2F8BA

Nmr structure of the c-terminal domain (dimer) of hpv45 oncoprotein e7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
b'GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E7
molecule tags Oncoprotein, virus/viral protein
source organism Human papillomavirus type 45
publication title Solution structure of the partially folded high-risk human papilloma virus 45 oncoprotein E7.
pubmed doi rcsb
total genus 11
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.730 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2f8bA00
2EWLA 2F8BA
chains in the Genus database with same CATH superfamily
2EN8A 5KL4A 1BBOA 2MDGA 2JY9A 1HR0E 2EQ0A 2L92A 5KL3A 1I94E 4WYQB 1X6EA 2EM6A 5CFFE 2RSIA 2YTOA 1AAYA 4DV4E 2DLKA 4GKJE 3VYYA 2DLQA 2N3GA 2V87A 4KHPE 4BC7A 2WBSA 2NUFA 3LLHA 3ZOQB 1BB8A 4B3ME 4ZYHA 5AC4A 4DUYE 4DV3E 2HHHE 3ADIA 2JP9A 1HNZE 1YFHA 4X66E 2GHFA 2M9AA 4X8WA 3T1HE 1T38A 5AE3A 2DRPA 4YY3E 3EPHA 1A1IA 1ZAAC 1YPNA 1T4LB 2LJUA 4R2PA 5A6AA 2LTSA 1NEIA 1PJQA 2E5LE 2EOZA 4LFAE 2EOHA 2NUEA 4TUGA 1X6FA 5T6JA 2E1MA 1ZU1A 1N32E 2KHXA 3C4BA 4JI8E 2EMLA 2F8BA 2EOFA 5KL5A 1X5WA 4DR1E 1F2IG 2UUAE 3DF6A 4WFTA 4F54A 2L6MA 4O43A 2EMGA 4F9CB 1PJSA 4WSPA 2ODRD 1WHNA 2CPNA 2JR1A 2VQFE 2EOOA 1ZR9A 2Q8UA 1G2FC 3HPZA 4X9JA 1PKPA 1WHQA 3AV0A 1J26A 2EP3A 4R8OA 3F6GA 4WX9A 4LF7E 2YTPA 4JV5E 2LUPB 4O24A 4O5GA 2NA2A 3BGHA 3C6MA 4JI7E 2L2MA 5ADZA 4P78A 1EH6A 2EMWA 5A2QC 4X65E 1T39A 2VRDA 4F9BB 2EPCA 4ZYEA 2YTDA 2ENCA 2YZTA 3H09A 1MEYC 2EPUA 4LF8E 2ADRA 4LF5E 2YTGA 2A25A 2HC5A 4OX9E 2EOMA 4LFCE 4ZYGA 1DI2A 2ENHA 3BF2A 2WBUA 4R2RA 4F6NA 1EH7A 4I8OA 2UU9E 2EMBA 2PRTA 2V85A 4R2SA 4B3SE 1SFEA 3HPSA 2WZOA 4LF4E 2L33A 3THOB 2EPKX 2EMCA 2YTIA 1JK1A 5AC5A 2EMAA 3EPKA 4Q28A 3ECRA 4NZVA 2J7JA 2NUGA 1X49A 3UK3C 2D9HA 1N3GA 3IWBA 4GEQB 3LMLA 4BS9A 4NXNE 1IMUA 5FLXC 3KWRA 1TF3A 4F6MA 2EPNA 1QU6A 2EMHA 2M7QA 4X62E 4FK5C 2YPNA 3EPLA 2EN3A 2KOUA 2LCEA 3K6QA 2GLIA 1EH8A 3VYXA 1IQOA 2LBSB 2JOBA 1YYOA 2L8TA 2EM0A 2WBTA 1PJTA 4F2JC 1EKZA 4JI2E 2WCC3 3EPJA 4DV5E 2YTFA 3EQ1A 4X64E 4MLQA 5AASA 1N36E 4N4RB 3ADGA 2EMKA 4LFBE 1YYKA 2BB8A 2L2KB 1A1GA 5LMUE 3THNA 1G2DC 3KZYA 4M9VC 1O0WA 1JK2A 2EM3A 2EM7A 2DGCA 2FGGA 1UN6B 2B7TA 2L2NA 5KL2A 1KJKA 3BIDA 4M2ZA 2M4IA 5LLQA 2ENAA 2YTNA 4JI0E 2V8QB 3MSWA 1A1LA 4LF6E 2EZ6A 2L3JA 5LMNE 3T1YE 4BC9A 3MHSC 4KZSA 1XNQE 2JXPA 5IV8B 2RSMA 4KWYA 2EM9A 1KYQA 4JI5E 2YRMA 3DJWA 2I13A 1UHZA 1GZ6A 2EORA 2EE8A 4AQYE 1YYWA 4WPYA 2K4VA 5IT9C 5F3WA 4R2EA 5DNYA 4HEIA 1UBDC 1T4OA 2EPLX 3C6KA 2UUBE 2LJHA 3FIGA 4TUIA 3ADJA 4R2CA 2UXCE 4NHRA 1WRJA 1IBME 1RC7A 5IXMB 1X3CA 2FTXB 1YUJA 1DGCA 3JU0A 4DR5E 1UILA 1XNRE 4DKKA 2V89A 4F9AB 2EOQA 1QNTA 2EN4A 2YTQA 2DMYA 4JI1E 2FV4B 4M30A 2EPMX 1LLMC 2RQLA 2YSOA 4JI6E 3VK6A 2EPRA 5AE1A 3QG5C 2EMXA 2L3CA 1HNXE 2LV2A 1ZBQA 2B7VA 5BR8E 2MKDA 1YUIA 1YZ9A 4DR3E 2JYAA 3M99B 2DSYA 3OTOE 2LT7A 1IBLE 2LE2A 3JAMC 4WXDA 2DB2A 4LTYA 4JYAE 1L4SA 2ODRC 4B3TE 2VF1A 2EN6A 2YTEA 2H36X 4O4KA 2EPPA 2EPOA 1BBGA 1A1HA 4K0KE 2RS6A 4DV0E 1N33E 5IWAE 2EOJA 4R2AA 5A6KA 4GKKE 3TQMA 4RH8A 2CSHA 2EL4A 2EOYA 2YRKA 4WXCA 2CT1A 1Z1BA 4OOGC 2V86A 4P7DA 4B3RE 4BHBA 1FKAE 2EL5A 1YSAC 3VHTB 2LUQA 2EN2A 2KONA 5TSEA 2EPZA 2V83A 1A1KA 4L8NA 1IQSA 2HGHA 3MHHC 2K7IA 2EMZA 2E72A 5A6BD 4M0VA 2N3HA 3IWDA 2JPAA 4BMJA 2GPIA 2V88A 1RMDA 1DQ3A 4GZNC 2MKNA 4YHHE 2IHR1 2YT4A 4DUZE 2DIXA 3BBGA 4DR6E 2EM2A 2NABA 2EOIA 2RTXA 2B9DA 1J5EE 4BBYA 4J8ZA 3F6HA 2ELYA 4RHBB 2MC5A 3AUZA 4LU9A 5AE2A 4JI3E 2N8XA 2F4VE 3HXLA 1GTKA 3J7AG 2VE7C 2LTRA 4L5NC 4WSGA 2VQEE 1XMQE 2EOSA 4JI4E 2MDRA 4MLVA 2ZM6E 1AH5A 4DV1E 2JVAA 2EM5A 1P47A 1WJPA 2EPXA 2DMIA 3C4TA 4IS1C 2RS7A 1XMOE 2YTJA 1WXRA 1ZBTA 3HQ1A 4Q35B 1IBKE 3J80C 2I9IA 2ELZA 1T4NA 2UXBE 3HTXA 2MC6A 2EQ1A 1X47A 4R2DA 1FJGE 4BHCA 5KL7A 3ADLA 1TF6A 5A69A 2EN7A 2M1SA 2EMIA 4HTGA 4R2QA 2JOXA 2EOXA 1HNWE 2LRSA 3KZZA 4DV6E 4ZYDA 2EOEA 4NXME 2YU5A 4DV7E 2EWLA 4DR4E 1A1JA 2LMZA 2R1FA 1SR9A 3P1XA 3IWCA 3L00A 3JTZA 2EJ4A 2R76A 4DMIA 2EM8A 3RMPA 3OMLA 4R03A 2EQ3A 1RQ0A 2EMFA 4IJDA 2LO3A 5LL6R 1X48A 2B3TB 1STUA 1NCSA 3J81C 2BBGA 5KL6A 1MGTA 5A6BA 2LVHA 4DV2E 2G7HA 2RPCA 1B69A 2YU8A 1A1FA 5A6JA 4LF9E 1PDAA 2YSPA 2EN1A 4DR2E 2EMYA 1X6HA 2EM4A 2HJJA 2EL6A 1TN9A 2YWQA 4BCAA 4DR7E 3J7Yp 1GQEA 2EPAA 2JWOA 1N34E 2CTDA 2YRHA 2UXDE 2UUCE
chains in the Genus database with same CATH topology
1T4OA 1DI2A 4B3RE 4BBYA 2JY9A 4I8OA 1HR0E 2UU9E 4J8ZA 3F6HA 2UUBE 2LJHA 2MC5A 2L92A 3AUZA 3FIGA 4LU9A 5AE2A 4TUIA 4JI3E 2V85A 3ADJA 3HXLA 1I94E 4B3SE 3J7AG 2F4VE 2VE7C 2LTRA 4L5NC 3HPSA 4WYQB 2WZOA 5CFFE 2VQEE 1IBME 2L33A 4DV4E 1XMQE 2FTXB 1RC7A 4LF4E 4GKJE 3JU0A 4DR5E 1UILA 3VYYA 1XNRE 4JI4E 4DKKA 2N3GA 2V87A 2V89A 2MDRA 4F9AB 4KHPE 2ZM6E 4Q28A 4BC7A 4DV1E 2JVAA 2NUFA 2NUGA 3LLHA 3ZOQB 4B3ME 1X49A 2DMYA 4DUYE 4DV3E 2HHHE 3IWBA 4JI1E 4GEQB 3LMLA 2FV4B 4M30A 4BS9A 4NXNE 5FLXC 3KWRA 3ADIA 1HNZE 3C4TA 4JI6E 4X66E 3VK6A 2RS7A 1XMOE 5AE1A 1QU6A 2L3CA 3T1HE 4X8WA 5AE3A 1ZBTA 3HQ1A 1WXRA 1HNXE 1ZBQA 2B7VA 4YY3E 2M7QA 4X62E 1T4LB 1IBKE 3J80C 2KOUA 3K6QA 1T4NA 2UXBE 5BR8E 3HTXA 2MC6A 1YZ9A 2LTSA 3VYXA 4DR3E 2E5LE 2LBSB 4LFAE 2DSYA 1X47A 2JOBA 1YYOA 4TUGA 1FJGE 2NUEA 2L8TA 5T6JA 3OTOE 2E1MA 1N32E 1EKZA 3ADLA 4JI2E 1IBLE 2KHXA 2LE2A 3C4BA 3JAMC 4DV5E 4JYAE 2DB2A 4LTYA 4JI8E 2F8BA 2ODRC 4DR1E 2VF1A 2M1SA 4X64E 2UUAE 3DF6A 4WFTA 5AASA 1N36E 4B3TE 2JOXA 2H36X 3ADGA 1HNWE 4F54A 2LRSA 4DV6E 2UXCE 4LFBE 1J5EE 4NXME 4DV7E 2EWLA 1YYKA 4K0KE 2L6MA 4F9CB 2L2KB 2RS6A 4DR4E 5LMUE 4DV0E 4WSPA 5IWAE 2ODRD 1N33E 2LMZA 1O0WA 1WHNA 2CPNA 2JR1A 1SR9A 4GKKE 3P1XA 2VQFE 3IWCA 2FGGA 3JTZA 2B7TA 4DMIA 2L2NA 2V86A 3HPZA 3OMLA 4P7DA 4R03A 4OOGC 3RMPA 1PKPA 1RQ0A 2M4IA 1FKAE 1WHQA 4M2ZA 3AV0A 4JI0E 1J26A 5LL6R 1X48A 4R8OA 3F6GA 2B3TB 2V8QB 4LF7E 4JV5E 2LUQA 1STUA 3MSWA 4LF6E 2KONA 2EZ6A 3J81C 2L3JA 2LUPB 2NA2A 5LMNE 3T1YE 4JI7E 2L2MA 2V83A 4P78A 5ADZA 4L8NA 4DV2E 4BC9A 2G7HA 5A2QC 4X65E 4KZSA 1XNQE 4LF9E 4F9BB 4DR2E 2RSMA 2YZTA 4M0VA 4JI5E 3H09A 2N3HA 3IWDA 4BCAA 4BMJA 4DR7E 3J7Yp 4LF8E 1GQEA 2V88A 3DJWA 1DQ3A 4LF5E 1UHZA 2JWOA 4YHHE 1GZ6A 4AQYE 1N34E 2IHR1 1YYWA 2YT4A 4DUZE 2DIXA 4WPYA 2K4VA 4OX9E 5IT9C 2UXDE 5F3WA 4DR6E 5DNYA 4LFCE 2UUCE 2RTXA 2B9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWL A;  2F8B A; 
#chains in the Genus database with same CATH topology
 2EN8 A;  5KL4 A;  1BBO A;  2MDG A;  2JY9 A;  1HR0 E;  2EQ0 A;  2L92 A;  5KL3 A;  1I94 E;  4WYQ B;  1X6E A;  2EM6 A;  5CFF E;  2RSI A;  2YTO A;  1AAY A;  4DV4 E;  2DLK A;  4GKJ E;  3VYY A;  2DLQ A;  2N3G A;  2V87 A;  4KHP E;  4BC7 A;  2WBS A;  2NUF A;  3LLH A;  3ZOQ B;  1BB8 A;  4B3M E;  4ZYH A;  5AC4 A;  4DUY E;  4DV3 E;  2HHH E;  3ADI A;  2JP9 A;  1HNZ E;  1YFH A;  4X66 E;  2GHF A;  2M9A A;  4X8W A;  3T1H E;  1T38 A;  5AE3 A;  2DRP A;  4YY3 E;  3EPH A;  1A1I A;  1ZAA C;  1YPN A;  1T4L B;  2LJU A;  4R2P A;  5A6A A;  2LTS A;  1NEI A;  1PJQ A;  2E5L E;  2EOZ A;  4LFA E;  2EOH A;  2NUE A;  4TUG A;  1X6F A;  5T6J A;  2E1M A;  1ZU1 A;  1N32 E;  2KHX A;  3C4B A;  4JI8 E;  2EML A;  2F8B A;  2EOF A;  5KL5 A;  1X5W A;  4DR1 E;  1F2I G;  2UUA E;  3DF6 A;  4WFT A;  4F54 A;  2L6M A;  4O43 A;  2EMG A;  4F9C B;  1PJS A;  4WSP A;  2ODR D;  1WHN A;  2CPN A;  2JR1 A;  2VQF E;  2EOO A;  1ZR9 A;  2Q8U A;  1G2F C;  3HPZ A;  4X9J A;  1PKP A;  1WHQ A;  3AV0 A;  1J26 A;  2EP3 A;  4R8O A;  3F6G A;  4WX9 A;  4LF7 E;  2YTP A;  4JV5 E;  2LUP B;  4O24 A;  4O5G A;  2NA2 A;  3BGH A;  3C6M A;  4JI7 E;  2L2M A;  5ADZ A;  4P78 A;  1EH6 A;  2EMW A;  5A2Q C;  4X65 E;  1T39 A;  2VRD A;  4F9B B;  2EPC A;  4ZYE A;  2YTD A;  2ENC A;  2YZT A;  3H09 A;  1MEY C;  2EPU A;  4LF8 E;  2ADR A;  4LF5 E;  2YTG A;  2A25 A;  2HC5 A;  4OX9 E;  2EOM A;  4LFC E;  4ZYG A;  1DI2 A;  2ENH A;  3BF2 A;  2WBU A;  4R2R A;  4F6N A;  1EH7 A;  4I8O A;  2UU9 E;  2EMB A;  2PRT A;  2V85 A;  4R2S A;  4B3S E;  1SFE A;  3HPS A;  2WZO A;  4LF4 E;  2L33 A;  3THO B;  2EPK X;  2EMC A;  2YTI A;  1JK1 A;  5AC5 A;  2EMA A;  3EPK A;  4Q28 A;  3ECR A;  4NZV A;  2J7J A;  2NUG A;  1X49 A;  3UK3 C;  2D9H A;  1N3G A;  3IWB A;  4GEQ B;  3LML A;  4BS9 A;  4NXN E;  1IMU A;  5FLX C;  3KWR A;  1TF3 A;  4F6M A;  2EPN A;  1QU6 A;  2EMH A;  2M7Q A;  4X62 E;  4FK5 C;  2YPN A;  3EPL A;  2EN3 A;  2KOU A;  2LCE A;  3K6Q A;  2GLI A;  1EH8 A;  3VYX A;  1IQO A;  2LBS B;  2JOB A;  1YYO A;  2L8T A;  2EM0 A;  2WBT A;  1PJT A;  4F2J C;  1EKZ A;  4JI2 E;  2WCC 3;  3EPJ A;  4DV5 E;  2YTF A;  3EQ1 A;  4X64 E;  4MLQ A;  5AAS A;  1N36 E;  4N4R B;  3ADG A;  2EMK A;  4LFB E;  1YYK A;  2BB8 A;  2L2K B;  1A1G A;  5LMU E;  3THN A;  1G2D C;  3KZY A;  4M9V C;  1O0W A;  1JK2 A;  2EM3 A;  2EM7 A;  2DGC A;  2FGG A;  1UN6 B;  2B7T A;  2L2N A;  5KL2 A;  1KJK A;  3BID A;  4M2Z A;  2M4I A;  5LLQ A;  2ENA A;  2YTN A;  4JI0 E;  2V8Q B;  3MSW A;  1A1L A;  4LF6 E;  2EZ6 A;  2L3J A;  5LMN E;  3T1Y E;  4BC9 A;  3MHS C;  4KZS A;  1XNQ E;  2JXP A;  5IV8 B;  2RSM A;  4KWY A;  2EM9 A;  1KYQ A;  4JI5 E;  2YRM A;  3DJW A;  2I13 A;  1UHZ A;  1GZ6 A;  2EOR A;  2EE8 A;  4AQY E;  1YYW A;  4WPY A;  2K4V A;  5IT9 C;  5F3W A;  4R2E A;  5DNY A;  4HEI A;  1UBD C;  1T4O A;  2EPL X;  3C6K A;  2UUB E;  2LJH A;  3FIG A;  4TUI A;  3ADJ A;  4R2C A;  2UXC E;  4NHR A;  1WRJ A;  1IBM E;  1RC7 A;  5IXM B;  1X3C A;  2FTX B;  1YUJ A;  1DGC A;  3JU0 A;  4DR5 E;  1UIL A;  1XNR E;  4DKK A;  2V89 A;  4F9A B;  2EOQ A;  1QNT A;  2EN4 A;  2YTQ A;  2DMY A;  4JI1 E;  2FV4 B;  4M30 A;  2EPM X;  1LLM C;  2RQL A;  2YSO A;  4JI6 E;  3VK6 A;  2EPR A;  5AE1 A;  3QG5 C;  2EMX A;  2L3C A;  1HNX E;  2LV2 A;  1ZBQ A;  2B7V A;  5BR8 E;  2MKD A;  1YUI A;  1YZ9 A;  4DR3 E;  2JYA A;  3M99 B;  2DSY A;  3OTO E;  2LT7 A;  1IBL E;  2LE2 A;  3JAM C;  4WXD A;  2DB2 A;  4LTY A;  4JYA E;  1L4S A;  2ODR C;  4B3T E;  2VF1 A;  2EN6 A;  2YTE A;  2H36 X;  4O4K A;  2EPP A;  2EPO A;  1BBG A;  1A1H A;  4K0K E;  2RS6 A;  4DV0 E;  1N33 E;  5IWA E;  2EOJ A;  4R2A A;  5A6K A;  4GKK E;  3TQM A;  4RH8 A;  2CSH A;  2EL4 A;  2EOY A;  2YRK A;  4WXC A;  2CT1 A;  1Z1B A;  4OOG C;  2V86 A;  4P7D A;  4B3R E;  4BHB A;  1FKA E;  2EL5 A;  1YSA C;  3VHT B;  2LUQ A;  2EN2 A;  2KON A;  5TSE A;  2EPZ A;  2V83 A;  1A1K A;  4L8N A;  1IQS A;  2HGH A;  3MHH C;  2K7I A;  2EMZ A;  2E72 A;  5A6B D;  4M0V A;  2N3H A;  3IWD A;  2JPA A;  4BMJ A;  2GPI A;  2V88 A;  1RMD A;  1DQ3 A;  4GZN C;  2MKN A;  4YHH E;  2IHR 1;  2YT4 A;  4DUZ E;  2DIX A;  3BBG A;  4DR6 E;  2EM2 A;  2NAB A;  2EOI A;  2RTX A;  2B9D A;  1J5E E;  4BBY A;  4J8Z A;  3F6H A;  2ELY A;  4RHB B;  2MC5 A;  3AUZ A;  4LU9 A;  5AE2 A;  4JI3 E;  2N8X A;  2F4V E;  3HXL A;  1GTK A;  3J7A G;  2VE7 C;  2LTR A;  4L5N C;  4WSG A;  2VQE E;  1XMQ E;  2EOS A;  4JI4 E;  2MDR A;  4MLV A;  2ZM6 E;  1AH5 A;  4DV1 E;  2JVA A;  2EM5 A;  1P47 A;  1WJP A;  2EPX A;  2DMI A;  3C4T A;  4IS1 C;  2RS7 A;  1XMO E;  2YTJ A;  1WXR A;  1ZBT A;  3HQ1 A;  4Q35 B;  1IBK E;  3J80 C;  2I9I A;  2ELZ A;  1T4N A;  2UXB E;  3HTX A;  2MC6 A;  2EQ1 A;  1X47 A;  4R2D A;  1FJG E;  4BHC A;  5KL7 A;  3ADL A;  1TF6 A;  5A69 A;  2EN7 A;  2M1S A;  2EMI A;  4HTG A;  4R2Q A;  2JOX A;  2EOX A;  1HNW E;  2LRS A;  3KZZ A;  4DV6 E;  4ZYD A;  2EOE A;  4NXM E;  2YU5 A;  4DV7 E;  2EWL A;  4DR4 E;  1A1J A;  2LMZ A;  2R1F A;  1SR9 A;  3P1X A;  3IWC A;  3L00 A;  3JTZ A;  2EJ4 A;  2R76 A;  4DMI A;  2EM8 A;  3RMP A;  3OML A;  4R03 A;  2EQ3 A;  1RQ0 A;  2EMF A;  4IJD A;  2LO3 A;  5LL6 R;  1X48 A;  2B3T B;  1STU A;  1NCS A;  3J81 C;  2BBG A;  5KL6 A;  1MGT A;  5A6B A;  2LVH A;  4DV2 E;  2G7H A;  2RPC A;  1B69 A;  2YU8 A;  1A1F A;  5A6J A;  4LF9 E;  1PDA A;  2YSP A;  2EN1 A;  4DR2 E;  2EMY A;  1X6H A;  2EM4 A;  2HJJ A;  2EL6 A;  1TN9 A;  2YWQ A;  4BCA A;  4DR7 E;  3J7Y p;  1GQE A;  2EPA A;  2JWO A;  1N34 E;  2CTD A;  2YRH A;  2UXD E;  2UUC E; 
#chains in the Genus database with same CATH homology
 1T4O A;  1DI2 A;  4B3R E;  4BBY A;  2JY9 A;  4I8O A;  1HR0 E;  2UU9 E;  4J8Z A;  3F6H A;  2UUB E;  2LJH A;  2MC5 A;  2L92 A;  3AUZ A;  3FIG A;  4LU9 A;  5AE2 A;  4TUI A;  4JI3 E;  2V85 A;  3ADJ A;  3HXL A;  1I94 E;  4B3S E;  3J7A G;  2F4V E;  2VE7 C;  2LTR A;  4L5N C;  3HPS A;  4WYQ B;  2WZO A;  5CFF E;  2VQE E;  1IBM E;  2L33 A;  4DV4 E;  1XMQ E;  2FTX B;  1RC7 A;  4LF4 E;  4GKJ E;  3JU0 A;  4DR5 E;  1UIL A;  3VYY A;  1XNR E;  4JI4 E;  4DKK A;  2N3G A;  2V87 A;  2V89 A;  2MDR A;  4F9A B;  4KHP E;  2ZM6 E;  4Q28 A;  4BC7 A;  4DV1 E;  2JVA A;  2NUF A;  2NUG A;  3LLH A;  3ZOQ B;  4B3M E;  1X49 A;  2DMY A;  4DUY E;  4DV3 E;  2HHH E;  3IWB A;  4JI1 E;  4GEQ B;  3LML A;  2FV4 B;  4M30 A;  4BS9 A;  4NXN E;  5FLX C;  3KWR A;  3ADI A;  1HNZ E;  3C4T A;  4JI6 E;  4X66 E;  3VK6 A;  2RS7 A;  1XMO E;  5AE1 A;  1QU6 A;  2L3C A;  3T1H E;  4X8W A;  5AE3 A;  1ZBT A;  3HQ1 A;  1WXR A;  1HNX E;  1ZBQ A;  2B7V A;  4YY3 E;  2M7Q A;  4X62 E;  1T4L B;  1IBK E;  3J80 C;  2KOU A;  3K6Q A;  1T4N A;  2UXB E;  5BR8 E;  3HTX A;  2MC6 A;  1YZ9 A;  2LTS A;  3VYX A;  4DR3 E;  2E5L E;  2LBS B;  4LFA E;  2DSY A;  1X47 A;  2JOB A;  1YYO A;  4TUG A;  1FJG E;  2NUE A;  2L8T A;  5T6J A;  3OTO E;  2E1M A;  1N32 E;  1EKZ A;  3ADL A;  4JI2 E;  1IBL E;  2KHX A;  2LE2 A;  3C4B A;  3JAM C;  4DV5 E;  4JYA E;  2DB2 A;  4LTY A;  4JI8 E;  2F8B A;  2ODR C;  4DR1 E;  2VF1 A;  2M1S A;  4X64 E;  2UUA E;  3DF6 A;  4WFT A;  5AAS A;  1N36 E;  4B3T E;  2JOX A;  2H36 X;  3ADG A;  1HNW E;  4F54 A;  2LRS A;  4DV6 E;  2UXC E;  4LFB E;  1J5E E;  4NXM E;  4DV7 E;  2EWL A;  1YYK A;  4K0K E;  2L6M A;  4F9C B;  2L2K B;  2RS6 A;  4DR4 E;  5LMU E;  4DV0 E;  4WSP A;  5IWA E;  2ODR D;  1N33 E;  2LMZ A;  1O0W A;  1WHN A;  2CPN A;  2JR1 A;  1SR9 A;  4GKK E;  3P1X A;  2VQF E;  3IWC A;  2FGG A;  3JTZ A;  2B7T A;  4DMI A;  2L2N A;  2V86 A;  3HPZ A;  3OML A;  4P7D A;  4R03 A;  4OOG C;  3RMP A;  1PKP A;  1RQ0 A;  2M4I A;  1FKA E;  1WHQ A;  4M2Z A;  3AV0 A;  4JI0 E;  1J26 A;  5LL6 R;  1X48 A;  4R8O A;  3F6G A;  2B3T B;  2V8Q B;  4LF7 E;  4JV5 E;  2LUQ A;  1STU A;  3MSW A;  4LF6 E;  2KON A;  2EZ6 A;  3J81 C;  2L3J A;  2LUP B;  2NA2 A;  5LMN E;  3T1Y E;  4JI7 E;  2L2M A;  2V83 A;  4P78 A;  5ADZ A;  4L8N A;  4DV2 E;  4BC9 A;  2G7H A;  5A2Q C;  4X65 E;  4KZS A;  1XNQ E;  4LF9 E;  4F9B B;  4DR2 E;  2RSM A;  2YZT A;  4M0V A;  4JI5 E;  3H09 A;  2N3H A;  3IWD A;  4BCA A;  4BMJ A;  4DR7 E;  3J7Y p;  4LF8 E;  1GQE A;  2V88 A;  3DJW A;  1DQ3 A;  4LF5 E;  1UHZ A;  2JWO A;  4YHH E;  1GZ6 A;  4AQY E;  1N34 E;  2IHR 1;  1YYW A;  2YT4 A;  4DUZ E;  2DIX A;  4WPY A;  2K4V A;  4OX9 E;  5IT9 C;  2UXD E;  5F3W A;  4DR6 E;  5DNY A;  4LFC E;  2UUC E;  2RTX A;  2B9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...