 2EPCA 2L3CA 4F6NA 2JOXA 2RTXA 3EPKA 1IQOA 4R2EA 4JI4E 2YSPA 2ZM6E 2K4VA 2EP3A 1NCSA 5IT9C 2KHXA 2YTJA 3OMLA 1UILA 2DIXA 4FK5C 2CPNA 4ZYHA 2N3GA 1QNTA 4F54A 5AE1A 2EOYA 4LF8E 1ZBQA 2EN1A 2RSIA 1HNXE 4JYAE 2EMKA 2DRPA 4Q35B 4DR3E 2YWQA 1ZBTA 2EMCA 4DV1E 5KL3A 4WPYA 4WSGA 4DUZE 2FTXB 2LJHA 3FIGA 4LFAE 1A1GA 1DGCA 2EM7A 1PDAA 1QU6A 4DV2E 3HPZA 1HNWE 4WYQB 2EN7A 2MDGA 1YUIA 4LF7E 1KJKA 1SFEA 2LV2A 4IJDA 2B9DA 2LTRA 5AE2A 3RMPA 2EN4A 2EOOA 4RH8A 2YTDA 3C6MA 3HTXA 4GKKE 1T4OA 2EMAA 2LUQA 4L5NC 2H36X 2EPPA 2V85A 2L2MA 2J7JA 3OTOE 2CT1A 1T38A 3J7Yp 2EM3A 5AC5A 2EN2A 2EMHA 2EORA 4R2RA 2LVHA 2WCC3 1PJSA 2VE7C 2M7QA 4X8WA 1HNZE 2EPOA 4BC9A 3ZOQB 2WBUA 1T39A 2YRHA 2HHHE 4NZVA 1PJQA 2E72A 5AC4A 1I94E 2EOEA 2EQ0A 3K6QA 2NA2A 5LL6R 1IBME 1YSAC 2EPNA 3TQMA 4BMJA 2B3TB 2YPNA 2Q8UA 1GZ6A 1N36E 1MEYC 2KONA 2L3JA 1YFHA 4NXNE 2EPXA 4LU9A 2V83A 5A6BA 5A6JA 1A1KA 2MKDA 2MC5A 2VF1A 1XNRE 2LMZA 2EM8A 2M9AA 2R1FA 2EN3A 4B3TE 5KL7A 1FJGE 1STUA 2DLQA 1A1HA 2UU9E 3UK3C 1Z1BA 2F4VE 2LTSA 1X3CA 4DV6E 1HR0E 2ODRC 1DQ3A 2EOZA 4KHPE 3HQ1A 5A2QC 2HJJA 2EMXA 1NEIA 5ADZA 1WJPA 2FGGA 2A25A 3IWBA 4JI5E 5KL5A 1T4LB 2NUGA 2EMBA 4DV0E 2EJ4A 3EPJA 1FKAE 2L2NA 2EMLA 2WBTA 4WX9A 1IQSA 2M4IA 5KL4A 3C4TA 4DR4E 1EH6A 2BB8A 3JTZA 2EPAA 2JXPA 3F6GA 2EPZA 1ZAAC 2JYAA 2B7VA 2HGHA 1YYWA 3J81C 2EOFA 1N34E 1AH5A 1KYQA 2EPKX 4B3ME 5CFFE 2EL4A 2EZ6A 2F8BA 1A1FA 4LTYA 2EWLA 1O0WA 3BBGA 4DR1E 3VK6A 4DV7E 2EM9A 4OX9E 4N4RB 2YTGA 3JAMC 2DGCA 4F2JC 3HXLA 2UXBE 4R2QA 2KOUA 1RQ0A 4KZSA 4ZYGA 4JI0E 5IXMB 4JV5E 1BBOA 5TSEA 2D9HA 5KL2A 5AASA 1BB8A 4ZYEA 2B7TA 2UXCE 3ECRA 2EMIA 4WXDA 3BIDA 3C4BA 4BS9A 2EM2A 4AQYE 2UXDE 2ENCA 2DLKA 2ENAA 1YYOA 4TUGA 1A1LA 4DUYE 3MHHC 2G7HA 2JVAA 2YTPA 4O4KA 4J8ZA 1X47A 2YZTA 2YTQA 5A6AA 4B3RE 4P7DA 1X6FA 5F3WA 4MLQA 4M2ZA 2EPRA 2RSMA 2YRKA 2UUAE 1GTKA 2GHFA 2WZOA 3DF6A 3T1YE 2RPCA 1XNQE 4YY3E 1BBGA 1P47A 4DR5E 1TF6A 2YU8A 2DB2A 1XMQE 2YRMA 2WBSA 1UN6B 3J7AG 4BCAA 1PKPA 1PJTA 2LT7A 3VYYA 4BHCA 4LF5E 2UUCE 2EL6A 3ADLA 2EN8A 4DV5E 2EQ3A 3IWCA 5LMUE 1ZU1A 1EH7A 1WHQA 4R2PA 1XMOE 4R2DA 1EKZA 2EMYA 1G2FC 2EPUA 3T1HE 5DNYA 4B3SE 2L33A 4R2CA 4NHRA 1RC7A 1YPNA 4LF4E 2I9IA 2RS7A 4DR7E 5A6BD 4JI3E 3KWRA 4DR6E 4NXME 2YTEA 4WXCA 1X49A 1T4NA 4O43A 2GLIA 2YTFA 2NABA 4LF9E 4IS1C 1G2DC 4DR2E 2N8XA 1LLMC 2JPAA 3MSWA 4M9VC 2EM6A 1DI2A 1X6HA 3BGHA 1F2IG 1X48A 4DMIA 4X65E 2MC6A 4BBYA 2EOHA 1A1IA 1AAYA 3MHSC 4BC7A 2L92A 3LMLA 2EMWA 2L2KB 4M30A 2EMGA 3AUZA 3EQ1A 1GQEA 2EMFA 3M99B 2LUPB 3L00A 4DV3E 2EOSA 2EOQA 2IHR1 1YUJA 2JY9A 2RQLA 2VQEE 4F6MA 4YHHE 3AV0A 1L4SA 4M0VA 2LJUA 4HEIA 2YT4A 2BBGA 3H09A 4JI6E 5IWAE 1WRJA 4O5GA 3ADIA 4I8OA 4F9AB 2E5LE 3BF2A 2JP9A 4O24A 1A1JA 2I13A 3F6HA 2LCEA 2ELYA 4GEQB 2GPIA 3EPLA 2L8TA 4JI1E 2UUBE 4JI7E 4X62E 4DV4E 1X6EA 4F9CB 1IMUA 2FV4B 1YZ9A 2EOJA 2M1SA 4X64E 3ADGA 4Q28A 5IV8B 1UHZA 2EOMA 2YTNA 2DMIA 3VYXA 4LFBE 3QG5C 4R2SA 1IBLE 4R2AA 4DKKA 2K7IA 2R76A 4HTGA 4TUIA 1JK1A 2V89A 4L8NA 4MLVA 2EOIA 2EE8A 2CTDA 1RMDA 5A6KA 4F9BB 1ZR9A 2L6MA 3EPHA 1IBKE 2E1MA 5A69A 1N3GA 3JU0A 1EH8A 3IWDA 1WXRA 2YU5A 2JR1A 2RS6A 3C6KA 1SR9A 2N3HA 2EM4A 1J5EE 2ELZA 2V86A 1X5WA 2LO3A 2VQFE 1B69A 5AE3A 2NUFA 2EM5A 2EQ1A 4P78A 2MKNA 2V87A 4LFCE 3THOB 4X9JA 2ODRD 2ADRA 2V8QB 1UBDC 3KZYA 1J26A 3KZZA 2DSYA 1TF3A 4JI2E 5KL6A 1YYKA 3THNA 3LLHA 5LMNE 4X66E 4ZYDA 4KWYA
chains in the Genus database with same CATH topology
2EN2A 4R2QA 2EMHA 2EMGA 2EORA 4R2RA 2EMFA 2LVHA 3M99B 2WCC3 1BBOA 2CSHA 2D9HA 5KL2A 2EOSA 2EOQA 1YUJA 2EN6A 2ENHA 1BB8A 2VRDA 4F6MA 2YTIA 2WBUA 2EMIA 2YRHA 4GZNC 2YTOA 2YSOA 2EM2A 3VHTB 2ENCA 2PRTA 2EL5A 2DLKA 2E72A 2ENAA 2EOEA 2EQ0A 1A1LA 1YSAC 3MHHC 2YTPA 1MEYC 2JP9A 2EMZA 2EM0A 2YTQA 1A1JA 2I13A 1TN9A 1X6FA 2LCEA 2EPRA 2ELYA 2EPXA 1JK2A 3EPLA 2EOXA 2YRKA 2EPCA 4F6NA 3EPKA 1X6EA 2GHFA 4R2EA 2YSPA 2RPCA 1A1KA 2MKDA 2EP3A 1NCSA 2EM8A 2M9AA 2R1FA 2EN3A 2YTJA 5KL7A 2EOJA 2DLQA 4FK5C 1P47A 1A1HA 1TF6A 3UK3C 2YU8A 1Z1BA 1X3CA 2EOMA 2YRMA 2WBSA 2YTNA 2DMIA 1UN6B 2EOZA 2EOYA 4R2SA 4R2AA 2EN1A 2LT7A 2RSIA 2EL6A 2EMXA 2EN8A 2EMKA 2EQ3A 1JK1A 2DRPA 2EOIA 2EE8A 2CTDA 1WJPA 2A25A 2EMCA 5KL3A 5KL5A 1ZU1A 1RMDA 4WSGA 2EMBA 1ZR9A 4F2JC 2EJ4A 4R2PA 3EPJA 1A1GA 3EPHA 4R2DA 2EMLA 2WBTA 1DGCA 2EM7A 2EMYA 1G2FC 2EPUA 5KL4A 2YU5A 2BB8A 2EN7A 4R2CA 2MDGA 1YUIA 2EPAA 1KJKA 2EM4A 2LV2A 2EPZA 2ELZA 4IJDA 1ZAAC 1X5WA 2LO3A 2YTEA 1B69A 2HGHA 2EOFA 2EN4A 2EOOA 2GLIA 2EM5A 2NABA 2YTFA 2EQ1A 4IS1C 1G2DC 2MKNA 1LLMC 2EL4A 2JPAA 4X9JA 2YTDA 4M9VC 2EM6A 2ADRA 1UBDC 1A1FA 1X6HA 1F2IG 2EMAA 1TF3A 2EPPA 5KL6A 2EM9A 1AAYA 2EOHA 1A1IA 2YTGA 2J7JA 3MHSC 2DGCA 2CT1A 2EMWA 2EM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN2 A;  4R2Q A;  2EMH A;  2EMG A;  2EOR A;  4R2R A;  2EMF A;  2LVH A;  3M99 B;  2WCC 3;  1BBO A;  2CSH A;  2D9H A;  5KL2 A;  2EOS A;  2EOQ A;  1YUJ A;  2EN6 A;  2ENH A;  1BB8 A;  2VRD A;  4F6M A;  2YTI A;  2WBU A;  2EMI A;  2YRH A;  4GZN C;  2YTO A;  2YSO A;  2EM2 A;  3VHT B;  2ENC A;  2PRT A;  2EL5 A;  2DLK A;  2E72 A;  2ENA A;  2EOE A;  2EQ0 A;  1A1L A;  1YSA C;  3MHH C;  2YTP A;  1MEY C;  2JP9 A;  2EMZ A;  2EM0 A;  2YTQ A;  1A1J A;  2I13 A;  1TN9 A;  1X6F A;  2LCE A;  2EPR A;  2ELY A;  2EPX A;  1JK2 A;  3EPL A;  2EOX A;  2YRK A;  2EPC A;  4F6N A;  3EPK A;  1X6E A;  2GHF A;  4R2E A;  2YSP A;  2RPC A;  1A1K A;  2MKD A;  2EP3 A;  1NCS A;  2EM8 A;  2M9A A;  2R1F A;  2EN3 A;  2YTJ A;  5KL7 A;  2EOJ A;  2DLQ A;  4FK5 C;  1P47 A;  1A1H A;  1TF6 A;  3UK3 C;  2YU8 A;  1Z1B A;  1X3C A;  2EOM A;  2YRM A;  2WBS A;  2YTN A;  2DMI A;  1UN6 B;  2EOZ A;  2EOY A;  4R2S A;  4R2A A;  2EN1 A;  2LT7 A;  2RSI A;  2EL6 A;  2EMX A;  2EN8 A;  2EMK A;  2EQ3 A;  1JK1 A;  2DRP A;  2EOI A;  2EE8 A;  2CTD A;  1WJP A;  2A25 A;  2EMC A;  5KL3 A;  5KL5 A;  1ZU1 A;  1RMD A;  4WSG A;  2EMB A;  1ZR9 A;  4F2J C;  2EJ4 A;  4R2P A;  3EPJ A;  1A1G A;  3EPH A;  4R2D A;  2EML A;  2WBT A;  1DGC A;  2EM7 A;  2EMY A;  1G2F C;  2EPU A;  5KL4 A;  2YU5 A;  2BB8 A;  2EN7 A;  4R2C A;  2MDG A;  1YUI A;  2EPA A;  1KJK A;  2EM4 A;  2LV2 A;  2EPZ A;  2ELZ A;  4IJD A;  1ZAA C;  1X5W A;  2LO3 A;  2YTE A;  1B69 A;  2HGH A;  2EOF A;  2EN4 A;  2EOO A;  2GLI A;  2EM5 A;  2NAB A;  2YTF A;  2EQ1 A;  4IS1 C;  1G2D C;  2MKN A;  1LLM C;  2EL4 A;  2JPA A;  4X9J A;  2YTD A;  4M9V C;  2EM6 A;  2ADR A;  1UBD C;  1A1F A;  1X6H A;  1F2I G;  2EMA A;  1TF3 A;  2EPP A;  5KL6 A;  2EM9 A;  1AAY A;  2EOH A;  1A1I A;  2YTG A;  2J7J A;  3MHS C;  2DGC A;  2CT1 A;  2EMW A;  2EM3 A; 
#chains in the Genus database with same CATH topology
 4WFT A;  5FLX C;  2JWO A;  4JI8 E;  1N32 E;  4R8O A;  2CSH A;  4K0K E;  5LLQ A;  2JOB A;  2EPL X;  2EN6 A;  2ENH A;  2V88 A;  2LE2 A;  4OOG C;  2VRD A;  5BR8 E;  4LF6 E;  3ADJ A;  2YTI A;  1WHN A;  4R03 A;  2YTO A;  2YSO A;  3VHT B;  4GZN C;  2LRS A;  4BHB A;  2EPM X;  2EL5 A;  3P1X A;  2PRT A;  5T6J A;  2NUE A;  1MGT A;  3HPS A;  1N33 E;  2DMY A;  4WSP A;  2LBS B;  2HC5 A;  3DJW A;  4RHB B;  2MDR A;  2EMZ A;  2EM0 A;  3J80 C;  1TN9 A;  4GKJ E;  1JK2 A;  2EOX A;  2EPC A;  2L3C A;  4F6N A;  2JOX A;  2RTX A;  3EPK A;  1IQO A;  4R2E A;  4JI4 E;  2YSP A;  2ZM6 E;  2K4V A;  2EP3 A;  1NCS A;  5IT9 C;  2KHX A;  2YTJ A;  3OML A;  1UIL A;  2DIX A;  4FK5 C;  2CPN A;  4ZYH A;  2N3G A;  1QNT A;  4F54 A;  5AE1 A;  2EOY A;  4LF8 E;  1ZBQ A;  2EN1 A;  2RSI A;  1HNX E;  4JYA E;  2EMK A;  2DRP A;  4Q35 B;  4DR3 E;  2YWQ A;  1ZBT A;  2EMC A;  4DV1 E;  5KL3 A;  4WPY A;  4WSG A;  4DUZ E;  2FTX B;  2LJH A;  3FIG A;  4LFA E;  1A1G A;  1DGC A;  2EM7 A;  1PDA A;  1QU6 A;  4DV2 E;  3HPZ A;  1HNW E;  4WYQ B;  2EN7 A;  2MDG A;  1YUI A;  4LF7 E;  1KJK A;  1SFE A;  2LV2 A;  4IJD A;  2B9D A;  2LTR A;  5AE2 A;  3RMP A;  2EN4 A;  2EOO A;  4RH8 A;  2YTD A;  3C6M A;  3HTX A;  4GKK E;  1T4O A;  2EMA A;  2LUQ A;  4L5N C;  2H36 X;  2EPP A;  2V85 A;  2L2M A;  2J7J A;  3OTO E;  2CT1 A;  1T38 A;  3J7Y p;  2EM3 A;  5AC5 A;  2EN2 A;  2EMH A;  2EOR A;  4R2R A;  2LVH A;  2WCC 3;  1PJS A;  2VE7 C;  2M7Q A;  4X8W A;  1HNZ E;  2EPO A;  4BC9 A;  3ZOQ B;  2WBU A;  1T39 A;  2YRH A;  2HHH E;  4NZV A;  1PJQ A;  2E72 A;  5AC4 A;  1I94 E;  2EOE A;  2EQ0 A;  3K6Q A;  2NA2 A;  5LL6 R;  1IBM E;  1YSA C;  2EPN A;  3TQM A;  4BMJ A;  2B3T B;  2YPN A;  2Q8U A;  1GZ6 A;  1N36 E;  1MEY C;  2KON A;  2L3J A;  1YFH A;  4NXN E;  2EPX A;  4LU9 A;  2V83 A;  5A6B A;  5A6J A;  1A1K A;  2MKD A;  2MC5 A;  2VF1 A;  1XNR E;  2LMZ A;  2EM8 A;  2M9A A;  2R1F A;  2EN3 A;  4B3T E;  5KL7 A;  1FJG E;  1STU A;  2DLQ A;  1A1H A;  2UU9 E;  3UK3 C;  1Z1B A;  2F4V E;  2LTS A;  1X3C A;  4DV6 E;  1HR0 E;  2ODR C;  1DQ3 A;  2EOZ A;  4KHP E;  3HQ1 A;  5A2Q C;  2HJJ A;  2EMX A;  1NEI A;  5ADZ A;  1WJP A;  2FGG A;  2A25 A;  3IWB A;  4JI5 E;  5KL5 A;  1T4L B;  2NUG A;  2EMB A;  4DV0 E;  2EJ4 A;  3EPJ A;  1FKA E;  2L2N A;  2EML A;  2WBT A;  4WX9 A;  1IQS A;  2M4I A;  5KL4 A;  3C4T A;  4DR4 E;  1EH6 A;  2BB8 A;  3JTZ A;  2EPA A;  2JXP A;  3F6G A;  2EPZ A;  1ZAA C;  2JYA A;  2B7V A;  2HGH A;  1YYW A;  3J81 C;  2EOF A;  1N34 E;  1AH5 A;  1KYQ A;  2EPK X;  4B3M E;  5CFF E;  2EL4 A;  2EZ6 A;  2F8B A;  1A1F A;  4LTY A;  2EWL A;  1O0W A;  3BBG A;  4DR1 E;  3VK6 A;  4DV7 E;  2EM9 A;  4OX9 E;  4N4R B;  2YTG A;  3JAM C;  2DGC A;  4F2J C;  3HXL A;  2UXB E;  4R2Q A;  2KOU A;  1RQ0 A;  4KZS A;  4ZYG A;  4JI0 E;  5IXM B;  4JV5 E;  1BBO A;  5TSE A;  2D9H A;  5KL2 A;  5AAS A;  1BB8 A;  4ZYE A;  2B7T A;  2UXC E;  3ECR A;  2EMI A;  4WXD A;  3BID A;  3C4B A;  4BS9 A;  2EM2 A;  4AQY E;  2UXD E;  2ENC A;  2DLK A;  2ENA A;  1YYO A;  4TUG A;  1A1L A;  4DUY E;  3MHH C;  2G7H A;  2JVA A;  2YTP A;  4O4K A;  4J8Z A;  1X47 A;  2YZT A;  2YTQ A;  5A6A A;  4B3R E;  4P7D A;  1X6F A;  5F3W A;  4MLQ A;  4M2Z A;  2EPR A;  2RSM A;  2YRK A;  2UUA E;  1GTK A;  2GHF A;  2WZO A;  3DF6 A;  3T1Y E;  2RPC A;  1XNQ E;  4YY3 E;  1BBG A;  1P47 A;  4DR5 E;  1TF6 A;  2YU8 A;  2DB2 A;  1XMQ E;  2YRM A;  2WBS A;  1UN6 B;  3J7A G;  4BCA A;  1PKP A;  1PJT A;  2LT7 A;  3VYY A;  4BHC A;  4LF5 E;  2UUC E;  2EL6 A;  3ADL A;  2EN8 A;  4DV5 E;  2EQ3 A;  3IWC A;  5LMU E;  1ZU1 A;  1EH7 A;  1WHQ A;  4R2P A;  1XMO E;  4R2D A;  1EKZ A;  2EMY A;  1G2F C;  2EPU A;  3T1H E;  5DNY A;  4B3S E;  2L33 A;  4R2C A;  4NHR A;  1RC7 A;  1YPN A;  4LF4 E;  2I9I A;  2RS7 A;  4DR7 E;  5A6B D;  4JI3 E;  3KWR A;  4DR6 E;  4NXM E;  2YTE A;  4WXC A;  1X49 A;  1T4N A;  4O43 A;  2GLI A;  2YTF A;  2NAB A;  4LF9 E;  4IS1 C;  1G2D C;  4DR2 E;  2N8X A;  1LLM C;  2JPA A;  3MSW A;  4M9V C;  2EM6 A;  1DI2 A;  1X6H A;  3BGH A;  1F2I G;  1X48 A;  4DMI A;  4X65 E;  2MC6 A;  4BBY A;  2EOH A;  1A1I A;  1AAY A;  3MHS C;  4BC7 A;  2L92 A;  3LML A;  2EMW A;  2L2K B;  4M30 A;  2EMG A;  3AUZ A;  3EQ1 A;  1GQE A;  2EMF A;  3M99 B;  2LUP B;  3L00 A;  4DV3 E;  2EOS A;  2EOQ A;  2IHR 1;  1YUJ A;  2JY9 A;  2RQL A;  2VQE E;  4F6M A;  4YHH E;  3AV0 A;  1L4S A;  4M0V A;  2LJU A;  4HEI A;  2YT4 A;  2BBG A;  3H09 A;  4JI6 E;  5IWA E;  1WRJ A;  4O5G A;  3ADI A;  4I8O A;  4F9A B;  2E5L E;  3BF2 A;  2JP9 A;  4O24 A;  1A1J A;  2I13 A;  3F6H A;  2LCE A;  2ELY A;  4GEQ B;  2GPI A;  3EPL A;  2L8T A;  4JI1 E;  2UUB E;  4JI7 E;  4X62 E;  4DV4 E;  1X6E A;  4F9C B;  1IMU A;  2FV4 B;  1YZ9 A;  2EOJ A;  2M1S A;  4X64 E;  3ADG A;  4Q28 A;  5IV8 B;  1UHZ A;  2EOM A;  2YTN A;  2DMI A;  3VYX A;  4LFB E;  3QG5 C;  4R2S A;  1IBL E;  4R2A A;  4DKK A;  2K7I A;  2R76 A;  4HTG A;  4TUI A;  1JK1 A;  2V89 A;  4L8N A;  4MLV A;  2EOI A;  2EE8 A;  2CTD A;  1RMD A;  5A6K A;  4F9B B;  1ZR9 A;  2L6M A;  3EPH A;  1IBK E;  2E1M A;  5A69 A;  1N3G A;  3JU0 A;  1EH8 A;  3IWD A;  1WXR A;  2YU5 A;  2JR1 A;  2RS6 A;  3C6K A;  1SR9 A;  2N3H A;  2EM4 A;  1J5E E;  2ELZ A;  2V86 A;  1X5W A;  2LO3 A;  2VQF E;  1B69 A;  5AE3 A;  2NUF A;  2EM5 A;  2EQ1 A;  4P78 A;  2MKN A;  2V87 A;  4LFC E;  3THO B;  4X9J A;  2ODR D;  2ADR A;  2V8Q B;  1UBD C;  3KZY A;  1J26 A;  3KZZ A;  2DSY A;  1TF3 A;  4JI2 E;  5KL6 A;  1YYK A;  3THN A;  3LLH A;  5LMN E;  4X66 E;  4ZYD A;  4KWY A; 
#chains in the Genus database with same CATH homology
 2EN2 A;  4R2Q A;  2EMH A;  2EMG A;  2EOR A;  4R2R A;  2EMF A;  2LVH A;  3M99 B;  2WCC 3;  1BBO A;  2CSH A;  2D9H A;  5KL2 A;  2EOS A;  2EOQ A;  1YUJ A;  2EN6 A;  2ENH A;  1BB8 A;  2VRD A;  4F6M A;  2YTI A;  2WBU A;  2EMI A;  2YRH A;  4GZN C;  2YTO A;  2YSO A;  2EM2 A;  3VHT B;  2ENC A;  2PRT A;  2EL5 A;  2DLK A;  2E72 A;  2ENA A;  2EOE A;  2EQ0 A;  1A1L A;  1YSA C;  3MHH C;  2YTP A;  1MEY C;  2JP9 A;  2EMZ A;  2EM0 A;  2YTQ A;  1A1J A;  2I13 A;  1TN9 A;  1X6F A;  2LCE A;  2EPR A;  2ELY A;  2EPX A;  1JK2 A;  3EPL A;  2EOX A;  2YRK A;  2EPC A;  4F6N A;  3EPK A;  1X6E A;  2GHF A;  4R2E A;  2YSP A;  2RPC A;  1A1K A;  2MKD A;  2EP3 A;  1NCS A;  2EM8 A;  2M9A A;  2R1F A;  2EN3 A;  2YTJ A;  5KL7 A;  2EOJ A;  2DLQ A;  4FK5 C;  1P47 A;  1A1H A;  1TF6 A;  3UK3 C;  2YU8 A;  1Z1B A;  1X3C A;  2EOM A;  2YRM A;  2WBS A;  2YTN A;  2DMI A;  1UN6 B;  2EOZ A;  2EOY A;  4R2S A;  4R2A A;  2EN1 A;  2LT7 A;  2RSI A;  2EL6 A;  2EMX A;  2EN8 A;  2EMK A;  2EQ3 A;  1JK1 A;  2DRP A;  2EOI A;  2EE8 A;  2CTD A;  1WJP A;  2A25 A;  2EMC A;  5KL3 A;  5KL5 A;  1ZU1 A;  1RMD A;  4WSG A;  2EMB A;  1ZR9 A;  4F2J C;  2EJ4 A;  4R2P A;  3EPJ A;  1A1G A;  3EPH A;  4R2D A;  2EML A;  2WBT A;  1DGC A;  2EM7 A;  2EMY A;  1G2F C;  2EPU A;  5KL4 A;  2YU5 A;  2BB8 A;  2EN7 A;  4R2C A;  2MDG A;  1YUI A;  2EPA A;  1KJK A;  2EM4 A;  2LV2 A;  2EPZ A;  2ELZ A;  4IJD A;  1ZAA C;  1X5W A;  2LO3 A;  2YTE A;  1B69 A;  2HGH A;  2EOF A;  2EN4 A;  2EOO A;  2GLI A;  2EM5 A;  2NAB A;  2YTF A;  2EQ1 A;  4IS1 C;  1G2D C;  2MKN A;  1LLM C;  2EL4 A;  2JPA A;  4X9J A;  2YTD A;  4M9V C;  2EM6 A;  2ADR A;  1UBD C;  1A1F A;  1X6H A;  1F2I G;  2EMA A;  1TF3 A;  2EPP A;  5KL6 A;  2EM9 A;  1AAY A;  2EOH A;  1A1I A;  2YTG A;  2J7J A;  3MHS C;  2DGC A;  2CT1 A;  2EMW A;  2EM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...