1BB8A

N-terminal dna binding domain from tn916 integrase, nmr, 25 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Site-specific DNA binding using a variation of the double stranded RNA binding motif.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Integrase
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1998-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bb8A00
2GHFA 4R2AA 2YTPA 4R2QA 2EMLA 2EMWA 2EQ3A 2EMHA 2LO3A 5KL2A 3EPJA 1A1LA 2WBUA 1P47A 1AAYA 2EN6A 1X6FA 4GZNC 1YUJA 2EPZA 5KL5A 2YTNA 1A1GA 2R1FA 2JPAA 2EJ4A 2EMFA 2EOFA 2EL5A 4X9JA 1UBDC 1DGCA 2YTFA 2YTDA 2CT1A 2EM8A 3EPLA 2EOXA 2YRMA 2J7JA 2EL4A 2EMZA 2EP3A 2EL6A 2ELZA 3MHHC 2EN1A 2EOIA 1YUIA 2YSOA 1TF6A 2EMBA 4F6MA 2DLQA 1A1KA 2EM6A 2YTOA 1A1JA 1KJKA 2CSHA 3VHTB 2VRDA 1UN6B 2M9AA 2EOHA 2EM2A 1YSAC 2EOYA 2YTIA 2EMIA 2RPCA 2I13A 2EPRA 2EMAA 1WJPA 4R2SA 2ADRA 3UK3C 5KL3A 1X3CA 1TN9A 2DLKA 1X6HA 2EM3A 2EM9A 4IJDA 2HGHA 1X5WA 2EPAA 2GLIA 2ENAA 2ENCA 2EORA 2LV2A 1G2DC 2A25A 2EMKA 2YSPA 2YRHA 2EM0A 2DRPA 3MHSC 2JP9A 2MDGA 2EOMA 2EOZA 2YTJA 3EPHA 2EOJA 4F2JC 2EM7A 1ZR9A 2EQ0A 2YTGA 4IS1C 4R2CA 2EN4A 2YTEA 1JK1A 2EPUA 1ZAAC 2EN7A 1A1HA 2DGCA 2DMIA 4R2PA 2EPPA 1ZU1A 2EPCA 2EOEA 2RSIA 2EN8A 2BB8A 2WBTA 2YTQA 2EN2A 2EOOA 1A1IA 1F2IG 4WSGA 2CTDA 2EPXA 2EMCA 1BB8A 1JK2A 2EQ1A 1X6EA 2ENHA 2EN3A 2LT7A 5KL4A 2PRTA 4FK5C 2EOQA 2EOSA 1TF3A 1G2FC 2MKNA 1B69A 4M9VC 4F6NA 5KL7A 1RMDA 2YU5A 2WBSA 2EM5A 2D9HA 2NABA 2ELYA 1LLMC 3M99B 1Z1BA 2WCC3 1BBOA 2LVHA 4R2RA 2EMYA 2LCEA 4R2EA 2EM4A 2YRKA 2EMGA 2YU8A 2E72A 1NCSA 2MKDA 5KL6A 3EPKA 1A1FA 2EMXA 2EE8A 1MEYC 4R2DA
chains in the Genus database with same CATH superfamily
4LU9A 4R2QA 3EPJA 2RS7A 4OOGC 5AE1A 1A1LA 2WBUA 1EH6A 1J5EE 2EWLA 2EN6A 4GZNC 1YUJA 5KL5A 2YTNA 1A1GA 4X65E 2EOFA 2EL5A 4X9JA 1DGCA 2YTFA 2YTDA 2UU9E 2R76A 4JI1E 1MGTA 4I8OA 3HPZA 4WFTA 5ADZA 2ELZA 3MHHC 4KHPE 3F6HA 4O24A 1X49A 4DR7E 4DR5E 1N36E 4LF9E 2CSHA 3VHTB 1YYWA 2VRDA 4Q28A 2EOYA 2YTIA 4LF4E 3J7AG 4JV5E 5A6JA 2NUGA 2L8TA 4R2SA 4JI0E 1X3CA 2LTRA 2RQLA 3AUZA 2EM3A 2EM9A 4IJDA 2B3TB 5AE3A 2L2KB 2L2NA 2LV2A 3VK6A 4JI2E 1G2DC 2A25A 2DRPA 2L2MA 5LMUE 2NUFA 1YPNA 3EPHA 2EOJA 2EM7A 3IWDA 5AE2A 3IWCA 4R2CA 1WHQA 5DNYA 2YTEA 4JI3E 4DUZE 1WXRA 1A1HA 1PJQA 2F4VE 2DMIA 4R8OA 2V87A 2M7QA 2EPCA 1N34E 2VQEE 2BB8A 3VYYA 5BR8E 2IHR1 2FV4B 1BBGA 2V83A 5LMNE 4RHBB 1YYOA 3IWBA 4B3RE 5F3WA 5LLQA 2EQ1A 2RTXA 5KL4A 2V86A 2KONA 1GTKA 3C4TA 2EOSA 2MKNA 4F6NA 2EM5A 2NABA 3QG5C 3J80C 2LJUA 4JI6E 4B3ME 2DMYA 2LCEA 4WYQB 1NCSA 3C6KA 1A1FA 2LMZA 2EMXA 4WPYA 4M2ZA 1TN9A 4HTGA 4R2AA 2YWQA 4MLVA 2EMWA 4B3TE 1IQOA 3EQ1A 3TQMA 3LMLA 3HTXA 2EM8A 3EPLA 4LF8E 2J7JA 3LLHA 5TSEA 2EL4A 2FTXB 2EMZA 4BC7A 2EP3A 4YY3E 3J81C 3JAMC 1YYKA 1YUIA 2YSOA 2EMBA 3DJWA 3FIGA 4P78A 5IXMB 1DI2A 1A1KA 2EM6A 1EKZA 1A1JA 2L3CA 4X66E 2ZM6E 1T4NA 2M9AA 4JI5E 1HNWE 4GKKE 2EM2A 1YSAC 2LRSA 3P1XA 1IQSA 2I13A 1UILA 4LF7E 5CFFE 3BIDA 2ADRA 4LTYA 3UK3C 4M30A 2DLKA 1X5WA 2GLIA 4GKJE 4LFCE 2EMKA 4TUGA 3DF6A 3OMLA 2YRHA 1FJGE 4WSPA 3KZZA 2VE7C 4NZVA 2JOBA 2YTGA 5AC5A 2JYAA 4DV4E 4DV5E 4L5NC 3RMPA 2DIXA 3THOB 2JOXA 1N32E 4R2PA 2EPPA 4DV3E 2L6MA 2HC5A 2EN2A 2CTDA 2YPNA 1N3GA 4X62E 5IT9C 4J8ZA 1GQEA 3BBGA 2EMCA 3HQ1A 5LL6R 3OTOE 1BB8A 1IBME 2UXCE 1STUA 1JK2A 4BHCA 2ENHA 2EN3A 4BMJA 4F9CB 2VF1A 2HJJA 4DR1E 1G2FC 1RQ0A 1WRJA 4O4KA 3JTZA 2G7HA 4WXCA 2YU5A 2WBSA 2LE2A 2D9HA 1QU6A 1BBOA 2LVHA 3J7Yp 4R2RA 2UUBE 1HR0E 2EMGA 2YU8A 2E72A 5A69A 5KL6A 4K0KE 4TUIA 2F8BA 5KL3A 1HNZE 1MEYC 4L8NA 2GHFA 4O5GA 2YTPA 2EMLA 2JXPA 2EMHA 5KL2A 2UUAE 2V85A 1P47A 3F6GA 1AAYA 2KOUA 2EPZA 4X64E 1X47A 2R1FA 4F54A 2MC5A 2EJ4A 2H36X 1UBDC 1XNRE 2VQFE 5A6BA 1EH7A 2N3HA 2EOXA 3H09A 2I9IA 2JR1A 2B7TA 2EL6A 2LTSA 4F6MA 2V88A 2N3GA 2YTOA 1EH8A 1IBLE 2M1SA 5IWAE 1XMQE 2EOHA 4RH8A 2EMAA 2L3JA 1X6HA 3THNA 2EPAA 4BS9A 4DV7E 2ENAA 5AASA 5FLXC 1T38A 2M4IA 2YSPA 4BCAA 1KYQA 2EM0A 1XMOE 2MDGA 2EOMA 2EOZA 4R2DA 2NUEA 2KHXA 2YTJA 3VYXA 4NXNE 4KZSA 1YFHA 2K7IA 4DKKA 2JVAA 4ZYHA 1ZR9A 2EQ0A 3ADIA 4N4RB 1AH5A 1ZBQA 4BBYA 1JK1A 2UUCE 4NXME 2EN7A 3T1HE 2DGCA 2MDRA 4DUYE 2DSYA 1IMUA 1O0WA 1ZU1A 2EOEA 2EPNA 4BHBA 1YZ9A 2RSIA 2DB2A 2EN8A 2YTQA 2WBTA 4B3SE 1PKPA 2LUQA 2EOOA 4WSGA 4DV1E 2EPXA 1T4LB 4DR6E 4YHHE 4DV0E 5T6JA 4LFBE 2RSMA 2EPLX 2E5LE 4FK5C 2EOQA 4DV2E 4KWYA 1TF3A 2N8XA 2CPNA 2BBGA 4ZYEA 4M9VC 4LFAE 5KL7A 3ECRA 1RMDA 2EZ6A 3JU0A 1LLMC 5A6BD 3M99B 3ADGA 1WHNA 2EMYA 3KWRA 4JI4E 4R2EA 2YRKA 4MLQA 2K4VA 4DR4E 2ODRD 5IV8B 4DR3E 1PJTA 4WXDA 1KJKA 2NA2A 2EQ3A 2LO3A 4LF6E 2YT4A 3MSWA 4F9AB 2YZTA 1X6FA 4M0VA 1T39A 3L00A 3ADLA 5A6KA 2JPAA 2EMFA 2E1MA 2EPOA 4ZYGA 2CT1A 4GEQB 2LBSB 2UXBE 2YRMA 4JI8E 2B9DA 4BC9A 3BF2A 2EN1A 2LJHA 2EOIA 1TF6A 1T4OA 3K6QA 2DLQA 3ZOQB 1GZ6A 1RC7A 4ZYDA 2HHHE 2L33A 1SR9A 1UN6B 3C4BA 1UHZA 1X48A 2EMIA 2MC6A 2RPCA 4R03A 2EPRA 1WJPA 2V8QB 4LF5E 2Q8UA 1I94E 4DV6E 2HGHA 1J26A 3ADJA 2ENCA 3HPSA 4OX9E 3HXLA 4X8WA 1SFEA 2EORA 2UXDE 5AC4A 3KZYA 2JP9A 3MHSC 1NEIA 4NHRA 2LUPB 2RS6A 4F2JC 1QNTA 2B7VA 1PJSA 1XNQE 5A6AA 4IS1C 1ZBTA 2FGGA 2EN4A 3BGHA 2EPMX 1L4SA 1N33E 4AQYE 2EPUA 4O43A 1ZAAC 2V89A 4F9BB 3T1YE 4Q35B 1IBKE 3AV0A 1A1IA 1DQ3A 1F2IG 2L92A 2EPKX 2GPIA 2JWOA 4DR2E 1X6EA 2LT7A 2PRTA 3C6MA 4WX9A 2ODRC 5A2QC 1PDAA 1B69A 2WZOA 1FKAE 2ELYA 1Z1BA 2JY9A 4HEIA 2WCC3 4P7DA 2EM4A 2MKDA 3EPKA 1HNXE 4DMIA 2EE8A 4JI7E 4JYAE
chains in the Genus database with same CATH topology
2GHFA 4R2AA 2YTPA 4R2QA 2EMLA 2EMWA 2EQ3A 2EMHA 2LO3A 5KL2A 3EPJA 1A1LA 2WBUA 1P47A 1AAYA 2EN6A 1X6FA 4GZNC 1YUJA 2EPZA 5KL5A 2YTNA 1A1GA 2R1FA 2JPAA 2EJ4A 2EMFA 2EOFA 2EL5A 4X9JA 1UBDC 1DGCA 2YTFA 2YTDA 2CT1A 2EM8A 3EPLA 2EOXA 2YRMA 2J7JA 2EL4A 2EMZA 2EP3A 2EL6A 2ELZA 3MHHC 2EN1A 2EOIA 1YUIA 2YSOA 1TF6A 2EMBA 4F6MA 2DLQA 1A1KA 2EM6A 2YTOA 1A1JA 1KJKA 2CSHA 3VHTB 2VRDA 1UN6B 2M9AA 2EOHA 2EM2A 1YSAC 2EOYA 2YTIA 2EMIA 2RPCA 2I13A 2EPRA 2EMAA 1WJPA 4R2SA 2ADRA 3UK3C 5KL3A 1X3CA 1TN9A 2DLKA 1X6HA 2EM3A 2EM9A 4IJDA 2HGHA 1X5WA 2EPAA 2GLIA 2ENAA 2ENCA 2EORA 2LV2A 1G2DC 2A25A 2EMKA 2YSPA 2YRHA 2EM0A 2DRPA 3MHSC 2JP9A 2MDGA 2EOMA 2EOZA 2YTJA 3EPHA 2EOJA 4F2JC 2EM7A 1ZR9A 2EQ0A 2YTGA 4IS1C 4R2CA 2EN4A 2YTEA 1JK1A 2EPUA 1ZAAC 2EN7A 1A1HA 2DGCA 2DMIA 4R2PA 2EPPA 1ZU1A 2EPCA 2EOEA 2RSIA 2EN8A 2BB8A 2WBTA 2YTQA 2EN2A 2EOOA 1A1IA 1F2IG 4WSGA 2CTDA 2EPXA 2EMCA 1BB8A 1JK2A 2EQ1A 1X6EA 2ENHA 2EN3A 2LT7A 5KL4A 2PRTA 4FK5C 2EOQA 2EOSA 1TF3A 1G2FC 2MKNA 1B69A 4M9VC 4F6NA 5KL7A 1RMDA 2YU5A 2WBSA 2EM5A 2D9HA 2NABA 2ELYA 1LLMC 3M99B 1Z1BA 2WCC3 1BBOA 2LVHA 4R2RA 2EMYA 2LCEA 4R2EA 2EM4A 2YRKA 2EMGA 2YU8A 2E72A 1NCSA 2MKDA 5KL6A 3EPKA 1A1FA 2EMXA 2EE8A 1MEYC 4R2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHF A;  4R2A A;  2YTP A;  4R2Q A;  2EML A;  2EMW A;  2EQ3 A;  2EMH A;  2LO3 A;  5KL2 A;  3EPJ A;  1A1L A;  2WBU A;  1P47 A;  1AAY A;  2EN6 A;  1X6F A;  4GZN C;  1YUJ A;  2EPZ A;  5KL5 A;  2YTN A;  1A1G A;  2R1F A;  2JPA A;  2EJ4 A;  2EMF A;  2EOF A;  2EL5 A;  4X9J A;  1UBD C;  1DGC A;  2YTF A;  2YTD A;  2CT1 A;  2EM8 A;  3EPL A;  2EOX A;  2YRM A;  2J7J A;  2EL4 A;  2EMZ A;  2EP3 A;  2EL6 A;  2ELZ A;  3MHH C;  2EN1 A;  2EOI A;  1YUI A;  2YSO A;  1TF6 A;  2EMB A;  4F6M A;  2DLQ A;  1A1K A;  2EM6 A;  2YTO A;  1A1J A;  1KJK A;  2CSH A;  3VHT B;  2VRD A;  1UN6 B;  2M9A A;  2EOH A;  2EM2 A;  1YSA C;  2EOY A;  2YTI A;  2EMI A;  2RPC A;  2I13 A;  2EPR A;  2EMA A;  1WJP A;  4R2S A;  2ADR A;  3UK3 C;  5KL3 A;  1X3C A;  1TN9 A;  2DLK A;  1X6H A;  2EM3 A;  2EM9 A;  4IJD A;  2HGH A;  1X5W A;  2EPA A;  2GLI A;  2ENA A;  2ENC A;  2EOR A;  2LV2 A;  1G2D C;  2A25 A;  2EMK A;  2YSP A;  2YRH A;  2EM0 A;  2DRP A;  3MHS C;  2JP9 A;  2MDG A;  2EOM A;  2EOZ A;  2YTJ A;  3EPH A;  2EOJ A;  4F2J C;  2EM7 A;  1ZR9 A;  2EQ0 A;  2YTG A;  4IS1 C;  4R2C A;  2EN4 A;  2YTE A;  1JK1 A;  2EPU A;  1ZAA C;  2EN7 A;  1A1H A;  2DGC A;  2DMI A;  4R2P A;  2EPP A;  1ZU1 A;  2EPC A;  2EOE A;  2RSI A;  2EN8 A;  2BB8 A;  2WBT A;  2YTQ A;  2EN2 A;  2EOO A;  1A1I A;  1F2I G;  4WSG A;  2CTD A;  2EPX A;  2EMC A;  1BB8 A;  1JK2 A;  2EQ1 A;  1X6E A;  2ENH A;  2EN3 A;  2LT7 A;  5KL4 A;  2PRT A;  4FK5 C;  2EOQ A;  2EOS A;  1TF3 A;  1G2F C;  2MKN A;  1B69 A;  4M9V C;  4F6N A;  5KL7 A;  1RMD A;  2YU5 A;  2WBS A;  2EM5 A;  2D9H A;  2NAB A;  2ELY A;  1LLM C;  3M99 B;  1Z1B A;  2WCC 3;  1BBO A;  2LVH A;  4R2R A;  2EMY A;  2LCE A;  4R2E A;  2EM4 A;  2YRK A;  2EMG A;  2YU8 A;  2E72 A;  1NCS A;  2MKD A;  5KL6 A;  3EPK A;  1A1F A;  2EMX A;  2EE8 A;  1MEY C;  4R2D A; 
#chains in the Genus database with same CATH topology
 4LU9 A;  4R2Q A;  3EPJ A;  2RS7 A;  4OOG C;  5AE1 A;  1A1L A;  2WBU A;  1EH6 A;  1J5E E;  2EWL A;  2EN6 A;  4GZN C;  1YUJ A;  5KL5 A;  2YTN A;  1A1G A;  4X65 E;  2EOF A;  2EL5 A;  4X9J A;  1DGC A;  2YTF A;  2YTD A;  2UU9 E;  2R76 A;  4JI1 E;  1MGT A;  4I8O A;  3HPZ A;  4WFT A;  5ADZ A;  2ELZ A;  3MHH C;  4KHP E;  3F6H A;  4O24 A;  1X49 A;  4DR7 E;  4DR5 E;  1N36 E;  4LF9 E;  2CSH A;  3VHT B;  1YYW A;  2VRD A;  4Q28 A;  2EOY A;  2YTI A;  4LF4 E;  3J7A G;  4JV5 E;  5A6J A;  2NUG A;  2L8T A;  4R2S A;  4JI0 E;  1X3C A;  2LTR A;  2RQL A;  3AUZ A;  2EM3 A;  2EM9 A;  4IJD A;  2B3T B;  5AE3 A;  2L2K B;  2L2N A;  2LV2 A;  3VK6 A;  4JI2 E;  1G2D C;  2A25 A;  2DRP A;  2L2M A;  5LMU E;  2NUF A;  1YPN A;  3EPH A;  2EOJ A;  2EM7 A;  3IWD A;  5AE2 A;  3IWC A;  4R2C A;  1WHQ A;  5DNY A;  2YTE A;  4JI3 E;  4DUZ E;  1WXR A;  1A1H A;  1PJQ A;  2F4V E;  2DMI A;  4R8O A;  2V87 A;  2M7Q A;  2EPC A;  1N34 E;  2VQE E;  2BB8 A;  3VYY A;  5BR8 E;  2IHR 1;  2FV4 B;  1BBG A;  2V83 A;  5LMN E;  4RHB B;  1YYO A;  3IWB A;  4B3R E;  5F3W A;  5LLQ A;  2EQ1 A;  2RTX A;  5KL4 A;  2V86 A;  2KON A;  1GTK A;  3C4T A;  2EOS A;  2MKN A;  4F6N A;  2EM5 A;  2NAB A;  3QG5 C;  3J80 C;  2LJU A;  4JI6 E;  4B3M E;  2DMY A;  2LCE A;  4WYQ B;  1NCS A;  3C6K A;  1A1F A;  2LMZ A;  2EMX A;  4WPY A;  4M2Z A;  1TN9 A;  4HTG A;  4R2A A;  2YWQ A;  4MLV A;  2EMW A;  4B3T E;  1IQO A;  3EQ1 A;  3TQM A;  3LML A;  3HTX A;  2EM8 A;  3EPL A;  4LF8 E;  2J7J A;  3LLH A;  5TSE A;  2EL4 A;  2FTX B;  2EMZ A;  4BC7 A;  2EP3 A;  4YY3 E;  3J81 C;  3JAM C;  1YYK A;  1YUI A;  2YSO A;  2EMB A;  3DJW A;  3FIG A;  4P78 A;  5IXM B;  1DI2 A;  1A1K A;  2EM6 A;  1EKZ A;  1A1J A;  2L3C A;  4X66 E;  2ZM6 E;  1T4N A;  2M9A A;  4JI5 E;  1HNW E;  4GKK E;  2EM2 A;  1YSA C;  2LRS A;  3P1X A;  1IQS A;  2I13 A;  1UIL A;  4LF7 E;  5CFF E;  3BID A;  2ADR A;  4LTY A;  3UK3 C;  4M30 A;  2DLK A;  1X5W A;  2GLI A;  4GKJ E;  4LFC E;  2EMK A;  4TUG A;  3DF6 A;  3OML A;  2YRH A;  1FJG E;  4WSP A;  3KZZ A;  2VE7 C;  4NZV A;  2JOB A;  2YTG A;  5AC5 A;  2JYA A;  4DV4 E;  4DV5 E;  4L5N C;  3RMP A;  2DIX A;  3THO B;  2JOX A;  1N32 E;  4R2P A;  2EPP A;  4DV3 E;  2L6M A;  2HC5 A;  2EN2 A;  2CTD A;  2YPN A;  1N3G A;  4X62 E;  5IT9 C;  4J8Z A;  1GQE A;  3BBG A;  2EMC A;  3HQ1 A;  5LL6 R;  3OTO E;  1BB8 A;  1IBM E;  2UXC E;  1STU A;  1JK2 A;  4BHC A;  2ENH A;  2EN3 A;  4BMJ A;  4F9C B;  2VF1 A;  2HJJ A;  4DR1 E;  1G2F C;  1RQ0 A;  1WRJ A;  4O4K A;  3JTZ A;  2G7H A;  4WXC A;  2YU5 A;  2WBS A;  2LE2 A;  2D9H A;  1QU6 A;  1BBO A;  2LVH A;  3J7Y p;  4R2R A;  2UUB E;  1HR0 E;  2EMG A;  2YU8 A;  2E72 A;  5A69 A;  5KL6 A;  4K0K E;  4TUI A;  2F8B A;  5KL3 A;  1HNZ E;  1MEY C;  4L8N A;  2GHF A;  4O5G A;  2YTP A;  2EML A;  2JXP A;  2EMH A;  5KL2 A;  2UUA E;  2V85 A;  1P47 A;  3F6G A;  1AAY A;  2KOU A;  2EPZ A;  4X64 E;  1X47 A;  2R1F A;  4F54 A;  2MC5 A;  2EJ4 A;  2H36 X;  1UBD C;  1XNR E;  2VQF E;  5A6B A;  1EH7 A;  2N3H A;  2EOX A;  3H09 A;  2I9I A;  2JR1 A;  2B7T A;  2EL6 A;  2LTS A;  4F6M A;  2V88 A;  2N3G A;  2YTO A;  1EH8 A;  1IBL E;  2M1S A;  5IWA E;  1XMQ E;  2EOH A;  4RH8 A;  2EMA A;  2L3J A;  1X6H A;  3THN A;  2EPA A;  4BS9 A;  4DV7 E;  2ENA A;  5AAS A;  5FLX C;  1T38 A;  2M4I A;  2YSP A;  4BCA A;  1KYQ A;  2EM0 A;  1XMO E;  2MDG A;  2EOM A;  2EOZ A;  4R2D A;  2NUE A;  2KHX A;  2YTJ A;  3VYX A;  4NXN E;  4KZS A;  1YFH A;  2K7I A;  4DKK A;  2JVA A;  4ZYH A;  1ZR9 A;  2EQ0 A;  3ADI A;  4N4R B;  1AH5 A;  1ZBQ A;  4BBY A;  1JK1 A;  2UUC E;  4NXM E;  2EN7 A;  3T1H E;  2DGC A;  2MDR A;  4DUY E;  2DSY A;  1IMU A;  1O0W A;  1ZU1 A;  2EOE A;  2EPN A;  4BHB A;  1YZ9 A;  2RSI A;  2DB2 A;  2EN8 A;  2YTQ A;  2WBT A;  4B3S E;  1PKP A;  2LUQ A;  2EOO A;  4WSG A;  4DV1 E;  2EPX A;  1T4L B;  4DR6 E;  4YHH E;  4DV0 E;  5T6J A;  4LFB E;  2RSM A;  2EPL X;  2E5L E;  4FK5 C;  2EOQ A;  4DV2 E;  4KWY A;  1TF3 A;  2N8X A;  2CPN A;  2BBG A;  4ZYE A;  4M9V C;  4LFA E;  5KL7 A;  3ECR A;  1RMD A;  2EZ6 A;  3JU0 A;  1LLM C;  5A6B D;  3M99 B;  3ADG A;  1WHN A;  2EMY A;  3KWR A;  4JI4 E;  4R2E A;  2YRK A;  4MLQ A;  2K4V A;  4DR4 E;  2ODR D;  5IV8 B;  4DR3 E;  1PJT A;  4WXD A;  1KJK A;  2NA2 A;  2EQ3 A;  2LO3 A;  4LF6 E;  2YT4 A;  3MSW A;  4F9A B;  2YZT A;  1X6F A;  4M0V A;  1T39 A;  3L00 A;  3ADL A;  5A6K A;  2JPA A;  2EMF A;  2E1M A;  2EPO A;  4ZYG A;  2CT1 A;  4GEQ B;  2LBS B;  2UXB E;  2YRM A;  4JI8 E;  2B9D A;  4BC9 A;  3BF2 A;  2EN1 A;  2LJH A;  2EOI A;  1TF6 A;  1T4O A;  3K6Q A;  2DLQ A;  3ZOQ B;  1GZ6 A;  1RC7 A;  4ZYD A;  2HHH E;  2L33 A;  1SR9 A;  1UN6 B;  3C4B A;  1UHZ A;  1X48 A;  2EMI A;  2MC6 A;  2RPC A;  4R03 A;  2EPR A;  1WJP A;  2V8Q B;  4LF5 E;  2Q8U A;  1I94 E;  4DV6 E;  2HGH A;  1J26 A;  3ADJ A;  2ENC A;  3HPS A;  4OX9 E;  3HXL A;  4X8W A;  1SFE A;  2EOR A;  2UXD E;  5AC4 A;  3KZY A;  2JP9 A;  3MHS C;  1NEI A;  4NHR A;  2LUP B;  2RS6 A;  4F2J C;  1QNT A;  2B7V A;  1PJS A;  1XNQ E;  5A6A A;  4IS1 C;  1ZBT A;  2FGG A;  2EN4 A;  3BGH A;  2EPM X;  1L4S A;  1N33 E;  4AQY E;  2EPU A;  4O43 A;  1ZAA C;  2V89 A;  4F9B B;  3T1Y E;  4Q35 B;  1IBK E;  3AV0 A;  1A1I A;  1DQ3 A;  1F2I G;  2L92 A;  2EPK X;  2GPI A;  2JWO A;  4DR2 E;  1X6E A;  2LT7 A;  2PRT A;  3C6M A;  4WX9 A;  2ODR C;  5A2Q C;  1PDA A;  1B69 A;  2WZO A;  1FKA E;  2ELY A;  1Z1B A;  2JY9 A;  4HEI A;  2WCC 3;  4P7D A;  2EM4 A;  2MKD A;  3EPK A;  1HNX E;  4DMI A;  2EE8 A;  4JI7 E;  4JYA E; 
#chains in the Genus database with same CATH homology
 2GHF A;  4R2A A;  2YTP A;  4R2Q A;  2EML A;  2EMW A;  2EQ3 A;  2EMH A;  2LO3 A;  5KL2 A;  3EPJ A;  1A1L A;  2WBU A;  1P47 A;  1AAY A;  2EN6 A;  1X6F A;  4GZN C;  1YUJ A;  2EPZ A;  5KL5 A;  2YTN A;  1A1G A;  2R1F A;  2JPA A;  2EJ4 A;  2EMF A;  2EOF A;  2EL5 A;  4X9J A;  1UBD C;  1DGC A;  2YTF A;  2YTD A;  2CT1 A;  2EM8 A;  3EPL A;  2EOX A;  2YRM A;  2J7J A;  2EL4 A;  2EMZ A;  2EP3 A;  2EL6 A;  2ELZ A;  3MHH C;  2EN1 A;  2EOI A;  1YUI A;  2YSO A;  1TF6 A;  2EMB A;  4F6M A;  2DLQ A;  1A1K A;  2EM6 A;  2YTO A;  1A1J A;  1KJK A;  2CSH A;  3VHT B;  2VRD A;  1UN6 B;  2M9A A;  2EOH A;  2EM2 A;  1YSA C;  2EOY A;  2YTI A;  2EMI A;  2RPC A;  2I13 A;  2EPR A;  2EMA A;  1WJP A;  4R2S A;  2ADR A;  3UK3 C;  5KL3 A;  1X3C A;  1TN9 A;  2DLK A;  1X6H A;  2EM3 A;  2EM9 A;  4IJD A;  2HGH A;  1X5W A;  2EPA A;  2GLI A;  2ENA A;  2ENC A;  2EOR A;  2LV2 A;  1G2D C;  2A25 A;  2EMK A;  2YSP A;  2YRH A;  2EM0 A;  2DRP A;  3MHS C;  2JP9 A;  2MDG A;  2EOM A;  2EOZ A;  2YTJ A;  3EPH A;  2EOJ A;  4F2J C;  2EM7 A;  1ZR9 A;  2EQ0 A;  2YTG A;  4IS1 C;  4R2C A;  2EN4 A;  2YTE A;  1JK1 A;  2EPU A;  1ZAA C;  2EN7 A;  1A1H A;  2DGC A;  2DMI A;  4R2P A;  2EPP A;  1ZU1 A;  2EPC A;  2EOE A;  2RSI A;  2EN8 A;  2BB8 A;  2WBT A;  2YTQ A;  2EN2 A;  2EOO A;  1A1I A;  1F2I G;  4WSG A;  2CTD A;  2EPX A;  2EMC A;  1BB8 A;  1JK2 A;  2EQ1 A;  1X6E A;  2ENH A;  2EN3 A;  2LT7 A;  5KL4 A;  2PRT A;  4FK5 C;  2EOQ A;  2EOS A;  1TF3 A;  1G2F C;  2MKN A;  1B69 A;  4M9V C;  4F6N A;  5KL7 A;  1RMD A;  2YU5 A;  2WBS A;  2EM5 A;  2D9H A;  2NAB A;  2ELY A;  1LLM C;  3M99 B;  1Z1B A;  2WCC 3;  1BBO A;  2LVH A;  4R2R A;  2EMY A;  2LCE A;  4R2E A;  2EM4 A;  2YRK A;  2EMG A;  2YU8 A;  2E72 A;  1NCS A;  2MKD A;  5KL6 A;  3EPK A;  1A1F A;  2EMX A;  2EE8 A;  1MEY C;  4R2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...