2F8BA

Nmr structure of the c-terminal domain (dimer) of hpv45 oncoprotein e7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the partially folded high-risk human papilloma virus 45 oncoprotein E7.
pubmed doi rcsb
source organism Human papillomavirus type 45
molecule tags Oncoprotein, virus/viral protein
molecule keywords Protein E7
total genus 11
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.730 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2f8bA00
2F8BA 2EWLA
chains in the Genus database with same CATH superfamily
1IBME 1XMQE 2EMWA 4R2CA 4B3SE 2ELZA 2EOOA 1T4NA 2YRMA 4DUYE 3KZYA 3J7Yp 4R2SA 4B3TE 2UXDE 2YTNA 4L8NA 2EL4A 3DF6A 2LVHA 5T6JA 2DRPA 4OOGC 4LFCE 2VQFE 4JI0E 5AE3A 2FTXB 2YTOA 1A1LA 2JOXA 5AE2A 5AASA 4LF5E 2EPLX 1WHNA 2EPMX 2H36X 2PRTA 4LF8E 2EM6A 2M1SA 3AUZA 3EQ1A 2KOUA 2EPZA 2LBSB 1WXRA 4WSPA 2MKNA 1YYOA 1BBOA 3P1XA 5DNYA 2G7HA 4LF6E 2GHFA 1XMOE 2EOIA 1RC7A 2WBTA 2EM3A 1YSAC 1YYWA 1UILA 4N4RB 4Q35B 2YTFA 2N8XA 4M30A 4DUZE 4DV1E 4BC7A 2RS6A 3BBGA 4X62E 2UUAE 1L4SA 4DV0E 2EL6A 1PJSA 4B3ME 2LTSA 2L33A 1FKAE 2UUBE 4M0VA 2EPXA 2EM0A 1X6FA 3ADJA 1F2IG 2NUFA 2LCEA 2EOMA 2EMCA 1P47A 1RMDA 3J81C 1A1IA 2DLQA 1N36E 2VRDA 2BBGA 2E1MA 1IMUA 3EPHA 2EN8A 4LF9E 3C6MA 4P7DA 2JPAA 1T39A 1BB8A 1WHQA 4JI2E 2MKDA 2YTPA 2EWLA 1PKPA 1IBKE 1NEIA 1X5WA 2YTJA 3KZZA 4R2EA 4DV5E 3JAMC 2DB2A 1J26A 1RQ0A 4NZVA 2DSYA 2HC5A 4BBYA 3ADLA 1NCSA 2ZM6E 5KL3A 2JVAA 2EN2A 2CSHA 3F6HA 2EOXA 1JK2A 2L92A 2V89A 2EOYA 1ZBQA 1AAYA 1DGCA 2EZ6A 1UN6B 4IS1C 1QU6A 4OX9E 2EN7A 2V83A 1PJTA 5A69A 3UK3C 5FLXC 2ELYA 1WJPA 4MLQA 3C4BA 4I8OA 5F3WA 1TF6A 1A1KA 3HXLA 4DV3E 4F9CB 2YU5A 2UU9E 4DMIA 3MSWA 2EM9A 1B69A 3VYXA 4X64E 2EORA 1O0WA 2JXPA 2D9HA 3LLHA 1J5EE 2YT4A 4DR1E 5IT9C 1N32E 2FGGA 1IQSA 2UUCE 2EMGA 5A6BD 1ZBTA 4WSGA 4HEIA 1X6EA 5IXMB 3JU0A 2EMLA 4AQYE 3ADIA 2RSMA 4JI5E 1UBDC 3AV0A 3IWCA 4WXCA 1T4LB 4ZYGA 4DV2E 4BC9A 5ADZA 4R2DA 3EPKA 4MLVA 3BIDA 4K0KE 4JV5E 2V8QB 2LTRA 4LTYA 2DGCA 2EOHA 4M2ZA 2RS7A 2NA2A 2L8TA 2EN1A 2EMAA 2M9AA 4O4KA 2YSPA 2EMZA 1EH7A 4IJDA 3RMPA 4LF7E 1YZ9A 4F6MA 2EM2A 2EOZA 2N3HA 1ZAAC 2LMZA 4NXME 2NUEA 4KZSA 4WFTA 2EL5A 2EQ3A 2I9IA 2JY9A 3ADGA 3OMLA 4B3RE 5BR8E 1YFHA 2MC6A 4JI8E 4DR4E 4LF4E 4GKJE 1YUIA 1A1GA 4JI7E 2EOSA 2EPUA 2YTIA 4GZNC 2EPOA 3HQ1A 5IV8B 1ZR9A 3VK6A 4BHBA 4DV7E 4YY3E 1HR0E 2KONA 3F6GA 2LJHA 1WRJA 1X48A 1N34E 1FJGE 2LV2A 2HGHA 1T4OA 4X66E 2K4VA 1X6HA 3TQMA 1A1HA 2F8BA 5A2QC 2GLIA 2EN4A 2YTEA 4ZYDA 4R2AA 1HNWE 2L2NA 4ZYEA 2RQLA 4O24A 4X9JA 4DR2E 2EMXA 2LUQA 2IHR1 3OTOE 4BHCA 1GQEA 4KHPE 1X47A 1JK1A 1EH8A 2EPAA 3IWBA 4YHHE 3HPZA 2EM4A 2EPNA 4WX9A 2NABA 5A6BA 1G2DC 2JR1A 4BMJA 5KL5A 2GPIA 2EMBA 2HHHE 1MGTA 2EMIA 4KWYA 1GTKA 1Z1BA 1LLMC 2ENCA 2WCC3 1A1FA 3HTXA 2YRKA 1KJKA 2EPRA 3VHTB 2KHXA 2EM8A 5LL6R 1YPNA 2B9DA 2E72A 3FIGA 4R03A 4DKKA 5AC4A 2V85A 5KL4A 2VE7C 2WBUA 2LJUA 3T1YE 5KL7A 4R2RA 2MDRA 4NXNE 2R1FA 2NUGA 2N3GA 1ZU1A 2DLKA 1SR9A 2CPNA 2F4VE 3J7AG 2EPKX 2CTDA 2WZOA 1T38A 2EPCA 4F9AB 3JTZA 2MDGA 4ZYHA 3THNA 2EMFA 2L6MA 5CFFE 3K6QA 4R2PA 2HJJA 2RPCA 2UXCE 2V87A 4FK5C 2EN3A 4F54A 5KL6A 3H09A 4NHRA 5IWAE 3THOB 2RTXA 2VF1A 2YTGA 3ECRA 2EMKA 4BCAA 1UHZA 1IBLE 2L3CA 3KWRA 2L2KB 2EMHA 2L3JA 3C6KA 2EQ0A 2MC5A 2JOBA 2YPNA 4O43A 4DR6E 4DV6E 5KL2A 2WBSA 1G2FC 5TSEA 1XNQE 2EN6A 2LT7A 2DIXA 2EOEA 1GZ6A 3HPSA 1TN9A 2Q8UA 1TF3A 2VQEE 3QG5C 5AC5A 1PJQA 1EH6A 5LMUE 2J7JA 5A6KA 4WYQB 1X49A 1A1JA 2JYAA 5AE1A 2EMYA 3IWDA 2YTDA 4HTGA 2L2MA 4DR3E 2LO3A 5A6JA 5LMNE 4TUGA 4GKKE 2ADRA 2LRSA 2ENAA 3LMLA 2EP3A 1AH5A 1IQOA 4R2QA 3VYYA 4RH8A 4R8OA 2B3TB 4JYAE 2JP9A 4F6NA 1YYKA 4O5GA 3J80C 4J8ZA 4L5NC 1YUJA 2EPPA 1HNZE 4M9VC 2LE2A 2B7TA 4GEQB 4JI4E 1MEYC 4JI1E 2ODRD 2YZTA 5LLQA 4P78A 2E5LE 1EKZA 2V88A 1I94E 2A25A 4JI3E 4DR7E 3EPLA 2FV4B 4F2JC 4F9BB 3ZOQB 3M99B 2RSIA 1N3GA 1X3CA 2LUPB 3BF2A 2EJ4A 4X65E 2B7VA 2EQ1A 2I13A 2EM5A 2EOQA 2CT1A 2EE8A 4JI6E 2DMYA 4X8WA 3L00A 2DMIA 3MHHC 4Q28A 1DQ3A 1KYQA 4LFAE 2YU8A 2M7QA 1SFEA 2EOJA 2YTQA 4LFBE 1BBGA 2BB8A 2YWQA 4BS9A 3EPJA 4DR5E 5A6AA 4RHBB 1HNXE 1XNRE 3BGHA 2R76A 3DJWA 1N33E 1STUA 2EOFA 2ENHA 2YRHA 4DV4E 3C4TA 2ODRC 4WXDA 3T1HE 1PDAA 2UXBE 2JWOA 3MHSC 2YSOA 1QNTA 4TUIA 4WPYA 2EM7A 1DI2A 2K7IA 4LU9A 2M4IA 2V86A
chains in the Genus database with same CATH topology
1IBME 4DR2E 1XMQE 3F6HA 2L92A 2LUQA 2IHR1 3OTOE 2V89A 2EZ6A 1ZBQA 5LMUE 4B3SE 1GQEA 4KHPE 4WYQB 1QU6A 1X49A 1X47A 3IWBA 4OX9E 4YHHE 5AE1A 1T4NA 3IWDA 3HPZA 4DUYE 2V83A 3J7Yp 5FLXC 2L2MA 4DR3E 4B3TE 2UXDE 5LMNE 4L8NA 4TUGA 4GKKE 3C4BA 2JR1A 2LRSA 3DF6A 4I8OA 5T6JA 4BMJA 5F3WA 4OOGC 4LFCE 2VQFE 4JI0E 3LMLA 5AE3A 3HXLA 2FTXB 4DV3E 4F9CB 2HHHE 2UU9E 2JOXA 4DMIA 3VYYA 3HTXA 4R8OA 3MSWA 2B3TB 4JYAE 1YYKA 5AE2A 3VYXA 5AASA 3J80C 4LF5E 4J8ZA 4X64E 4L5NC 1WHNA 1O0WA 2KHXA 1HNZE 2H36X 5LL6R 2B9DA 4LF8E 3LLHA 3FIGA 4R03A 2LE2A 2M1SA 2V85A 4DKKA 2YT4A 4DR1E 5IT9C 3AUZA 1J5EE 2B7TA 2FGGA 2KOUA 2VE7C 1N32E 4GEQB 4JI4E 3ADIA 2LBSB 4JI1E 2ODRD 2UUCE 2YZTA 1WXRA 1ZBTA 4P78A 4WSPA 2E5LE 1YYOA 1EKZA 3T1YE 4AQYE 3JU0A 4NXNE 3P1XA 2MDRA 2RSMA 5DNYA 2NUGA 2N3GA 2G7HA 2V88A 1I94E 4JI5E 4LF6E 3AV0A 3IWCA 4JI3E 1XMOE 4DR7E 2FV4B 1SR9A 1T4LB 2CPNA 1RC7A 4F9BB 4DV2E 3ZOQB 4BC9A 5ADZA 2F4VE 3J7AG 2WZOA 4K0KE 1YYWA 4JV5E 2V8QB 2LTRA 1UILA 4LTYA 2LUPB 4M2ZA 2RS7A 2NA2A 2L8TA 4F9AB 4M30A 3JTZA 4DUZE 4DV1E 4X65E 4BC7A 2RS6A 4LU9A 4X62E 2B7VA 3RMPA 2UUAE 4LF7E 1YZ9A 2L6MA 4DV0E 2N3HA 5CFFE 2LMZA 4NXME 4B3ME 4KZSA 2NUEA 4JI6E 2DMYA 4WFTA 4X8WA 3ADGA 3K6QA 2JY9A 2LTSA 3OMLA 2L33A 4Q28A 1DQ3A 4LFAE 4B3RE 1FKAE 2UUBE 5BR8E 2UXCE 4M0VA 2V87A 2MC6A 4JI8E 4DR4E 4LF4E 3ADJA 2M7QA 4F54A 4GKJE 4LFBE 3H09A 2NUFA 5IWAE 4JI7E 2RTXA 4BS9A 2VF1A 4DR5E 3J81C 1N36E 4BCAA 2E1MA 3HQ1A 1HNXE 1UHZA 1IBLE 2L3CA 3KWRA 4P7DA 3VK6A 4DV7E 4LF9E 1XNRE 2L2KB 4YY3E 1HR0E 2KONA 3DJWA 3F6GA 2L3JA 1N33E 1STUA 1WHQA 2LJHA 4JI2E 1X48A 2EWLA 1N34E 1PKPA 1IBKE 1FJGE 2MC5A 2JOBA 4DV4E 1T4OA 3C4TA 2ODRC 4X66E 4DR6E 2K4VA 4DV6E 4DV5E 3JAMC 3T1HE 2DB2A 1XNQE 1J26A 2DIXA 1RQ0A 2DSYA 2F8BA 2JWOA 5A2QC 4BBYA 2UXBE 1GZ6A 3HPSA 4WPYA 4TUIA 3ADLA 1DI2A 2ZM6E 2JVAA 1HNWE 2L2NA 2VQEE 2M4IA 2V86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8B A;  2EWL A; 
#chains in the Genus database with same CATH topology
 1IBM E;  1XMQ E;  2EMW A;  4R2C A;  4B3S E;  2ELZ A;  2EOO A;  1T4N A;  2YRM A;  4DUY E;  3KZY A;  3J7Y p;  4R2S A;  4B3T E;  2UXD E;  2YTN A;  4L8N A;  2EL4 A;  3DF6 A;  2LVH A;  5T6J A;  2DRP A;  4OOG C;  4LFC E;  2VQF E;  4JI0 E;  5AE3 A;  2FTX B;  2YTO A;  1A1L A;  2JOX A;  5AE2 A;  5AAS A;  4LF5 E;  2EPL X;  1WHN A;  2EPM X;  2H36 X;  2PRT A;  4LF8 E;  2EM6 A;  2M1S A;  3AUZ A;  3EQ1 A;  2KOU A;  2EPZ A;  2LBS B;  1WXR A;  4WSP A;  2MKN A;  1YYO A;  1BBO A;  3P1X A;  5DNY A;  2G7H A;  4LF6 E;  2GHF A;  1XMO E;  2EOI A;  1RC7 A;  2WBT A;  2EM3 A;  1YSA C;  1YYW A;  1UIL A;  4N4R B;  4Q35 B;  2YTF A;  2N8X A;  4M30 A;  4DUZ E;  4DV1 E;  4BC7 A;  2RS6 A;  3BBG A;  4X62 E;  2UUA E;  1L4S A;  4DV0 E;  2EL6 A;  1PJS A;  4B3M E;  2LTS A;  2L33 A;  1FKA E;  2UUB E;  4M0V A;  2EPX A;  2EM0 A;  1X6F A;  3ADJ A;  1F2I G;  2NUF A;  2LCE A;  2EOM A;  2EMC A;  1P47 A;  1RMD A;  3J81 C;  1A1I A;  2DLQ A;  1N36 E;  2VRD A;  2BBG A;  2E1M A;  1IMU A;  3EPH A;  2EN8 A;  4LF9 E;  3C6M A;  4P7D A;  2JPA A;  1T39 A;  1BB8 A;  1WHQ A;  4JI2 E;  2MKD A;  2YTP A;  2EWL A;  1PKP A;  1IBK E;  1NEI A;  1X5W A;  2YTJ A;  3KZZ A;  4R2E A;  4DV5 E;  3JAM C;  2DB2 A;  1J26 A;  1RQ0 A;  4NZV A;  2DSY A;  2HC5 A;  4BBY A;  3ADL A;  1NCS A;  2ZM6 E;  5KL3 A;  2JVA A;  2EN2 A;  2CSH A;  3F6H A;  2EOX A;  1JK2 A;  2L92 A;  2V89 A;  2EOY A;  1ZBQ A;  1AAY A;  1DGC A;  2EZ6 A;  1UN6 B;  4IS1 C;  1QU6 A;  4OX9 E;  2EN7 A;  2V83 A;  1PJT A;  5A69 A;  3UK3 C;  5FLX C;  2ELY A;  1WJP A;  4MLQ A;  3C4B A;  4I8O A;  5F3W A;  1TF6 A;  1A1K A;  3HXL A;  4DV3 E;  4F9C B;  2YU5 A;  2UU9 E;  4DMI A;  3MSW A;  2EM9 A;  1B69 A;  3VYX A;  4X64 E;  2EOR A;  1O0W A;  2JXP A;  2D9H A;  3LLH A;  1J5E E;  2YT4 A;  4DR1 E;  5IT9 C;  1N32 E;  2FGG A;  1IQS A;  2UUC E;  2EMG A;  5A6B D;  1ZBT A;  4WSG A;  4HEI A;  1X6E A;  5IXM B;  3JU0 A;  2EML A;  4AQY E;  3ADI A;  2RSM A;  4JI5 E;  1UBD C;  3AV0 A;  3IWC A;  4WXC A;  1T4L B;  4ZYG A;  4DV2 E;  4BC9 A;  5ADZ A;  4R2D A;  3EPK A;  4MLV A;  3BID A;  4K0K E;  4JV5 E;  2V8Q B;  2LTR A;  4LTY A;  2DGC A;  2EOH A;  4M2Z A;  2RS7 A;  2NA2 A;  2L8T A;  2EN1 A;  2EMA A;  2M9A A;  4O4K A;  2YSP A;  2EMZ A;  1EH7 A;  4IJD A;  3RMP A;  4LF7 E;  1YZ9 A;  4F6M A;  2EM2 A;  2EOZ A;  2N3H A;  1ZAA C;  2LMZ A;  4NXM E;  2NUE A;  4KZS A;  4WFT A;  2EL5 A;  2EQ3 A;  2I9I A;  2JY9 A;  3ADG A;  3OML A;  4B3R E;  5BR8 E;  1YFH A;  2MC6 A;  4JI8 E;  4DR4 E;  4LF4 E;  4GKJ E;  1YUI A;  1A1G A;  4JI7 E;  2EOS A;  2EPU A;  2YTI A;  4GZN C;  2EPO A;  3HQ1 A;  5IV8 B;  1ZR9 A;  3VK6 A;  4BHB A;  4DV7 E;  4YY3 E;  1HR0 E;  2KON A;  3F6G A;  2LJH A;  1WRJ A;  1X48 A;  1N34 E;  1FJG E;  2LV2 A;  2HGH A;  1T4O A;  4X66 E;  2K4V A;  1X6H A;  3TQM A;  1A1H A;  2F8B A;  5A2Q C;  2GLI A;  2EN4 A;  2YTE A;  4ZYD A;  4R2A A;  1HNW E;  2L2N A;  4ZYE A;  2RQL A;  4O24 A;  4X9J A;  4DR2 E;  2EMX A;  2LUQ A;  2IHR 1;  3OTO E;  4BHC A;  1GQE A;  4KHP E;  1X47 A;  1JK1 A;  1EH8 A;  2EPA A;  3IWB A;  4YHH E;  3HPZ A;  2EM4 A;  2EPN A;  4WX9 A;  2NAB A;  5A6B A;  1G2D C;  2JR1 A;  4BMJ A;  5KL5 A;  2GPI A;  2EMB A;  2HHH E;  1MGT A;  2EMI A;  4KWY A;  1GTK A;  1Z1B A;  1LLM C;  2ENC A;  2WCC 3;  1A1F A;  3HTX A;  2YRK A;  1KJK A;  2EPR A;  3VHT B;  2KHX A;  2EM8 A;  5LL6 R;  1YPN A;  2B9D A;  2E72 A;  3FIG A;  4R03 A;  4DKK A;  5AC4 A;  2V85 A;  5KL4 A;  2VE7 C;  2WBU A;  2LJU A;  3T1Y E;  5KL7 A;  4R2R A;  2MDR A;  4NXN E;  2R1F A;  2NUG A;  2N3G A;  1ZU1 A;  2DLK A;  1SR9 A;  2CPN A;  2F4V E;  3J7A G;  2EPK X;  2CTD A;  2WZO A;  1T38 A;  2EPC A;  4F9A B;  3JTZ A;  2MDG A;  4ZYH A;  3THN A;  2EMF A;  2L6M A;  5CFF E;  3K6Q A;  4R2P A;  2HJJ A;  2RPC A;  2UXC E;  2V87 A;  4FK5 C;  2EN3 A;  4F54 A;  5KL6 A;  3H09 A;  4NHR A;  5IWA E;  3THO B;  2RTX A;  2VF1 A;  2YTG A;  3ECR A;  2EMK A;  4BCA A;  1UHZ A;  1IBL E;  2L3C A;  3KWR A;  2L2K B;  2EMH A;  2L3J A;  3C6K A;  2EQ0 A;  2MC5 A;  2JOB A;  2YPN A;  4O43 A;  4DR6 E;  4DV6 E;  5KL2 A;  2WBS A;  1G2F C;  5TSE A;  1XNQ E;  2EN6 A;  2LT7 A;  2DIX A;  2EOE A;  1GZ6 A;  3HPS A;  1TN9 A;  2Q8U A;  1TF3 A;  2VQE E;  3QG5 C;  5AC5 A;  1PJQ A;  1EH6 A;  5LMU E;  2J7J A;  5A6K A;  4WYQ B;  1X49 A;  1A1J A;  2JYA A;  5AE1 A;  2EMY A;  3IWD A;  2YTD A;  4HTG A;  2L2M A;  4DR3 E;  2LO3 A;  5A6J A;  5LMN E;  4TUG A;  4GKK E;  2ADR A;  2LRS A;  2ENA A;  3LML A;  2EP3 A;  1AH5 A;  1IQO A;  4R2Q A;  3VYY A;  4RH8 A;  4R8O A;  2B3T B;  4JYA E;  2JP9 A;  4F6N A;  1YYK A;  4O5G A;  3J80 C;  4J8Z A;  4L5N C;  1YUJ A;  2EPP A;  1HNZ E;  4M9V C;  2LE2 A;  2B7T A;  4GEQ B;  4JI4 E;  1MEY C;  4JI1 E;  2ODR D;  2YZT A;  5LLQ A;  4P78 A;  2E5L E;  1EKZ A;  2V88 A;  1I94 E;  2A25 A;  4JI3 E;  4DR7 E;  3EPL A;  2FV4 B;  4F2J C;  4F9B B;  3ZOQ B;  3M99 B;  2RSI A;  1N3G A;  1X3C A;  2LUP B;  3BF2 A;  2EJ4 A;  4X65 E;  2B7V A;  2EQ1 A;  2I13 A;  2EM5 A;  2EOQ A;  2CT1 A;  2EE8 A;  4JI6 E;  2DMY A;  4X8W A;  3L00 A;  2DMI A;  3MHH C;  4Q28 A;  1DQ3 A;  1KYQ A;  4LFA E;  2YU8 A;  2M7Q A;  1SFE A;  2EOJ A;  2YTQ A;  4LFB E;  1BBG A;  2BB8 A;  2YWQ A;  4BS9 A;  3EPJ A;  4DR5 E;  5A6A A;  4RHB B;  1HNX E;  1XNR E;  3BGH A;  2R76 A;  3DJW A;  1N33 E;  1STU A;  2EOF A;  2ENH A;  2YRH A;  4DV4 E;  3C4T A;  2ODR C;  4WXD A;  3T1H E;  1PDA A;  2UXB E;  2JWO A;  3MHS C;  2YSO A;  1QNT A;  4TUI A;  4WPY A;  2EM7 A;  1DI2 A;  2K7I A;  4LU9 A;  2M4I A;  2V86 A; 
#chains in the Genus database with same CATH homology
 1IBM E;  4DR2 E;  1XMQ E;  3F6H A;  2L92 A;  2LUQ A;  2IHR 1;  3OTO E;  2V89 A;  2EZ6 A;  1ZBQ A;  5LMU E;  4B3S E;  1GQE A;  4KHP E;  4WYQ B;  1QU6 A;  1X49 A;  1X47 A;  3IWB A;  4OX9 E;  4YHH E;  5AE1 A;  1T4N A;  3IWD A;  3HPZ A;  4DUY E;  2V83 A;  3J7Y p;  5FLX C;  2L2M A;  4DR3 E;  4B3T E;  2UXD E;  5LMN E;  4L8N A;  4TUG A;  4GKK E;  3C4B A;  2JR1 A;  2LRS A;  3DF6 A;  4I8O A;  5T6J A;  4BMJ A;  5F3W A;  4OOG C;  4LFC E;  2VQF E;  4JI0 E;  3LML A;  5AE3 A;  3HXL A;  2FTX B;  4DV3 E;  4F9C B;  2HHH E;  2UU9 E;  2JOX A;  4DMI A;  3VYY A;  3HTX A;  4R8O A;  3MSW A;  2B3T B;  4JYA E;  1YYK A;  5AE2 A;  3VYX A;  5AAS A;  3J80 C;  4LF5 E;  4J8Z A;  4X64 E;  4L5N C;  1WHN A;  1O0W A;  2KHX A;  1HNZ E;  2H36 X;  5LL6 R;  2B9D A;  4LF8 E;  3LLH A;  3FIG A;  4R03 A;  2LE2 A;  2M1S A;  2V85 A;  4DKK A;  2YT4 A;  4DR1 E;  5IT9 C;  3AUZ A;  1J5E E;  2B7T A;  2FGG A;  2KOU A;  2VE7 C;  1N32 E;  4GEQ B;  4JI4 E;  3ADI A;  2LBS B;  4JI1 E;  2ODR D;  2UUC E;  2YZT A;  1WXR A;  1ZBT A;  4P78 A;  4WSP A;  2E5L E;  1YYO A;  1EKZ A;  3T1Y E;  4AQY E;  3JU0 A;  4NXN E;  3P1X A;  2MDR A;  2RSM A;  5DNY A;  2NUG A;  2N3G A;  2G7H A;  2V88 A;  1I94 E;  4JI5 E;  4LF6 E;  3AV0 A;  3IWC A;  4JI3 E;  1XMO E;  4DR7 E;  2FV4 B;  1SR9 A;  1T4L B;  2CPN A;  1RC7 A;  4F9B B;  4DV2 E;  3ZOQ B;  4BC9 A;  5ADZ A;  2F4V E;  3J7A G;  2WZO A;  4K0K E;  1YYW A;  4JV5 E;  2V8Q B;  2LTR A;  1UIL A;  4LTY A;  2LUP B;  4M2Z A;  2RS7 A;  2NA2 A;  2L8T A;  4F9A B;  4M30 A;  3JTZ A;  4DUZ E;  4DV1 E;  4X65 E;  4BC7 A;  2RS6 A;  4LU9 A;  4X62 E;  2B7V A;  3RMP A;  2UUA E;  4LF7 E;  1YZ9 A;  2L6M A;  4DV0 E;  2N3H A;  5CFF E;  2LMZ A;  4NXM E;  4B3M E;  4KZS A;  2NUE A;  4JI6 E;  2DMY A;  4WFT A;  4X8W A;  3ADG A;  3K6Q A;  2JY9 A;  2LTS A;  3OML A;  2L33 A;  4Q28 A;  1DQ3 A;  4LFA E;  4B3R E;  1FKA E;  2UUB E;  5BR8 E;  2UXC E;  4M0V A;  2V87 A;  2MC6 A;  4JI8 E;  4DR4 E;  4LF4 E;  3ADJ A;  2M7Q A;  4F54 A;  4GKJ E;  4LFB E;  3H09 A;  2NUF A;  5IWA E;  4JI7 E;  2RTX A;  4BS9 A;  2VF1 A;  4DR5 E;  3J81 C;  1N36 E;  4BCA A;  2E1M A;  3HQ1 A;  1HNX E;  1UHZ A;  1IBL E;  2L3C A;  3KWR A;  4P7D A;  3VK6 A;  4DV7 E;  4LF9 E;  1XNR E;  2L2K B;  4YY3 E;  1HR0 E;  2KON A;  3DJW A;  3F6G A;  2L3J A;  1N33 E;  1STU A;  1WHQ A;  2LJH A;  4JI2 E;  1X48 A;  2EWL A;  1N34 E;  1PKP A;  1IBK E;  1FJG E;  2MC5 A;  2JOB A;  4DV4 E;  1T4O A;  3C4T A;  2ODR C;  4X66 E;  4DR6 E;  2K4V A;  4DV6 E;  4DV5 E;  3JAM C;  3T1H E;  2DB2 A;  1XNQ E;  1J26 A;  2DIX A;  1RQ0 A;  2DSY A;  2F8B A;  2JWO A;  5A2Q C;  4BBY A;  2UXB E;  1GZ6 A;  3HPS A;  4WPY A;  4TUI A;  3ADL A;  1DI2 A;  2ZM6 E;  2JVA A;  1HNW E;  2L2N A;  2VQE E;  2M4I A;  2V86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...