2F8BA

Nmr structure of the c-terminal domain (dimer) of hpv45 oncoprotein e7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E7
publication title Solution structure of the partially folded high-risk human papilloma virus 45 oncoprotein E7.
pubmed doi rcsb
source organism Human papillomavirus type 45
molecule tags Oncoprotein, virus/viral protein
total genus 11
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.730 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2f8bA00
2F8BA 2EWLA
chains in the Genus database with same CATH superfamily
3F6GA 2YTGA 1BB8A 5LMUE 2EM0A 2EPKX 2V85A 2EQ3A 2YTOA 3UK3C 1GTKA 4IS1C 2F4VE 2M9AA 1UHZA 1XNRE 4L5NC 1PKPA 4O4KA 2EPUA 4R2AA 1YSAC 5IWAE 2DLQA 3VK6A 2EOEA 1YZ9A 2RTXA 3MHSC 4IJDA 2EPZA 2YPNA 4P78A 2VF1A 5KL7A 2MKNA 4YY3E 1UBDC 4WFTA 4M2ZA 1IBKE 2B7TA 3ADJA 2EPCA 2EOXA 2LE2A 2L2KB 2EL5A 1X49A 2JVAA 2EOYA 4WXDA 4DR1E 1YPNA 3JAMC 2R76A 4DR3E 1HNZE 3KZZA 1X48A 2EOHA 1G2DC 4K0KE 4LF6E 2M4IA 2BB8A 4OOGC 1YYKA 2ELZA 4TUIA 3DJWA 3OMLA 2EM3A 5F3WA 1FJGE 3HTXA 1BBOA 3K6QA 5A6AA 2EMHA 2V83A 2RS7A 1PJQA 2EPMX 2GHFA 1RQ0A 1UILA 4LFAE 4DV7E 1N33E 4M30A 2E1MA 2EQ1A 2YSOA 2EOIA 2YWQA 1T38A 4JI0E 2N8XA 4JV5E 2IHR1 2ZM6E 3IWCA 2YTFA 5A2QC 3IWBA 1GQEA 4WSPA 1A1JA 2HGHA 3EPKA 2EN8A 3MSWA 2EN4A 4R2QA 3HPZA 2DGCA 4L8NA 4F9CB 4LF5E 2V89A 4R2CA 1KYQA 2V87A 1JK1A 2EMYA 2UUCE 2KHXA 2ENAA 4DUYE 4JI8E 3TQMA 4GEQB 1SFEA 5LLQA 1TF6A 2YU5A 2EM2A 5KL4A 2EN7A 2EMCA 1N36E 2EPPA 2UXCE 3T1HE 4WPYA 5AE3A 2EL4A 4GZNC 3LLHA 2EOSA 4M9VC 2YTIA 2V88A 1X47A 2FTXB 4BMJA 1X3CA 2HJJA 5A6KA 3T1YE 2RSIA 1XNQE 4RH8A 3LMLA 1P47A 2YRHA 2NUFA 1IQSA 4Q35B 2EN2A 2EPLX 4TUGA 5AC4A 3ZOQB 2WZOA 2EM8A 4BS9A 1MEYC 4P7DA 4N4RB 2B9DA 1A1GA 3VYXA 4F2JC 4JI6E 1HNXE 2EPNA 2DMYA 2EMIA 2MC5A 4DMIA 5AE1A 2EWLA 2N3GA 2YRKA 2BBGA 2LJUA 1T4OA 1IBLE 5LMNE 2EN6A 1PDAA 1F2IG 2K4VA 4FK5C 4X65E 2RSMA 2V86A 5KL2A 4BC7A 4X62E 2YTEA 2LV2A 1ZBTA 3THOB 2RPCA 1QNTA 4GKKE 4B3TE 4J8ZA 2EMFA 1I94E 3AUZA 4JI5E 1YUIA 3C4TA 5DNYA 1NEIA 2EZ6A 2L2MA 2A25A 5TSEA 4B3RE 2EMBA 4MLVA 4B3ME 4X8WA 3IWDA 2RS6A 1XMQE 1YYWA 2YTQA 5T6JA 1RC7A 1AAYA 2VQFE 1EKZA 4B3SE 1YUJA 1N32E 2GLIA 3AV0A 4JYAE 1T4LB 1RMDA 2D9HA 3BGHA 1AH5A 3BBGA 2KOUA 4R03A 2E72A 1X5WA 3C6KA 4O5GA 3C4BA 4RHBB 5KL5A 4NHRA 1T39A 1TN9A 5BR8E 5IXMB 1STUA 3ADIA 3MHHC 4DR5E 2Q8UA 2CPNA 5A69A 2JPAA 3BF2A 3J80C 1IBME 4R2RA 5A6JA 3ADGA 4R8OA 2ADRA 4R2DA 2JXPA 3HPSA 5FLXC 2VRDA 1HNWE 1XMOE 2EP3A 4HEIA 2UXDE 2GPIA 2L3CA 4HTGA 4DV6E 2LUPB 4BC9A 1IMUA 1G2FC 1J5EE 4ZYEA 2EM7A 1X6HA 4R2EA 1A1FA 5IT9C 1WRJA 2EMWA 2YT4A 2M1SA 2I9IA 3DF6A 3HQ1A 1WHQA 2UU9E 2JOBA 2JOXA 3J7Yp 2ELYA 4JI4E 4LF9E 2L92A 2B7VA 3OTOE 2FGGA 2M7QA 3RMPA 2NABA 2LTSA 5KL3A 2FV4B 4DR4E 2DMIA 2L8TA 4F9BB 3VYYA 2G7HA 2EM5A 4DV1E 2JY9A 2JR1A 3ECRA 3C6MA 1NCSA 3EPJA 1YFHA 1A1HA 2LBSB 5ADZA 1BBGA 2DIXA 2CT1A 3JU0A 4I8OA 2HHHE 1JK2A 3VHTB 4DKKA 1WXRA 4BBYA 2JWOA 2F8BA 3EQ1A 1O0WA 2L2NA 4YHHE 4F9AB 2MC6A 4M0VA 3KZYA 1A1IA 1DGCA 1ZBQA 1GZ6A 2YZTA 5A6BA 4KWYA 2DLKA 1FKAE 4MLQA 4F54A 2LCEA 2I13A 3EPHA 4BHCA 2K7IA 2EOMA 1DQ3A 4LU9A 2EL6A 2ENHA 4DV5E 4DR2E 2ODRD 2YTPA 4BCAA 3J81C 2WBSA 2EM6A 2J7JA 2PRTA 2L33A 4BHBA 3FIGA 4LFCE 4R2SA 1A1KA 2EPAA 4F6NA 2WBTA 4WXCA 4X66E 4DUZE 4DR7E 2HC5A 4DV0E 1B69A 3KWRA 3EPLA 3JTZA 3L00A 1ZR9A 5CFFE 1X6FA 1J26A 1WHNA 4LFBE 2L6MA 2RQLA 2UUBE 4LF4E 1T4NA 2EOQA 2YRMA 2NA2A 2YSPA 2EOJA 2ENCA 2EPRA 2EE8A 5IV8B 2CTDA 1HR0E 3THNA 1UN6B 4JI2E 2KONA 2LRSA 3F6HA 2ODRC 1L4SA 2EOFA 4AQYE 1KJKA 2EJ4A 4DV2E 4JI3E 2EMXA 4X64E 2YTJA 2E5LE 4ZYHA 1IQOA 4LF7E 1N34E 2EPOA 2EMKA 2NUGA 2UXBE 5AE2A 1EH7A 2LO3A 4OX9E 1EH8A 2EQ0A 4JI7E 2L3JA 4R2PA 1MGTA 1QU6A 4LTYA 2MKDA 2EMLA 4NXNE 2DB2A 1A1LA 2EMGA 2N3HA 1N3GA 4WYQB 2JP9A 4O43A 4KHPE 4Q28A 4KZSA 4F6MA 1LLMC 3ADLA 2EORA 2EN1A 2MDGA 2JYAA 1ZAAC 4DV3E 4X9JA 2EMAA 3BIDA 5LL6R 2R1FA 2EPXA 2EN3A 2YU8A 4GKJE 2MDRA 2DRPA 2WCC3 2H36X 4DV4E 2EM9A 1Z1BA 2LVHA 4LF8E 3J7AG 1X6EA 2EOZA 5AC5A 1WJPA 1YYOA 2LJHA 1PJSA 4NXME 2LT7A 2UUAE 4DR6E 1DI2A 1PJTA 2EMZA 2YTDA 2YTNA 4JI1E 2VE7C 4NZVA 1ZU1A 1TF3A 5KL6A 4WSGA 1SR9A 5A6BD 2EM4A 4ZYGA 3H09A 2B3TB 2V8QB 3QG5C 2VQEE 2NUEA 3P1XA 2WBUA 1EH6A 4WX9A 2LTRA 2LUQA 3HXLA 5AASA 3M99B 2EOOA 4O24A 2CSHA 2DSYA 4ZYDA 2LMZA
chains in the Genus database with same CATH topology
1HR0E 3LLHA 3F6GA 5IT9C 2V88A 1X47A 2FTXB 4BMJA 4JI2E 2KONA 2LRSA 3F6HA 2ODRC 5LMUE 3T1YE 1XNQE 2V85A 4AQYE 2YT4A 2M1SA 4DV2E 3LMLA 4JI3E 2F4VE 3DF6A 3HQ1A 1UHZA 1WHQA 4X64E 4L5NC 2NUFA 2UU9E 1XNRE 1PKPA 2JOBA 2JOXA 3J7Yp 4JI4E 2E5LE 4TUGA 4LF9E 3ZOQB 2L92A 5IWAE 2B7VA 2WZOA 3VK6A 4BS9A 2FGGA 3OTOE 4LF7E 1N34E 4P7DA 1YZ9A 2RTXA 2M7QA 2B9DA 3RMPA 2LTSA 4P78A 2FV4B 2VF1A 2NUGA 4DR4E 2UXBE 5AE2A 3VYXA 2L8TA 4F9BB 3VYYA 4YY3E 4OX9E 2G7HA 4JI6E 1HNXE 4WFTA 4DV1E 2DMYA 2JY9A 4M2ZA 1IBKE 2B7TA 2MC5A 3ADJA 4DMIA 2JR1A 2EWLA 4JI7E 5AE1A 2LE2A 2N3GA 2L2KB 2L3JA 1X49A 1T4OA 1QU6A 2JVAA 4LTYA 4DR1E 3JAMC 4DR3E 2LBSB 1IBLE 1HNZE 5LMNE 1X48A 5ADZA 2DIXA 3JU0A 4K0KE 4LF6E 4I8OA 2K4VA 2M4IA 2HHHE 4X65E 2RSMA 4OOGC 4DKKA 1WXRA 2V86A 4NXNE 2DB2A 4BC7A 4BBYA 4X62E 4TUIA 3DJWA 3OMLA 1YYKA 1ZBTA 2JWOA 2N3HA 4GKKE 2F8BA 4WYQB 5F3WA 4B3TE 1FJGE 4KHPE 4Q28A 4J8ZA 1O0WA 1I94E 2L2NA 3HTXA 4YHHE 4F9AB 2MC6A 4KZSA 4M0VA 4BC9A 3AUZA 4JI5E 3K6QA 3C4TA 5DNYA 2V83A 1ZBQA 2EZ6A 2L2MA 2RS7A 1GZ6A 2YZTA 3ADLA 4B3RE 1FKAE 1RQ0A 1UILA 4B3ME 4X8WA 3IWDA 2RS6A 1XMQE 4LFAE 4DV7E 4DV3E 1YYWA 5LL6R 1N33E 4F54A 4M30A 2E1MA 5T6JA 1RC7A 4GKJE 2MDRA 1DQ3A 2VQFE 1EKZA 4B3SE 2H36X 4LU9A 4JI0E 4DV4E 4JV5E 2IHR1 4DV5E 4LF8E 1N32E 3J7AG 3AV0A 4DR2E 2ODRD 3IWCA 2ZM6E 1T4LB 4JYAE 4BCAA 5A2QC 3J81C 3IWBA 1GQEA 4WSPA 1YYOA 2LJHA 2KOUA 4R03A 4NXME 3MSWA 2L33A 3C4BA 2UUAE 4DR6E 3HPZA 1DI2A 4L8NA 4F9CB 4LF5E 3FIGA 2V89A 4LFCE 4JI1E 2VE7C 5BR8E 1STUA 3ADIA 2V87A 4X66E 4DUZE 4DR7E 4DV0E 4DR5E 3KWRA 2CPNA 1SR9A 3JTZA 2UUCE 2KHXA 3H09A 3J80C 1IBME 4DUYE 4JI8E 2B3TB 2V8QB 3ADGA 5CFFE 4R8OA 4GEQB 2VQEE 2NUEA 3P1XA 3HPSA 5FLXC 1WHNA 1J26A 4LFBE 2L6MA 2UUBE 4LF4E 2LTRA 2LUQA 1T4NA 3HXLA 1XMOE 1N36E 1HNWE 2UXCE 2NA2A 5AASA 4WPYA 3T1HE 5AE3A 2UXDE 2L3CA 4DV6E 2LUPB 2DSYA 1J5EE 2LMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8B A;  2EWL A; 
#chains in the Genus database with same CATH topology
 3F6G A;  2YTG A;  1BB8 A;  5LMU E;  2EM0 A;  2EPK X;  2V85 A;  2EQ3 A;  2YTO A;  3UK3 C;  1GTK A;  4IS1 C;  2F4V E;  2M9A A;  1UHZ A;  1XNR E;  4L5N C;  1PKP A;  4O4K A;  2EPU A;  4R2A A;  1YSA C;  5IWA E;  2DLQ A;  3VK6 A;  2EOE A;  1YZ9 A;  2RTX A;  3MHS C;  4IJD A;  2EPZ A;  2YPN A;  4P78 A;  2VF1 A;  5KL7 A;  2MKN A;  4YY3 E;  1UBD C;  4WFT A;  4M2Z A;  1IBK E;  2B7T A;  3ADJ A;  2EPC A;  2EOX A;  2LE2 A;  2L2K B;  2EL5 A;  1X49 A;  2JVA A;  2EOY A;  4WXD A;  4DR1 E;  1YPN A;  3JAM C;  2R76 A;  4DR3 E;  1HNZ E;  3KZZ A;  1X48 A;  2EOH A;  1G2D C;  4K0K E;  4LF6 E;  2M4I A;  2BB8 A;  4OOG C;  1YYK A;  2ELZ A;  4TUI A;  3DJW A;  3OML A;  2EM3 A;  5F3W A;  1FJG E;  3HTX A;  1BBO A;  3K6Q A;  5A6A A;  2EMH A;  2V83 A;  2RS7 A;  1PJQ A;  2EPM X;  2GHF A;  1RQ0 A;  1UIL A;  4LFA E;  4DV7 E;  1N33 E;  4M30 A;  2E1M A;  2EQ1 A;  2YSO A;  2EOI A;  2YWQ A;  1T38 A;  4JI0 E;  2N8X A;  4JV5 E;  2IHR 1;  2ZM6 E;  3IWC A;  2YTF A;  5A2Q C;  3IWB A;  1GQE A;  4WSP A;  1A1J A;  2HGH A;  3EPK A;  2EN8 A;  3MSW A;  2EN4 A;  4R2Q A;  3HPZ A;  2DGC A;  4L8N A;  4F9C B;  4LF5 E;  2V89 A;  4R2C A;  1KYQ A;  2V87 A;  1JK1 A;  2EMY A;  2UUC E;  2KHX A;  2ENA A;  4DUY E;  4JI8 E;  3TQM A;  4GEQ B;  1SFE A;  5LLQ A;  1TF6 A;  2YU5 A;  2EM2 A;  5KL4 A;  2EN7 A;  2EMC A;  1N36 E;  2EPP A;  2UXC E;  3T1H E;  4WPY A;  5AE3 A;  2EL4 A;  4GZN C;  3LLH A;  2EOS A;  4M9V C;  2YTI A;  2V88 A;  1X47 A;  2FTX B;  4BMJ A;  1X3C A;  2HJJ A;  5A6K A;  3T1Y E;  2RSI A;  1XNQ E;  4RH8 A;  3LML A;  1P47 A;  2YRH A;  2NUF A;  1IQS A;  4Q35 B;  2EN2 A;  2EPL X;  4TUG A;  5AC4 A;  3ZOQ B;  2WZO A;  2EM8 A;  4BS9 A;  1MEY C;  4P7D A;  4N4R B;  2B9D A;  1A1G A;  3VYX A;  4F2J C;  4JI6 E;  1HNX E;  2EPN A;  2DMY A;  2EMI A;  2MC5 A;  4DMI A;  5AE1 A;  2EWL A;  2N3G A;  2YRK A;  2BBG A;  2LJU A;  1T4O A;  1IBL E;  5LMN E;  2EN6 A;  1PDA A;  1F2I G;  2K4V A;  4FK5 C;  4X65 E;  2RSM A;  2V86 A;  5KL2 A;  4BC7 A;  4X62 E;  2YTE A;  2LV2 A;  1ZBT A;  3THO B;  2RPC A;  1QNT A;  4GKK E;  4B3T E;  4J8Z A;  2EMF A;  1I94 E;  3AUZ A;  4JI5 E;  1YUI A;  3C4T A;  5DNY A;  1NEI A;  2EZ6 A;  2L2M A;  2A25 A;  5TSE A;  4B3R E;  2EMB A;  4MLV A;  4B3M E;  4X8W A;  3IWD A;  2RS6 A;  1XMQ E;  1YYW A;  2YTQ A;  5T6J A;  1RC7 A;  1AAY A;  2VQF E;  1EKZ A;  4B3S E;  1YUJ A;  1N32 E;  2GLI A;  3AV0 A;  4JYA E;  1T4L B;  1RMD A;  2D9H A;  3BGH A;  1AH5 A;  3BBG A;  2KOU A;  4R03 A;  2E72 A;  1X5W A;  3C6K A;  4O5G A;  3C4B A;  4RHB B;  5KL5 A;  4NHR A;  1T39 A;  1TN9 A;  5BR8 E;  5IXM B;  1STU A;  3ADI A;  3MHH C;  4DR5 E;  2Q8U A;  2CPN A;  5A69 A;  2JPA A;  3BF2 A;  3J80 C;  1IBM E;  4R2R A;  5A6J A;  3ADG A;  4R8O A;  2ADR A;  4R2D A;  2JXP A;  3HPS A;  5FLX C;  2VRD A;  1HNW E;  1XMO E;  2EP3 A;  4HEI A;  2UXD E;  2GPI A;  2L3C A;  4HTG A;  4DV6 E;  2LUP B;  4BC9 A;  1IMU A;  1G2F C;  1J5E E;  4ZYE A;  2EM7 A;  1X6H A;  4R2E A;  1A1F A;  5IT9 C;  1WRJ A;  2EMW A;  2YT4 A;  2M1S A;  2I9I A;  3DF6 A;  3HQ1 A;  1WHQ A;  2UU9 E;  2JOB A;  2JOX A;  3J7Y p;  2ELY A;  4JI4 E;  4LF9 E;  2L92 A;  2B7V A;  3OTO E;  2FGG A;  2M7Q A;  3RMP A;  2NAB A;  2LTS A;  5KL3 A;  2FV4 B;  4DR4 E;  2DMI A;  2L8T A;  4F9B B;  3VYY A;  2G7H A;  2EM5 A;  4DV1 E;  2JY9 A;  2JR1 A;  3ECR A;  3C6M A;  1NCS A;  3EPJ A;  1YFH A;  1A1H A;  2LBS B;  5ADZ A;  1BBG A;  2DIX A;  2CT1 A;  3JU0 A;  4I8O A;  2HHH E;  1JK2 A;  3VHT B;  4DKK A;  1WXR A;  4BBY A;  2JWO A;  2F8B A;  3EQ1 A;  1O0W A;  2L2N A;  4YHH E;  4F9A B;  2MC6 A;  4M0V A;  3KZY A;  1A1I A;  1DGC A;  1ZBQ A;  1GZ6 A;  2YZT A;  5A6B A;  4KWY A;  2DLK A;  1FKA E;  4MLQ A;  4F54 A;  2LCE A;  2I13 A;  3EPH A;  4BHC A;  2K7I A;  2EOM A;  1DQ3 A;  4LU9 A;  2EL6 A;  2ENH A;  4DV5 E;  4DR2 E;  2ODR D;  2YTP A;  4BCA A;  3J81 C;  2WBS A;  2EM6 A;  2J7J A;  2PRT A;  2L33 A;  4BHB A;  3FIG A;  4LFC E;  4R2S A;  1A1K A;  2EPA A;  4F6N A;  2WBT A;  4WXC A;  4X66 E;  4DUZ E;  4DR7 E;  2HC5 A;  4DV0 E;  1B69 A;  3KWR A;  3EPL A;  3JTZ A;  3L00 A;  1ZR9 A;  5CFF E;  1X6F A;  1J26 A;  1WHN A;  4LFB E;  2L6M A;  2RQL A;  2UUB E;  4LF4 E;  1T4N A;  2EOQ A;  2YRM A;  2NA2 A;  2YSP A;  2EOJ A;  2ENC A;  2EPR A;  2EE8 A;  5IV8 B;  2CTD A;  1HR0 E;  3THN A;  1UN6 B;  4JI2 E;  2KON A;  2LRS A;  3F6H A;  2ODR C;  1L4S A;  2EOF A;  4AQY E;  1KJK A;  2EJ4 A;  4DV2 E;  4JI3 E;  2EMX A;  4X64 E;  2YTJ A;  2E5L E;  4ZYH A;  1IQO A;  4LF7 E;  1N34 E;  2EPO A;  2EMK A;  2NUG A;  2UXB E;  5AE2 A;  1EH7 A;  2LO3 A;  4OX9 E;  1EH8 A;  2EQ0 A;  4JI7 E;  2L3J A;  4R2P A;  1MGT A;  1QU6 A;  4LTY A;  2MKD A;  2EML A;  4NXN E;  2DB2 A;  1A1L A;  2EMG A;  2N3H A;  1N3G A;  4WYQ B;  2JP9 A;  4O43 A;  4KHP E;  4Q28 A;  4KZS A;  4F6M A;  1LLM C;  3ADL A;  2EOR A;  2EN1 A;  2MDG A;  2JYA A;  1ZAA C;  4DV3 E;  4X9J A;  2EMA A;  3BID A;  5LL6 R;  2R1F A;  2EPX A;  2EN3 A;  2YU8 A;  4GKJ E;  2MDR A;  2DRP A;  2WCC 3;  2H36 X;  4DV4 E;  2EM9 A;  1Z1B A;  2LVH A;  4LF8 E;  3J7A G;  1X6E A;  2EOZ A;  5AC5 A;  1WJP A;  1YYO A;  2LJH A;  1PJS A;  4NXM E;  2LT7 A;  2UUA E;  4DR6 E;  1DI2 A;  1PJT A;  2EMZ A;  2YTD A;  2YTN A;  4JI1 E;  2VE7 C;  4NZV A;  1ZU1 A;  1TF3 A;  5KL6 A;  4WSG A;  1SR9 A;  5A6B D;  2EM4 A;  4ZYG A;  3H09 A;  2B3T B;  2V8Q B;  3QG5 C;  2VQE E;  2NUE A;  3P1X A;  2WBU A;  1EH6 A;  4WX9 A;  2LTR A;  2LUQ A;  3HXL A;  5AAS A;  3M99 B;  2EOO A;  4O24 A;  2CSH A;  2DSY A;  4ZYD A;  2LMZ A; 
#chains in the Genus database with same CATH homology
 1HR0 E;  3LLH A;  3F6G A;  5IT9 C;  2V88 A;  1X47 A;  2FTX B;  4BMJ A;  4JI2 E;  2KON A;  2LRS A;  3F6H A;  2ODR C;  5LMU E;  3T1Y E;  1XNQ E;  2V85 A;  4AQY E;  2YT4 A;  2M1S A;  4DV2 E;  3LML A;  4JI3 E;  2F4V E;  3DF6 A;  3HQ1 A;  1UHZ A;  1WHQ A;  4X64 E;  4L5N C;  2NUF A;  2UU9 E;  1XNR E;  1PKP A;  2JOB A;  2JOX A;  3J7Y p;  4JI4 E;  2E5L E;  4TUG A;  4LF9 E;  3ZOQ B;  2L92 A;  5IWA E;  2B7V A;  2WZO A;  3VK6 A;  4BS9 A;  2FGG A;  3OTO E;  4LF7 E;  1N34 E;  4P7D A;  1YZ9 A;  2RTX A;  2M7Q A;  2B9D A;  3RMP A;  2LTS A;  4P78 A;  2FV4 B;  2VF1 A;  2NUG A;  4DR4 E;  2UXB E;  5AE2 A;  3VYX A;  2L8T A;  4F9B B;  3VYY A;  4YY3 E;  4OX9 E;  2G7H A;  4JI6 E;  1HNX E;  4WFT A;  4DV1 E;  2DMY A;  2JY9 A;  4M2Z A;  1IBK E;  2B7T A;  2MC5 A;  3ADJ A;  4DMI A;  2JR1 A;  2EWL A;  4JI7 E;  5AE1 A;  2LE2 A;  2N3G A;  2L2K B;  2L3J A;  1X49 A;  1T4O A;  1QU6 A;  2JVA A;  4LTY A;  4DR1 E;  3JAM C;  4DR3 E;  2LBS B;  1IBL E;  1HNZ E;  5LMN E;  1X48 A;  5ADZ A;  2DIX A;  3JU0 A;  4K0K E;  4LF6 E;  4I8O A;  2K4V A;  2M4I A;  2HHH E;  4X65 E;  2RSM A;  4OOG C;  4DKK A;  1WXR A;  2V86 A;  4NXN E;  2DB2 A;  4BC7 A;  4BBY A;  4X62 E;  4TUI A;  3DJW A;  3OML A;  1YYK A;  1ZBT A;  2JWO A;  2N3H A;  4GKK E;  2F8B A;  4WYQ B;  5F3W A;  4B3T E;  1FJG E;  4KHP E;  4Q28 A;  4J8Z A;  1O0W A;  1I94 E;  2L2N A;  3HTX A;  4YHH E;  4F9A B;  2MC6 A;  4KZS A;  4M0V A;  4BC9 A;  3AUZ A;  4JI5 E;  3K6Q A;  3C4T A;  5DNY A;  2V83 A;  1ZBQ A;  2EZ6 A;  2L2M A;  2RS7 A;  1GZ6 A;  2YZT A;  3ADL A;  4B3R E;  1FKA E;  1RQ0 A;  1UIL A;  4B3M E;  4X8W A;  3IWD A;  2RS6 A;  1XMQ E;  4LFA E;  4DV7 E;  4DV3 E;  1YYW A;  5LL6 R;  1N33 E;  4F54 A;  4M30 A;  2E1M A;  5T6J A;  1RC7 A;  4GKJ E;  2MDR A;  1DQ3 A;  2VQF E;  1EKZ A;  4B3S E;  2H36 X;  4LU9 A;  4JI0 E;  4DV4 E;  4JV5 E;  2IHR 1;  4DV5 E;  4LF8 E;  1N32 E;  3J7A G;  3AV0 A;  4DR2 E;  2ODR D;  3IWC A;  2ZM6 E;  1T4L B;  4JYA E;  4BCA A;  5A2Q C;  3J81 C;  3IWB A;  1GQE A;  4WSP A;  1YYO A;  2LJH A;  2KOU A;  4R03 A;  4NXM E;  3MSW A;  2L33 A;  3C4B A;  2UUA E;  4DR6 E;  3HPZ A;  1DI2 A;  4L8N A;  4F9C B;  4LF5 E;  3FIG A;  2V89 A;  4LFC E;  4JI1 E;  2VE7 C;  5BR8 E;  1STU A;  3ADI A;  2V87 A;  4X66 E;  4DUZ E;  4DR7 E;  4DV0 E;  4DR5 E;  3KWR A;  2CPN A;  1SR9 A;  3JTZ A;  2UUC E;  2KHX A;  3H09 A;  3J80 C;  1IBM E;  4DUY E;  4JI8 E;  2B3T B;  2V8Q B;  3ADG A;  5CFF E;  4R8O A;  4GEQ B;  2VQE E;  2NUE A;  3P1X A;  3HPS A;  5FLX C;  1WHN A;  1J26 A;  4LFB E;  2L6M A;  2UUB E;  4LF4 E;  2LTR A;  2LUQ A;  1T4N A;  3HXL A;  1XMO E;  1N36 E;  1HNW E;  2UXC E;  2NA2 A;  5AAS A;  4WPY A;  3T1H E;  5AE3 A;  2UXD E;  2L3C A;  4DV6 E;  2LUP B;  2DSY A;  1J5E E;  2LMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...