2F8BA

Nmr structure of the c-terminal domain (dimer) of hpv45 oncoprotein e7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein, virus/viral protein
molecule keywords Protein E7
publication title Solution structure of the partially folded high-risk human papilloma virus 45 oncoprotein E7.
pubmed doi rcsb
source organism Human papillomavirus type 45
total genus 11
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.730 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2f8bA00
2EWLA 2F8BA
chains in the Genus database with same CATH superfamily
2EPNA 2HGHA 5AC5A 3VHTB 2YRKA 2JP9A 1GTKA 3DJWA 5KL5A 1HNZE 3KZZA 2EOZA 2HHHE 2EM3A 2EPCA 2EL5A 5A6KA 4JI6E 2EMZA 2L2MA 1UN6B 3TQMA 4R03A 2EMFA 2WZOA 4BHCA 2EN6A 4JI4E 4R2SA 2EPRA 3H09A 2JVAA 2JOXA 2EM7A 4X64E 2DLKA 2VQFE 2HJJA 1N34E 2EMKA 1JK2A 5AE1A 2DIXA 1JK1A 1J5EE 2A25A 2GPIA 4LF5E 3C4BA 3ADJA 2ELYA 2EQ0A 1DGCA 4NXME 1TN9A 1Z1BA 1N36E 4F9CB 2ADRA 2KONA 1BBGA 5F3WA 1AAYA 1T4OA 2M4IA 3F6HA 4DV7E 2JPAA 2MDRA 3VK6A 4LF8E 2NUFA 2EWLA 3BBGA 4TUGA 2V8QB 3DF6A 4ZYHA 2EPXA 2N3HA 2ENAA 2YTDA 1WHQA 2EPOA 4DR1E 4GKKE 4F6MA 2CT1A 2EPKX 1KYQA 2K7IA 2EM8A 3JAMC 1B69A 3EPHA 1YPNA 4R2QA 3THNA 2JYAA 1PKPA 1GQEA 2MC6A 2LUPB 4J8ZA 1NCSA 4GEQB 4TUIA 2EN3A 2L3CA 1A1FA 3OTOE 2EP3A 2ENHA 3IWCA 2LE2A 5KL4A 1YUIA 4B3ME 4DV3E 4YHHE 5A6AA 4BHBA 3BF2A 2EOQA 2YTPA 1HR0E 1F2IG 4KZSA 1A1IA 2FV4B 4BMJA 2YTJA 2L92A 3ADIA 4JI5E 4LFCE 3HTXA 1PJQA 1TF6A 4Q35B 2RS6A 1X47A 2NUEA 4M9VC 2E1MA 4DUZE 1HNXE 2EPAA 1SR9A 3L00A 1EH7A 4GZNC 1IBME 2DSYA 2LUQA 2EMIA 1FKAE 1NEIA 1IQOA 4BBYA 2DGCA 4GKJE 2EQ3A 2MDGA 2LMZA 4L8NA 2V86A 5IWAE 5T6JA 4R2AA 3MHHC 3OMLA 1GZ6A 2RSIA 2E72A 5KL6A 2CSHA 2B9DA 4IS1C 3KWRA 2WBTA 4JI7E 4B3TE 5BR8E 2F8BA 2LCEA 2YSPA 2YWQA 4ZYDA 4LF6E 2ZM6E 1YYOA 2M9AA 3VYXA 2ODRD 1WJPA 2DMIA 2EPLX 1X3CA 4R2PA 2JR1A 1WHNA 4JYAE 5A69A 2LV2A 4DR3E 2E5LE 1DI2A 1L4SA 2LTSA 3LLHA 4WPYA 3EPLA 4X65E 1UBDC 5LMNE 3KZYA 4NZVA 2LBSB 1MGTA 3VYYA 4OOGC 1O0WA 2YTQA 1BBOA 4HTGA 3J81C 1A1GA 1QNTA 2YU5A 2UXDE 4R2EA 2LT7A 3P1XA 1X6HA 3M99B 2L3JA 2EOHA 4N4RB 4HEIA 2MC5A 3J80C 4RHBB 4DR2E 2CPNA 2M1SA 1IQSA 4DV1E 2RSMA 5FLXC 4DR6E 2LJHA 1RQ0A 4R8OA 1ZU1A 2YRHA 1YYKA 1HNWE 3MSWA 4LFAE 2NUGA 2EMXA 2YSOA 3MHSC 3EPKA 2EPMX 4F54A 5A6BA 2VRDA 4KWYA 2EOSA 4JI2E 4LTYA 2WBSA 2MKNA 1STUA 2EOEA 1LLMC 4P7DA 2GLIA 4YY3E 1SFEA 2JWOA 2RQLA 2LTRA 3C6KA 5AC4A 2FTXB 1XMQE 1BB8A 1MEYC 3HQ1A 4JI8E 1G2DC 4R2DA 4F6NA 1G2FC 1YUJA 4O24A 2VE7C 3HPZA 1UHZA 4DR4E 4I8OA 4BS9A 2V83A 5A6JA 2EQ1A 4JI1E 2FGGA 2L2NA 1RC7A 4M0VA 1X5WA 2EN4A 1ZBTA 2EM0A 3BIDA 2I13A 4DV2E 4RH8A 2EL6A 1ZBQA 4F9AB 4AQYE 2EMYA 4FK5C 3T1HE 1WXRA 4LU9A 3JTZA 5CFFE 2DRPA 1IBLE 2RTXA 4L5NC 3J7Yp 2EMGA 2H36X 3IWDA 2EN1A 4JV5E 1T4LB 1A1JA 1T4NA 2DLQA 1N3GA 2KHXA 5IV8B 1P47A 1TF3A 3BGHA 5LLQA 4F9BB 2EJ4A 2HC5A 1X6EA 1PJSA 1KJKA 4BC9A 4DUYE 4X62E 2PRTA 2YRMA 2EM9A 1EKZA 1EH8A 2LO3A 2EOIA 4WFTA 2WBUA 4WXCA 1PJTA 2EM6A 2WCC3 1A1LA 4X8WA 2K4VA 4MLQA 2EMHA 2GHFA 5DNYA 5KL7A 2D9HA 2L6MA 2EN8A 2G7HA 2JXPA 5IT9C 2LVHA 2EE8A 2B7TA 4LFBE 3F6GA 4Q28A 5AE2A 2RS7A 2N3GA 2YTFA 3K6QA 4O4KA 3ZOQB 1YYWA 3ECRA 3J7AG 4ZYGA 2JOBA 1PDAA 4DMIA 5AE3A 2NA2A 2V89A 2M7QA 3AUZA 2R76A 2EMBA 1XMOE 4MLVA 4JI3E 1QU6A 3C6MA 4OX9E 4LF7E 1XNQE 1DQ3A 4BCAA 4ZYEA 3UK3C 1YSAC 2EN7A 2YTEA 2R1FA 2VF1A 1N32E 4P78A 2DB2A 2EORA 2V88A 1YZ9A 2EL4A 2KOUA 4WSGA 2YU8A 4WSPA 2EMCA 2LRSA 3EQ1A 1EH6A 2EPUA 2YTGA 4DKKA 4M2ZA 2UXBE 2F4VE 2EOYA 4DR5E 1ZAAC 4R2CA 2N8XA 2EOJA 2EZ6A 4B3SE 3AV0A 3EPJA 2J7JA 4LF4E 2DMYA 1X48A 2EMWA 1FJGE 2EOMA 1IBKE 1XNRE 1A1HA 1AH5A 2YTIA 3C4TA 2LJUA 3ADGA 4WXDA 4X9JA 1X6FA 2EPPA 5ADZA 4DV5E 2YT4A 4JI0E 4X66E 2CTDA 4DV0E 5A6BD 2EM2A 2BBGA 4NHRA 2YZTA 3QG5C 2EM5A 1ZR9A 2ENCA 2UU9E 1T39A 1IMUA 2EPZA 1WRJA 1J26A 1YFHA 2EN2A 2L8TA 3HPSA 2NABA 2YTNA 1UILA 2MKDA 5KL2A 1I94E 2YTOA 4KHPE 4K0KE 5AASA 4O43A 4DV4E 2I9IA 2L2KB 4BC7A 2VQEE 4LF9E 1RMDA 2EMLA 2BB8A 4IJDA 4B3RE 2IHR1 5A2QC 2JY9A 5LL6R 2RPCA 2EOOA 1X49A 2ELZA 2V87A 5TSEA 2V85A 4NXNE 2B3TB 2EM4A 2UXCE 5KL3A 4R2RA 3THOB 2ODRC 3JU0A 1N33E 5IXMB 2EOFA 3RMPA 2EOXA 3ADLA 4DV6E 4DR7E 3HXLA 2UUAE 1T38A 3T1YE 2UUBE 4WYQB 1A1KA 2Q8UA 2YPNA 2B7VA 2L33A 4O5GA 4F2JC 3FIGA 4M30A 5LMUE 3IWBA 3LMLA 2UUCE 2EMAA 4WX9A
chains in the Genus database with same CATH topology
4JI8E 4JI3E 1QU6A 4OX9E 4LF7E 2RS6A 1X47A 2NUEA 2E1MA 3DJWA 4DUZE 1DQ3A 1HNXE 1HNZE 1XNQE 4BCAA 1SR9A 2HHHE 2VE7C 3HPZA 1UHZA 1IBME 4DR4E 2VF1A 4I8OA 2DSYA 2LUQA 2V83A 2L2MA 4BS9A 1FKAE 4JI1E 4JI6E 2FGGA 2L2NA 4P78A 4R03A 4BBYA 1RC7A 2DB2A 2V88A 4M0VA 1N32E 2LMZA 4B3RE 1YZ9A 4GKJE 4L8NA 2KOUA 1ZBTA 2WZOA 4WSPA 2LRSA 2V86A 5IWAE 5T6JA 4DV2E 3OMLA 4JI4E 1GZ6A 3H09A 4DKKA 4M2ZA 1ZBQA 2UXBE 4F9AB 4AQYE 2B9DA 3T1HE 2JVAA 1WXRA 2JOXA 4LU9A 3JTZA 2F4VE 5CFFE 4DR5E 4X64E 3KWRA 4JI7E 4B3TE 4B3SE 2EZ6A 3AV0A 2VQFE 5BR8E 2F8BA 2RTXA 4L5NC 1IBLE 4LF4E 3J7Yp 2DMYA 1X48A 2H36X 1N34E 4LF6E 2ZM6E 3IWDA 1IBKE 1FJGE 1XNRE 4JV5E 1T4LB 1YYOA 3C4TA 3VYXA 3ADGA 2ODRD 5AE1A 2DIXA 1T4NA 5ADZA 4DV5E 1J5EE 2YT4A 4JI0E 4LF5E 4X66E 2JR1A 1WHNA 2KHXA 4JYAE 3C4BA 3ADJA 4DV0E 4DR3E 4NXME 2E5LE 2YZTA 1DI2A 1N36E 4F9CB 2KONA 4F9BB 2LTSA 3LLHA 4WPYA 4X65E 5F3WA 5LMNE 2UU9E 2UUBE 1T4OA 2M4IA 2LBSB 3F6HA 4BC9A 4DUYE 3VYYA 4OOGC 4DV7E 2MDRA 3VK6A 4X62E 4LF8E 1O0WA 2EWLA 2NUFA 1J26A 4TUGA 2V8QB 3DF6A 1EKZA 3J81C 4LFCE 2N3HA 4WFTA 2L8TA 2UXDE 1WHQA 3HPSA 1UILA 3P1XA 1I94E 4KHPE 2L3JA 4DR1E 4GKKE 4K0KE 5AASA 4X8WA 2K4VA 4DV4E 5DNYA 2L2KB 2MC5A 3J80C 4BC7A 3JAMC 2VQEE 4LF9E 4DR2E 2L6MA 2CPNA 4JI5E 2M1SA 2MC6A 1GQEA 1PKPA 2G7HA 4DV1E 2LUPB 2RSMA 4J8ZA 5IT9C 2IHR1 5FLXC 4DR6E 5A2QC 4GEQB 2JY9A 2LJHA 5LL6R 4TUIA 2L3CA 1RQ0A 4R8OA 2B7TA 1YYKA 1HNWE 1X49A 3OTOE 4LFBE 3F6GA 2V87A 3IWCA 3MSWA 4Q28A 2RS7A 2LE2A 2V85A 5AE2A 2B3TB 2N3GA 4LFAE 4NXNE 2NUGA 2UXCE 4B3ME 4DV3E 4F54A 3K6QA 2ODRC 4YHHE 3JU0A 4JI2E 4LTYA 3ZOQB 3RMPA 1N33E 3ADLA 1YYWA 1STUA 4DV6E 3T1YE 4DR7E 3HXLA 1HR0E 4P7DA 2UUAE 3J7AG 2JOBA 4DMIA 4KZSA 4WYQB 4YY3E 2JWOA 2NA2A 2V89A 5AE3A 2M7QA 2B7VA 2L33A 2FV4B 2LTRA 4BMJA 3FIGA 4M30A 2L92A 3AUZA 2FTXB 3IWBA 5LMUE 3ADIA 1XMQE 3LMLA 2UUCE 3HTXA 3HQ1A 1XMOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWL A;  2F8B A; 
#chains in the Genus database with same CATH topology
 2EPN A;  2HGH A;  5AC5 A;  3VHT B;  2YRK A;  2JP9 A;  1GTK A;  3DJW A;  5KL5 A;  1HNZ E;  3KZZ A;  2EOZ A;  2HHH E;  2EM3 A;  2EPC A;  2EL5 A;  5A6K A;  4JI6 E;  2EMZ A;  2L2M A;  1UN6 B;  3TQM A;  4R03 A;  2EMF A;  2WZO A;  4BHC A;  2EN6 A;  4JI4 E;  4R2S A;  2EPR A;  3H09 A;  2JVA A;  2JOX A;  2EM7 A;  4X64 E;  2DLK A;  2VQF E;  2HJJ A;  1N34 E;  2EMK A;  1JK2 A;  5AE1 A;  2DIX A;  1JK1 A;  1J5E E;  2A25 A;  2GPI A;  4LF5 E;  3C4B A;  3ADJ A;  2ELY A;  2EQ0 A;  1DGC A;  4NXM E;  1TN9 A;  1Z1B A;  1N36 E;  4F9C B;  2ADR A;  2KON A;  1BBG A;  5F3W A;  1AAY A;  1T4O A;  2M4I A;  3F6H A;  4DV7 E;  2JPA A;  2MDR A;  3VK6 A;  4LF8 E;  2NUF A;  2EWL A;  3BBG A;  4TUG A;  2V8Q B;  3DF6 A;  4ZYH A;  2EPX A;  2N3H A;  2ENA A;  2YTD A;  1WHQ A;  2EPO A;  4DR1 E;  4GKK E;  4F6M A;  2CT1 A;  2EPK X;  1KYQ A;  2K7I A;  2EM8 A;  3JAM C;  1B69 A;  3EPH A;  1YPN A;  4R2Q A;  3THN A;  2JYA A;  1PKP A;  1GQE A;  2MC6 A;  2LUP B;  4J8Z A;  1NCS A;  4GEQ B;  4TUI A;  2EN3 A;  2L3C A;  1A1F A;  3OTO E;  2EP3 A;  2ENH A;  3IWC A;  2LE2 A;  5KL4 A;  1YUI A;  4B3M E;  4DV3 E;  4YHH E;  5A6A A;  4BHB A;  3BF2 A;  2EOQ A;  2YTP A;  1HR0 E;  1F2I G;  4KZS A;  1A1I A;  2FV4 B;  4BMJ A;  2YTJ A;  2L92 A;  3ADI A;  4JI5 E;  4LFC E;  3HTX A;  1PJQ A;  1TF6 A;  4Q35 B;  2RS6 A;  1X47 A;  2NUE A;  4M9V C;  2E1M A;  4DUZ E;  1HNX E;  2EPA A;  1SR9 A;  3L00 A;  1EH7 A;  4GZN C;  1IBM E;  2DSY A;  2LUQ A;  2EMI A;  1FKA E;  1NEI A;  1IQO A;  4BBY A;  2DGC A;  4GKJ E;  2EQ3 A;  2MDG A;  2LMZ A;  4L8N A;  2V86 A;  5IWA E;  5T6J A;  4R2A A;  3MHH C;  3OML A;  1GZ6 A;  2RSI A;  2E72 A;  5KL6 A;  2CSH A;  2B9D A;  4IS1 C;  3KWR A;  2WBT A;  4JI7 E;  4B3T E;  5BR8 E;  2F8B A;  2LCE A;  2YSP A;  2YWQ A;  4ZYD A;  4LF6 E;  2ZM6 E;  1YYO A;  2M9A A;  3VYX A;  2ODR D;  1WJP A;  2DMI A;  2EPL X;  1X3C A;  4R2P A;  2JR1 A;  1WHN A;  4JYA E;  5A69 A;  2LV2 A;  4DR3 E;  2E5L E;  1DI2 A;  1L4S A;  2LTS A;  3LLH A;  4WPY A;  3EPL A;  4X65 E;  1UBD C;  5LMN E;  3KZY A;  4NZV A;  2LBS B;  1MGT A;  3VYY A;  4OOG C;  1O0W A;  2YTQ A;  1BBO A;  4HTG A;  3J81 C;  1A1G A;  1QNT A;  2YU5 A;  2UXD E;  4R2E A;  2LT7 A;  3P1X A;  1X6H A;  3M99 B;  2L3J A;  2EOH A;  4N4R B;  4HEI A;  2MC5 A;  3J80 C;  4RHB B;  4DR2 E;  2CPN A;  2M1S A;  1IQS A;  4DV1 E;  2RSM A;  5FLX C;  4DR6 E;  2LJH A;  1RQ0 A;  4R8O A;  1ZU1 A;  2YRH A;  1YYK A;  1HNW E;  3MSW A;  4LFA E;  2NUG A;  2EMX A;  2YSO A;  3MHS C;  3EPK A;  2EPM X;  4F54 A;  5A6B A;  2VRD A;  4KWY A;  2EOS A;  4JI2 E;  4LTY A;  2WBS A;  2MKN A;  1STU A;  2EOE A;  1LLM C;  4P7D A;  2GLI A;  4YY3 E;  1SFE A;  2JWO A;  2RQL A;  2LTR A;  3C6K A;  5AC4 A;  2FTX B;  1XMQ E;  1BB8 A;  1MEY C;  3HQ1 A;  4JI8 E;  1G2D C;  4R2D A;  4F6N A;  1G2F C;  1YUJ A;  4O24 A;  2VE7 C;  3HPZ A;  1UHZ A;  4DR4 E;  4I8O A;  4BS9 A;  2V83 A;  5A6J A;  2EQ1 A;  4JI1 E;  2FGG A;  2L2N A;  1RC7 A;  4M0V A;  1X5W A;  2EN4 A;  1ZBT A;  2EM0 A;  3BID A;  2I13 A;  4DV2 E;  4RH8 A;  2EL6 A;  1ZBQ A;  4F9A B;  4AQY E;  2EMY A;  4FK5 C;  3T1H E;  1WXR A;  4LU9 A;  3JTZ A;  5CFF E;  2DRP A;  1IBL E;  2RTX A;  4L5N C;  3J7Y p;  2EMG A;  2H36 X;  3IWD A;  2EN1 A;  4JV5 E;  1T4L B;  1A1J A;  1T4N A;  2DLQ A;  1N3G A;  2KHX A;  5IV8 B;  1P47 A;  1TF3 A;  3BGH A;  5LLQ A;  4F9B B;  2EJ4 A;  2HC5 A;  1X6E A;  1PJS A;  1KJK A;  4BC9 A;  4DUY E;  4X62 E;  2PRT A;  2YRM A;  2EM9 A;  1EKZ A;  1EH8 A;  2LO3 A;  2EOI A;  4WFT A;  2WBU A;  4WXC A;  1PJT A;  2EM6 A;  2WCC 3;  1A1L A;  4X8W A;  2K4V A;  4MLQ A;  2EMH A;  2GHF A;  5DNY A;  5KL7 A;  2D9H A;  2L6M A;  2EN8 A;  2G7H A;  2JXP A;  5IT9 C;  2LVH A;  2EE8 A;  2B7T A;  4LFB E;  3F6G A;  4Q28 A;  5AE2 A;  2RS7 A;  2N3G A;  2YTF A;  3K6Q A;  4O4K A;  3ZOQ B;  1YYW A;  3ECR A;  3J7A G;  4ZYG A;  2JOB A;  1PDA A;  4DMI A;  5AE3 A;  2NA2 A;  2V89 A;  2M7Q A;  3AUZ A;  2R76 A;  2EMB A;  1XMO E;  4MLV A;  4JI3 E;  1QU6 A;  3C6M A;  4OX9 E;  4LF7 E;  1XNQ E;  1DQ3 A;  4BCA A;  4ZYE A;  3UK3 C;  1YSA C;  2EN7 A;  2YTE A;  2R1F A;  2VF1 A;  1N32 E;  4P78 A;  2DB2 A;  2EOR A;  2V88 A;  1YZ9 A;  2EL4 A;  2KOU A;  4WSG A;  2YU8 A;  4WSP A;  2EMC A;  2LRS A;  3EQ1 A;  1EH6 A;  2EPU A;  2YTG A;  4DKK A;  4M2Z A;  2UXB E;  2F4V E;  2EOY A;  4DR5 E;  1ZAA C;  4R2C A;  2N8X A;  2EOJ A;  2EZ6 A;  4B3S E;  3AV0 A;  3EPJ A;  2J7J A;  4LF4 E;  2DMY A;  1X48 A;  2EMW A;  1FJG E;  2EOM A;  1IBK E;  1XNR E;  1A1H A;  1AH5 A;  2YTI A;  3C4T A;  2LJU A;  3ADG A;  4WXD A;  4X9J A;  1X6F A;  2EPP A;  5ADZ A;  4DV5 E;  2YT4 A;  4JI0 E;  4X66 E;  2CTD A;  4DV0 E;  5A6B D;  2EM2 A;  2BBG A;  4NHR A;  2YZT A;  3QG5 C;  2EM5 A;  1ZR9 A;  2ENC A;  2UU9 E;  1T39 A;  1IMU A;  2EPZ A;  1WRJ A;  1J26 A;  1YFH A;  2EN2 A;  2L8T A;  3HPS A;  2NAB A;  2YTN A;  1UIL A;  2MKD A;  5KL2 A;  1I94 E;  2YTO A;  4KHP E;  4K0K E;  5AAS A;  4O43 A;  4DV4 E;  2I9I A;  2L2K B;  4BC7 A;  2VQE E;  4LF9 E;  1RMD A;  2EML A;  2BB8 A;  4IJD A;  4B3R E;  2IHR 1;  5A2Q C;  2JY9 A;  5LL6 R;  2RPC A;  2EOO A;  1X49 A;  2ELZ A;  2V87 A;  5TSE A;  2V85 A;  4NXN E;  2B3T B;  2EM4 A;  2UXC E;  5KL3 A;  4R2R A;  3THO B;  2ODR C;  3JU0 A;  1N33 E;  5IXM B;  2EOF A;  3RMP A;  2EOX A;  3ADL A;  4DV6 E;  4DR7 E;  3HXL A;  2UUA E;  1T38 A;  3T1Y E;  2UUB E;  4WYQ B;  1A1K A;  2Q8U A;  2YPN A;  2B7V A;  2L33 A;  4O5G A;  4F2J C;  3FIG A;  4M30 A;  5LMU E;  3IWB A;  3LML A;  2UUC E;  2EMA A;  4WX9 A; 
#chains in the Genus database with same CATH homology
 4JI8 E;  4JI3 E;  1QU6 A;  4OX9 E;  4LF7 E;  2RS6 A;  1X47 A;  2NUE A;  2E1M A;  3DJW A;  4DUZ E;  1DQ3 A;  1HNX E;  1HNZ E;  1XNQ E;  4BCA A;  1SR9 A;  2HHH E;  2VE7 C;  3HPZ A;  1UHZ A;  1IBM E;  4DR4 E;  2VF1 A;  4I8O A;  2DSY A;  2LUQ A;  2V83 A;  2L2M A;  4BS9 A;  1FKA E;  4JI1 E;  4JI6 E;  2FGG A;  2L2N A;  4P78 A;  4R03 A;  4BBY A;  1RC7 A;  2DB2 A;  2V88 A;  4M0V A;  1N32 E;  2LMZ A;  4B3R E;  1YZ9 A;  4GKJ E;  4L8N A;  2KOU A;  1ZBT A;  2WZO A;  4WSP A;  2LRS A;  2V86 A;  5IWA E;  5T6J A;  4DV2 E;  3OML A;  4JI4 E;  1GZ6 A;  3H09 A;  4DKK A;  4M2Z A;  1ZBQ A;  2UXB E;  4F9A B;  4AQY E;  2B9D A;  3T1H E;  2JVA A;  1WXR A;  2JOX A;  4LU9 A;  3JTZ A;  2F4V E;  5CFF E;  4DR5 E;  4X64 E;  3KWR A;  4JI7 E;  4B3T E;  4B3S E;  2EZ6 A;  3AV0 A;  2VQF E;  5BR8 E;  2F8B A;  2RTX A;  4L5N C;  1IBL E;  4LF4 E;  3J7Y p;  2DMY A;  1X48 A;  2H36 X;  1N34 E;  4LF6 E;  2ZM6 E;  3IWD A;  1IBK E;  1FJG E;  1XNR E;  4JV5 E;  1T4L B;  1YYO A;  3C4T A;  3VYX A;  3ADG A;  2ODR D;  5AE1 A;  2DIX A;  1T4N A;  5ADZ A;  4DV5 E;  1J5E E;  2YT4 A;  4JI0 E;  4LF5 E;  4X66 E;  2JR1 A;  1WHN A;  2KHX A;  4JYA E;  3C4B A;  3ADJ A;  4DV0 E;  4DR3 E;  4NXM E;  2E5L E;  2YZT A;  1DI2 A;  1N36 E;  4F9C B;  2KON A;  4F9B B;  2LTS A;  3LLH A;  4WPY A;  4X65 E;  5F3W A;  5LMN E;  2UU9 E;  2UUB E;  1T4O A;  2M4I A;  2LBS B;  3F6H A;  4BC9 A;  4DUY E;  3VYY A;  4OOG C;  4DV7 E;  2MDR A;  3VK6 A;  4X62 E;  4LF8 E;  1O0W A;  2EWL A;  2NUF A;  1J26 A;  4TUG A;  2V8Q B;  3DF6 A;  1EKZ A;  3J81 C;  4LFC E;  2N3H A;  4WFT A;  2L8T A;  2UXD E;  1WHQ A;  3HPS A;  1UIL A;  3P1X A;  1I94 E;  4KHP E;  2L3J A;  4DR1 E;  4GKK E;  4K0K E;  5AAS A;  4X8W A;  2K4V A;  4DV4 E;  5DNY A;  2L2K B;  2MC5 A;  3J80 C;  4BC7 A;  3JAM C;  2VQE E;  4LF9 E;  4DR2 E;  2L6M A;  2CPN A;  4JI5 E;  2M1S A;  2MC6 A;  1GQE A;  1PKP A;  2G7H A;  4DV1 E;  2LUP B;  2RSM A;  4J8Z A;  5IT9 C;  2IHR 1;  5FLX C;  4DR6 E;  5A2Q C;  4GEQ B;  2JY9 A;  2LJH A;  5LL6 R;  4TUI A;  2L3C A;  1RQ0 A;  4R8O A;  2B7T A;  1YYK A;  1HNW E;  1X49 A;  3OTO E;  4LFB E;  3F6G A;  2V87 A;  3IWC A;  3MSW A;  4Q28 A;  2RS7 A;  2LE2 A;  2V85 A;  5AE2 A;  2B3T B;  2N3G A;  4LFA E;  4NXN E;  2NUG A;  2UXC E;  4B3M E;  4DV3 E;  4F54 A;  3K6Q A;  2ODR C;  4YHH E;  3JU0 A;  4JI2 E;  4LTY A;  3ZOQ B;  3RMP A;  1N33 E;  3ADL A;  1YYW A;  1STU A;  4DV6 E;  3T1Y E;  4DR7 E;  3HXL A;  1HR0 E;  4P7D A;  2UUA E;  3J7A G;  2JOB A;  4DMI A;  4KZS A;  4WYQ B;  4YY3 E;  2JWO A;  2NA2 A;  2V89 A;  5AE3 A;  2M7Q A;  2B7V A;  2L33 A;  2FV4 B;  2LTR A;  4BMJ A;  3FIG A;  4M30 A;  2L92 A;  3AUZ A;  2FTX B;  3IWB A;  5LMU E;  3ADI A;  1XMQ E;  3LML A;  2UUC E;  3HTX A;  3HQ1 A;  1XMO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...