2F8BA

Nmr structure of the c-terminal domain (dimer) of hpv45 oncoprotein e7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
GSHMAEPQRHKILCVCCKCDGRIELTVESSAEDLRTLQQLFLSTLSFVCPWCATNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein E7
publication title Solution structure of the partially folded high-risk human papilloma virus 45 oncoprotein E7.
pubmed doi rcsb
source organism Human papillomavirus type 45
molecule tags Oncoprotein, virus/viral protein
total genus 11
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.730 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2f8bA00
2EWLA 2F8BA
chains in the Genus database with same CATH superfamily
1X5WA 2EMCA 4LTYA 2YRHA 1JK2A 2MKNA 5IXMB 2D9HA 1ZBTA 2V85A 3JAMC 2LTRA 1BBGA 5A2QC 2E1MA 1RMDA 4WX9A 3DJWA 2EMWA 2RTXA 1UN6B 2VF1A 4BMJA 2LUPB 2YTIA 1EH6A 2YTQA 2EZ6A 2YZTA 3C4BA 4DMIA 1STUA 2CTDA 2N3HA 2PRTA 1UBDC 3F6GA 1IMUA 1L4SA 4IS1C 2JVAA 4B3TE 1TN9A 3ECRA 3HPSA 4JI0E 4K0KE 5BR8E 2EN8A 4F6MA 2JY9A 4GKKE 2LJUA 2EORA 3P1XA 5A69A 1X49A 3M99B 2G7HA 2V87A 5A6BA 2GHFA 2GPIA 3KZZA 3LLHA 4B3ME 4RHBB 3BGHA 5ADZA 2B7TA 2M1SA 2B7VA 4R2QA 2N3GA 2V86A 4WSPA 4NXNE 4LFBE 4LF5E 2JYAA 1MGTA 3C6MA 2EOZA 3ADGA 1EKZA 5TSEA 1I94E 1AAYA 4R2AA 4R2CA 2CSHA 1A1LA 2MDRA 1X6EA 4R03A 1B69A 4JI5E 3JU0A 2ZM6E 4NHRA 2EOEA 2KOUA 2EPXA 4DV4E 1SR9A 4ZYGA 2EOOA 2EOXA 2EOJA 1EH8A 1SFEA 2JXPA 2EN4A 2L2NA 2ENCA 2YTGA 3BIDA 2DLQA 4R8OA 1X6FA 2EM8A 3T1YE 2EPMX 5LMNE 2I9IA 1N3GA 3MHSC 2V8QB 5AE1A 4OX9E 2Q8UA 4X62E 4B3SE 2EM7A 4HTGA 2V88A 2CT1A 2R76A 5T6JA 4TUIA 2EM5A 5IV8B 4LFCE 1RC7A 1IQSA 1PJQA 5A6KA 3JTZA 5AC4A 3RMPA 4JI1E 1DQ3A 2EN3A 2EM6A 2JP9A 2RS7A 4DUZE 2BB8A 2M7QA 3EPKA 1PJTA 2M9AA 1A1HA 1MEYC 3HQ1A 1N32E 2UXDE 2EPLX 4F9BB 2DRPA 4BC7A 1YZ9A 1YYKA 3IWCA 1ZAAC 2EMIA 1WHNA 1A1IA 1YSAC 2YTOA 2CPNA 2JPAA 2YTDA 2YU8A 4DV2E 2WBSA 3AV0A 1PJSA 4WXCA 3VYYA 4GZNC 2R1FA 3J7AG 4X9JA 2EPKX 2NUGA 2YRKA 4KWYA 2EOHA 2VQFE 1ZU1A 5LLQA 1PKPA 3OTOE 4JI2E 4F54A 5AE3A 4P78A 2YTPA 4JI8E 4JI4E 2WBTA 2UXCE 2VRDA 5A6JA 4DR5E 2M4IA 2ELYA 4NZVA 2L3JA 1WJPA 1WHQA 2EL4A 4X64E 4AQYE 2JOBA 5CFFE 1GTKA 2EOQA 2EM3A 4ZYHA 2LCEA 3FIGA 4X8WA 2K4VA 2RSIA 2JR1A 2V83A 2EM4A 2JOXA 2HGHA 2DGCA 3ADIA 4DR3E 2EP3A 5KL3A 2EQ3A 4R2RA 4LFAE 1X48A 3J81C 2DSYA 4O4KA 2EN7A 2WCC3 2YWQA 1XMOE 4DR2E 3THOB 3IWBA 1YUJA 2LJHA 1X47A 3VHTB 2IHR1 4WPYA 2EMFA 3BBGA 4LF9E 2ENAA 2HJJA 2EM2A 1PDAA 1XNRE 4M30A 3KWRA 2RS6A 2NA2A 3T1HE 3K6QA 3C6KA 2NUFA 1BB8A 3HPZA 2WZOA 1A1KA 4B3RE 2EL6A 1YUIA 1T4LB 1G2FC 3ZOQB 1QNTA 2JWOA 5IWAE 3ADLA 4BBYA 3J80C 4YHHE 2ODRD 1A1GA 5KL4A 1WRJA 3IWDA 2LMZA 4Q35B 4IJDA 2EMBA 3EPHA 3QG5C 4BHBA 1FJGE 4L5NC 3UK3C 4JV5E 1JK1A 4F9AB 4M2ZA 2EOYA 2N8XA 2GLIA 1QU6A 2EPAA 4M9VC 1EH7A 1WXRA 2WBUA 2NUEA 5DNYA 2EMZA 4O5GA 3MHHC 3KZYA 3AUZA 2DB2A 2ODRC 2EN1A 1A1FA 3F6HA 1UHZA 4O24A 1HNXE 2EMYA 2H36X 1YFHA 4JI7E 2LT7A 4DR7E 2K7IA 2DIXA 2YTEA 4J8ZA 2VE7C 3EPJA 2UUAE 2EPPA 2EMKA 2YRMA 2J7JA 2EPNA 2LBSB 1T4NA 4FK5C 4DV5E 3DF6A 1NEIA 2FGGA 2L6MA 4LF7E 3HTXA 2EWLA 1P47A 1DI2A 4KHPE 2EM0A 4R2DA 4BS9A 3EPLA 1UILA 2YU5A 2EPRA 3VYXA 2RPCA 2VQEE 2F4VE 5FLXC 3H09A 4GKJE 4ZYEA 5KL5A 2EM9A 4MLQA 4F6NA 4MLVA 1X3CA 2L2KB 5AASA 1YYOA 5LMUE 4DUYE 5F3WA 4DR4E 2L8TA 2EOSA 2EOFA 2YTNA 4JI6E 2EMAA 1TF3A 1GZ6A 2E72A 1N33E 1KYQA 4GEQB 1T39A 1RQ0A 2L33A 2YSPA 3MSWA 1IQOA 1F2IG 4TUGA 2L3CA 2YTJA 1FKAE 2BBGA 1HNZE 3TQMA 4ZYDA 4JYAE 2KONA 2EPCA 1IBKE 4LF8E 2EPZA 2LUQA 1YPNA 2B9DA 4F2JC 4L8NA 2MKDA 1BBOA 1O0WA 2DMYA 2LO3A 2EE8A 3ADJA 1A1JA 4X65E 4LF4E 1ZR9A 1J5EE 4WYQB 2EPOA 1NCSA 2FTXB 4BC9A 4Q28A 4N4RB 2MDGA 1GQEA 4WSGA 2UUBE 2LE2A 2EOIA 1N36E 2FV4B 2ELZA 1HR0E 5IT9C 3HXLA 2EMHA 4I8OA 2EN2A 4KZSA 4O43A 4BHCA 3EQ1A 1TF6A 4DKKA 5AC5A 5LL6R 2UUCE 2HHHE 1XMQE 1DGCA 4R2PA 5KL2A 1HNWE 2MC6A 2A25A 4OOGC 2RQLA 2YTFA 2ENHA 2YPNA 3VK6A 5KL6A 4NXME 2LTSA 2LRSA 4LF6E 2EPUA 2DMIA 2L2MA 4DR6E 4WFTA 4WXDA 4HEIA 1N34E 2ADRA 1ZBQA 5A6AA 3L00A 2EMGA 4RH8A 1T4OA 4F9CB 1LLMC 4DR1E 3J7Yp 4YY3E 3LMLA 1IBLE 2HC5A 2E5LE 2UU9E 4R2EA 2I13A 2NABA 2EOMA 5AE2A 1X6HA 1AH5A 2EMXA 2KHXA 2L92A 2EQ1A 2DLKA 2RSMA 4X66E 3BF2A 1KJKA 4JI3E 4DV0E 1T38A 2B3TB 3C4TA 4LU9A 2MC5A 4P7DA 4DV7E 4BCAA 1Z1BA 3OMLA 4R2SA 1J26A 5KL7A 1YYWA 2EJ4A 2EN6A 2YT4A 5A6BD 2UXBE 1G2DC 4DV1E 2EQ0A 2V89A 2EMLA 4M0VA 2YSOA 1IBME 2F8BA 1XNQE 4DV6E 4DV3E 3THNA 2EL5A 2LVHA 2LV2A
chains in the Genus database with same CATH topology
1IBKE 4LF8E 3IWDA 1RC7A 2LUQA 2B9DA 4LTYA 4L8NA 2LMZA 3JTZA 3RMPA 4JI1E 1DQ3A 1ZBTA 1O0WA 2DMYA 2RS7A 2V85A 3ADJA 2M7QA 4DUZE 3JAMC 4L5NC 2LTRA 1FJGE 4JV5E 5A2QC 4X65E 2E1MA 4LF4E 4F9AB 1J5EE 4M2ZA 3HQ1A 4WYQB 1QU6A 1N32E 2UXDE 3DJWA 4F9BB 1WXRA 4BC7A 1YZ9A 2NUEA 1YYKA 5DNYA 2RTXA 3IWCA 2FTXB 4BC9A 2VF1A 4Q28A 4BMJA 2LUPB 1WHNA 1GQEA 3AUZA 2EZ6A 2CPNA 2UUBE 2YZTA 3C4BA 4DMIA 1STUA 2LE2A 2N3HA 4DV2E 3AV0A 2DB2A 2FV4B 1N36E 3VYYA 1HR0E 3J7AG 2ODRC 5IT9C 3HXLA 3F6GA 3F6HA 1UHZA 1HNXE 4I8OA 4KZSA 1YYOA 2H36X 2NUGA 4JI7E 4DR7E 2VQFE 4DKKA 2UUCE 2DIXA 2JVAA 5LL6R 1XMQE 2HHHE 4B3TE 3OTOE 1PKPA 4J8ZA 2VE7C 4JI2E 2UUAE 3HPSA 1HNWE 4F54A 5AE3A 4JI0E 4K0KE 2MC6A 4P78A 4OOGC 4JI8E 4JI4E 5BR8E 2UXCE 2JY9A 3VK6A 2LBSB 4DR5E 4GKKE 4NXME 2M4IA 2LTSA 2LRSA 3P1XA 4LF6E 1T4NA 2L2MA 4DV5E 1X49A 3DF6A 4WFTA 4DR6E 2G7HA 2V87A 2L3JA 1N34E 2FGGA 1ZBQA 1WHQA 4X64E 4AQYE 3LLHA 2JOBA 5ADZA 5CFFE 2L6MA 2B7TA 2M1SA 2B7VA 4F9CB 1T4OA 2N3GA 4LF7E 3HTXA 4DR1E 2EWLA 3FIGA 4X8WA 2V86A 4WSPA 3J7Yp 4B3ME 2K4VA 4NXNE 4YY3E 3LMLA 1DI2A 4KHPE 4LFBE 4LF5E 1IBLE 2JR1A 2V83A 2JOXA 3ADGA 2E5LE 4DR3E 4BS9A 1EKZA 1UILA 3ADIA 2UU9E 1I94E 2MDRA 4LFAE 4R03A 1X48A 2VQEE 2F4VE 3VYXA 4JI5E 3JU0A 5FLXC 3J81C 2DSYA 2ZM6E 2KOUA 5AE2A 3H09A 4GKJE 2L92A 1SR9A 2KHXA 4DV4E 4DR2E 1XMOE 2RSMA 4X66E 4JI3E 3IWBA 2L2KB 2LJHA 1X47A 5AASA 2IHR1 2L2NA 4WPYA 5LMUE 4DUYE 4DV0E 5F3WA 4LF9E 4DR4E 2B3TB 3C4TA 4LU9A 2L8TA 2MC5A 4R8OA 4P7DA 3T1YE 4M30A 3KWRA 1XNRE 4JI6E 4DV7E 2RS6A 4BCAA 2NA2A 3T1HE 3K6QA 5LMNE 1GZ6A 2NUFA 3HPZA 1N33E 2V8QB 2WZOA 5AE1A 4B3RE 4GEQB 3OMLA 1RQ0A 4OX9E 1J26A 1YYWA 1T4LB 2L33A 2YT4A 3MSWA 3ZOQB 2JWOA 2UXBE 4X62E 4B3SE 5IWAE 3ADLA 4DV1E 2V88A 4TUGA 4BBYA 3J80C 2L3CA 2V89A 4M0VA 1IBME 1FKAE 2F8BA 1HNZE 4DV6E 5T6JA 4YHHE 4DV3E 1XNQE 4JYAE 2ODRD 4TUIA 2KONA 4LFCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWL A;  2F8B A; 
#chains in the Genus database with same CATH topology
 1X5W A;  2EMC A;  4LTY A;  2YRH A;  1JK2 A;  2MKN A;  5IXM B;  2D9H A;  1ZBT A;  2V85 A;  3JAM C;  2LTR A;  1BBG A;  5A2Q C;  2E1M A;  1RMD A;  4WX9 A;  3DJW A;  2EMW A;  2RTX A;  1UN6 B;  2VF1 A;  4BMJ A;  2LUP B;  2YTI A;  1EH6 A;  2YTQ A;  2EZ6 A;  2YZT A;  3C4B A;  4DMI A;  1STU A;  2CTD A;  2N3H A;  2PRT A;  1UBD C;  3F6G A;  1IMU A;  1L4S A;  4IS1 C;  2JVA A;  4B3T E;  1TN9 A;  3ECR A;  3HPS A;  4JI0 E;  4K0K E;  5BR8 E;  2EN8 A;  4F6M A;  2JY9 A;  4GKK E;  2LJU A;  2EOR A;  3P1X A;  5A69 A;  1X49 A;  3M99 B;  2G7H A;  2V87 A;  5A6B A;  2GHF A;  2GPI A;  3KZZ A;  3LLH A;  4B3M E;  4RHB B;  3BGH A;  5ADZ A;  2B7T A;  2M1S A;  2B7V A;  4R2Q A;  2N3G A;  2V86 A;  4WSP A;  4NXN E;  4LFB E;  4LF5 E;  2JYA A;  1MGT A;  3C6M A;  2EOZ A;  3ADG A;  1EKZ A;  5TSE A;  1I94 E;  1AAY A;  4R2A A;  4R2C A;  2CSH A;  1A1L A;  2MDR A;  1X6E A;  4R03 A;  1B69 A;  4JI5 E;  3JU0 A;  2ZM6 E;  4NHR A;  2EOE A;  2KOU A;  2EPX A;  4DV4 E;  1SR9 A;  4ZYG A;  2EOO A;  2EOX A;  2EOJ A;  1EH8 A;  1SFE A;  2JXP A;  2EN4 A;  2L2N A;  2ENC A;  2YTG A;  3BID A;  2DLQ A;  4R8O A;  1X6F A;  2EM8 A;  3T1Y E;  2EPM X;  5LMN E;  2I9I A;  1N3G A;  3MHS C;  2V8Q B;  5AE1 A;  4OX9 E;  2Q8U A;  4X62 E;  4B3S E;  2EM7 A;  4HTG A;  2V88 A;  2CT1 A;  2R76 A;  5T6J A;  4TUI A;  2EM5 A;  5IV8 B;  4LFC E;  1RC7 A;  1IQS A;  1PJQ A;  5A6K A;  3JTZ A;  5AC4 A;  3RMP A;  4JI1 E;  1DQ3 A;  2EN3 A;  2EM6 A;  2JP9 A;  2RS7 A;  4DUZ E;  2BB8 A;  2M7Q A;  3EPK A;  1PJT A;  2M9A A;  1A1H A;  1MEY C;  3HQ1 A;  1N32 E;  2UXD E;  2EPL X;  4F9B B;  2DRP A;  4BC7 A;  1YZ9 A;  1YYK A;  3IWC A;  1ZAA C;  2EMI A;  1WHN A;  1A1I A;  1YSA C;  2YTO A;  2CPN A;  2JPA A;  2YTD A;  2YU8 A;  4DV2 E;  2WBS A;  3AV0 A;  1PJS A;  4WXC A;  3VYY A;  4GZN C;  2R1F A;  3J7A G;  4X9J A;  2EPK X;  2NUG A;  2YRK A;  4KWY A;  2EOH A;  2VQF E;  1ZU1 A;  5LLQ A;  1PKP A;  3OTO E;  4JI2 E;  4F54 A;  5AE3 A;  4P78 A;  2YTP A;  4JI8 E;  4JI4 E;  2WBT A;  2UXC E;  2VRD A;  5A6J A;  4DR5 E;  2M4I A;  2ELY A;  4NZV A;  2L3J A;  1WJP A;  1WHQ A;  2EL4 A;  4X64 E;  4AQY E;  2JOB A;  5CFF E;  1GTK A;  2EOQ A;  2EM3 A;  4ZYH A;  2LCE A;  3FIG A;  4X8W A;  2K4V A;  2RSI A;  2JR1 A;  2V83 A;  2EM4 A;  2JOX A;  2HGH A;  2DGC A;  3ADI A;  4DR3 E;  2EP3 A;  5KL3 A;  2EQ3 A;  4R2R A;  4LFA E;  1X48 A;  3J81 C;  2DSY A;  4O4K A;  2EN7 A;  2WCC 3;  2YWQ A;  1XMO E;  4DR2 E;  3THO B;  3IWB A;  1YUJ A;  2LJH A;  1X47 A;  3VHT B;  2IHR 1;  4WPY A;  2EMF A;  3BBG A;  4LF9 E;  2ENA A;  2HJJ A;  2EM2 A;  1PDA A;  1XNR E;  4M30 A;  3KWR A;  2RS6 A;  2NA2 A;  3T1H E;  3K6Q A;  3C6K A;  2NUF A;  1BB8 A;  3HPZ A;  2WZO A;  1A1K A;  4B3R E;  2EL6 A;  1YUI A;  1T4L B;  1G2F C;  3ZOQ B;  1QNT A;  2JWO A;  5IWA E;  3ADL A;  4BBY A;  3J80 C;  4YHH E;  2ODR D;  1A1G A;  5KL4 A;  1WRJ A;  3IWD A;  2LMZ A;  4Q35 B;  4IJD A;  2EMB A;  3EPH A;  3QG5 C;  4BHB A;  1FJG E;  4L5N C;  3UK3 C;  4JV5 E;  1JK1 A;  4F9A B;  4M2Z A;  2EOY A;  2N8X A;  2GLI A;  1QU6 A;  2EPA A;  4M9V C;  1EH7 A;  1WXR A;  2WBU A;  2NUE A;  5DNY A;  2EMZ A;  4O5G A;  3MHH C;  3KZY A;  3AUZ A;  2DB2 A;  2ODR C;  2EN1 A;  1A1F A;  3F6H A;  1UHZ A;  4O24 A;  1HNX E;  2EMY A;  2H36 X;  1YFH A;  4JI7 E;  2LT7 A;  4DR7 E;  2K7I A;  2DIX A;  2YTE A;  4J8Z A;  2VE7 C;  3EPJ A;  2UUA E;  2EPP A;  2EMK A;  2YRM A;  2J7J A;  2EPN A;  2LBS B;  1T4N A;  4FK5 C;  4DV5 E;  3DF6 A;  1NEI A;  2FGG A;  2L6M A;  4LF7 E;  3HTX A;  2EWL A;  1P47 A;  1DI2 A;  4KHP E;  2EM0 A;  4R2D A;  4BS9 A;  3EPL A;  1UIL A;  2YU5 A;  2EPR A;  3VYX A;  2RPC A;  2VQE E;  2F4V E;  5FLX C;  3H09 A;  4GKJ E;  4ZYE A;  5KL5 A;  2EM9 A;  4MLQ A;  4F6N A;  4MLV A;  1X3C A;  2L2K B;  5AAS A;  1YYO A;  5LMU E;  4DUY E;  5F3W A;  4DR4 E;  2L8T A;  2EOS A;  2EOF A;  2YTN A;  4JI6 E;  2EMA A;  1TF3 A;  1GZ6 A;  2E72 A;  1N33 E;  1KYQ A;  4GEQ B;  1T39 A;  1RQ0 A;  2L33 A;  2YSP A;  3MSW A;  1IQO A;  1F2I G;  4TUG A;  2L3C A;  2YTJ A;  1FKA E;  2BBG A;  1HNZ E;  3TQM A;  4ZYD A;  4JYA E;  2KON A;  2EPC A;  1IBK E;  4LF8 E;  2EPZ A;  2LUQ A;  1YPN A;  2B9D A;  4F2J C;  4L8N A;  2MKD A;  1BBO A;  1O0W A;  2DMY A;  2LO3 A;  2EE8 A;  3ADJ A;  1A1J A;  4X65 E;  4LF4 E;  1ZR9 A;  1J5E E;  4WYQ B;  2EPO A;  1NCS A;  2FTX B;  4BC9 A;  4Q28 A;  4N4R B;  2MDG A;  1GQE A;  4WSG A;  2UUB E;  2LE2 A;  2EOI A;  1N36 E;  2FV4 B;  2ELZ A;  1HR0 E;  5IT9 C;  3HXL A;  2EMH A;  4I8O A;  2EN2 A;  4KZS A;  4O43 A;  4BHC A;  3EQ1 A;  1TF6 A;  4DKK A;  5AC5 A;  5LL6 R;  2UUC E;  2HHH E;  1XMQ E;  1DGC A;  4R2P A;  5KL2 A;  1HNW E;  2MC6 A;  2A25 A;  4OOG C;  2RQL A;  2YTF A;  2ENH A;  2YPN A;  3VK6 A;  5KL6 A;  4NXM E;  2LTS A;  2LRS A;  4LF6 E;  2EPU A;  2DMI A;  2L2M A;  4DR6 E;  4WFT A;  4WXD A;  4HEI A;  1N34 E;  2ADR A;  1ZBQ A;  5A6A A;  3L00 A;  2EMG A;  4RH8 A;  1T4O A;  4F9C B;  1LLM C;  4DR1 E;  3J7Y p;  4YY3 E;  3LML A;  1IBL E;  2HC5 A;  2E5L E;  2UU9 E;  4R2E A;  2I13 A;  2NAB A;  2EOM A;  5AE2 A;  1X6H A;  1AH5 A;  2EMX A;  2KHX A;  2L92 A;  2EQ1 A;  2DLK A;  2RSM A;  4X66 E;  3BF2 A;  1KJK A;  4JI3 E;  4DV0 E;  1T38 A;  2B3T B;  3C4T A;  4LU9 A;  2MC5 A;  4P7D A;  4DV7 E;  4BCA A;  1Z1B A;  3OML A;  4R2S A;  1J26 A;  5KL7 A;  1YYW A;  2EJ4 A;  2EN6 A;  2YT4 A;  5A6B D;  2UXB E;  1G2D C;  4DV1 E;  2EQ0 A;  2V89 A;  2EML A;  4M0V A;  2YSO A;  1IBM E;  2F8B A;  1XNQ E;  4DV6 E;  4DV3 E;  3THN A;  2EL5 A;  2LVH A;  2LV2 A; 
#chains in the Genus database with same CATH homology
 1IBK E;  4LF8 E;  3IWD A;  1RC7 A;  2LUQ A;  2B9D A;  4LTY A;  4L8N A;  2LMZ A;  3JTZ A;  3RMP A;  4JI1 E;  1DQ3 A;  1ZBT A;  1O0W A;  2DMY A;  2RS7 A;  2V85 A;  3ADJ A;  2M7Q A;  4DUZ E;  3JAM C;  4L5N C;  2LTR A;  1FJG E;  4JV5 E;  5A2Q C;  4X65 E;  2E1M A;  4LF4 E;  4F9A B;  1J5E E;  4M2Z A;  3HQ1 A;  4WYQ B;  1QU6 A;  1N32 E;  2UXD E;  3DJW A;  4F9B B;  1WXR A;  4BC7 A;  1YZ9 A;  2NUE A;  1YYK A;  5DNY A;  2RTX A;  3IWC A;  2FTX B;  4BC9 A;  2VF1 A;  4Q28 A;  4BMJ A;  2LUP B;  1WHN A;  1GQE A;  3AUZ A;  2EZ6 A;  2CPN A;  2UUB E;  2YZT A;  3C4B A;  4DMI A;  1STU A;  2LE2 A;  2N3H A;  4DV2 E;  3AV0 A;  2DB2 A;  2FV4 B;  1N36 E;  3VYY A;  1HR0 E;  3J7A G;  2ODR C;  5IT9 C;  3HXL A;  3F6G A;  3F6H A;  1UHZ A;  1HNX E;  4I8O A;  4KZS A;  1YYO A;  2H36 X;  2NUG A;  4JI7 E;  4DR7 E;  2VQF E;  4DKK A;  2UUC E;  2DIX A;  2JVA A;  5LL6 R;  1XMQ E;  2HHH E;  4B3T E;  3OTO E;  1PKP A;  4J8Z A;  2VE7 C;  4JI2 E;  2UUA E;  3HPS A;  1HNW E;  4F54 A;  5AE3 A;  4JI0 E;  4K0K E;  2MC6 A;  4P78 A;  4OOG C;  4JI8 E;  4JI4 E;  5BR8 E;  2UXC E;  2JY9 A;  3VK6 A;  2LBS B;  4DR5 E;  4GKK E;  4NXM E;  2M4I A;  2LTS A;  2LRS A;  3P1X A;  4LF6 E;  1T4N A;  2L2M A;  4DV5 E;  1X49 A;  3DF6 A;  4WFT A;  4DR6 E;  2G7H A;  2V87 A;  2L3J A;  1N34 E;  2FGG A;  1ZBQ A;  1WHQ A;  4X64 E;  4AQY E;  3LLH A;  2JOB A;  5ADZ A;  5CFF E;  2L6M A;  2B7T A;  2M1S A;  2B7V A;  4F9C B;  1T4O A;  2N3G A;  4LF7 E;  3HTX A;  4DR1 E;  2EWL A;  3FIG A;  4X8W A;  2V86 A;  4WSP A;  3J7Y p;  4B3M E;  2K4V A;  4NXN E;  4YY3 E;  3LML A;  1DI2 A;  4KHP E;  4LFB E;  4LF5 E;  1IBL E;  2JR1 A;  2V83 A;  2JOX A;  3ADG A;  2E5L E;  4DR3 E;  4BS9 A;  1EKZ A;  1UIL A;  3ADI A;  2UU9 E;  1I94 E;  2MDR A;  4LFA E;  4R03 A;  1X48 A;  2VQE E;  2F4V E;  3VYX A;  4JI5 E;  3JU0 A;  5FLX C;  3J81 C;  2DSY A;  2ZM6 E;  2KOU A;  5AE2 A;  3H09 A;  4GKJ E;  2L92 A;  1SR9 A;  2KHX A;  4DV4 E;  4DR2 E;  1XMO E;  2RSM A;  4X66 E;  4JI3 E;  3IWB A;  2L2K B;  2LJH A;  1X47 A;  5AAS A;  2IHR 1;  2L2N A;  4WPY A;  5LMU E;  4DUY E;  4DV0 E;  5F3W A;  4LF9 E;  4DR4 E;  2B3T B;  3C4T A;  4LU9 A;  2L8T A;  2MC5 A;  4R8O A;  4P7D A;  3T1Y E;  4M30 A;  3KWR A;  1XNR E;  4JI6 E;  4DV7 E;  2RS6 A;  4BCA A;  2NA2 A;  3T1H E;  3K6Q A;  5LMN E;  1GZ6 A;  2NUF A;  3HPZ A;  1N33 E;  2V8Q B;  2WZO A;  5AE1 A;  4B3R E;  4GEQ B;  3OML A;  1RQ0 A;  4OX9 E;  1J26 A;  1YYW A;  1T4L B;  2L33 A;  2YT4 A;  3MSW A;  3ZOQ B;  2JWO A;  2UXB E;  4X62 E;  4B3S E;  5IWA E;  3ADL A;  4DV1 E;  2V88 A;  4TUG A;  4BBY A;  3J80 C;  2L3C A;  2V89 A;  4M0V A;  1IBM E;  1FKA E;  2F8B A;  1HNZ E;  4DV6 E;  5T6J A;  4YHH E;  4DV3 E;  1XNQ E;  4JYA E;  2ODR D;  4TUI A;  2KON A;  4LFC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...