1BB8A

N-terminal dna binding domain from tn916 integrase, nmr, 25 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Integrase
molecule keywords INTEGRASE
publication title Site-specific DNA binding using a variation of the double stranded RNA binding motif.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1998-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bb8A00
2CT1A 2RPCA 2CSHA 2EL4A 3MHSC 2YSPA 1JK1A 2J7JA 5KL4A 2EN1A 3EPJA 4R2EA 2EOSA 1X6FA 1X6EA 2YU8A 1A1LA 2EOEA 2I13A 2ENAA 2EMIA 2YTFA 2EQ1A 4R2DA 1A1GA 2JP9A 1TF6A 2DGCA 2LT7A 2EOFA 1NCSA 2EM6A 2GLIA 2WBSA 1X6HA 2EOJA 2YTDA 2A25A 1A1IA 2R1FA 2YTPA 1A1KA 3EPLA 2EQ3A 2WBUA 1BBOA 2EMLA 1TN9A 2EOMA 4R2QA 2EE8A 2HGHA 2CTDA 2VRDA 4IJDA 2EMBA 2DMIA 2WCC3 2EOYA 2EPAA 2EL6A 4GZNC 2JPAA 2EPPA 2LO3A 1UBDC 3EPKA 2M9AA 2YTGA 2EN8A 2YTJA 4IS1C 4F6MA 2EOXA 2YRMA 4R2CA 2EPXA 1G2FC 2D9HA 2EPZA 1ZR9A 2EMXA 2EN4A 2DLQA 2EM9A 2EM8A 1TF3A 2LV2A 2MDGA 2EMWA 1MEYC 1DGCA 5KL5A 5KL3A 2EMFA 2E72A 1YUJA 2EOHA 2EPUA 2YTOA 2GHFA 2YRHA 2EOZA 1G2DC 2EN6A 2EPRA 3VHTB 2LCEA 2RSIA 2EN2A 1JK2A 2WBTA 2EPCA 2YTQA 4R2AA 3M99B 2NABA 5KL6A 2EM5A 1A1JA 3EPHA 1LLMC 1A1FA 2EM7A 2EM3A 2DRPA 2EOQA 1KJKA 4FK5C 2EJ4A 5KL2A 1UN6B 2ELYA 2EMHA 2ENHA 1X5WA 2YTEA 2EMAA 5KL7A 4R2SA 2LVHA 1AAYA 2YU5A 4WSGA 2EQ0A 2EMGA 1WJPA 1ZU1A 2EORA 2ENCA 3MHHC 2YRKA 2ADRA 2EM0A 1ZAAC 2BB8A 2EOIA 3UK3C 1BB8A 2EN7A 4F6NA 1F2IG 1X3CA 2EP3A 1YSAC 4M9VC 4X9JA 2EM4A 4R2RA 2EMKA 2EMZA 2MKDA 1B69A 1Z1BA 2EOOA 2EN3A 1RMDA 2MKNA 2DLKA 1A1HA 2ELZA 1P47A 2YTNA 2YTIA 2EM2A 2EMYA 1YUIA 2EL5A 4F2JC 2PRTA 2EMCA 2YSOA 4R2PA
chains in the Genus database with same CATH superfamily
3ADJA 2CSHA 4M30A 3MHSC 2EPNA 2BBGA 1N34E 2LJHA 2EOEA 1KYQA 4LF9E 3ECRA 3OTOE 3F6GA 4LF4E 2B3TB 4OOGC 1PKPA 1NCSA 2GLIA 3FIGA 4BS9A 4WX9A 2WZOA 1X6HA 2YTDA 2A25A 2UXCE 2VF1A 1A1KA 4MLQA 2YWQA 2EQ3A 2EMLA 1XMQE 4BHBA 2EE8A 2HGHA 5AC4A 2UXBE 4JI8E 4IJDA 3T1HE 2DMIA 1YPNA 4GZNC 5A69A 3DJWA 1UBDC 1T38A 4LF5E 3QG5C 4ZYEA 2UU9E 3HQ1A 4B3ME 4IS1C 3KZYA 4L5NC 2EOXA 4DV3E 2L33A 4R2CA 4TUGA 2V86A 2JOBA 2JVAA 2DLQA 2EM8A 2LV2A 2CPNA 1YYOA 4KWYA 1GQEA 5KL5A 1DGCA 3J7Yp 4BCAA 2DSYA 2E72A 4M2ZA 2LRSA 1IQOA 3KWRA 4YY3E 4DV6E 5AC5A 3THNA 2RSIA 4WXCA 3HXLA 2KOUA 2DB2A 4DR5E 4DR4E 2LTRA 1DQ3A 1A1FA 5LMNE 2EM7A 4FK5C 1UN6B 1XMOE 2ELYA 1X5WA 2MC6A 4B3RE 4X66E 2RS6A 4N4RB 4WSGA 1ZU1A 4KHPE 1UILA 2LMZA 5IXMB 2EOIA 2MDRA 1PJQA 5AE2A 2M7QA 2HJJA 4JI3E 1B69A 3VYYA 2EN3A 3P1XA 1RMDA 2JWOA 4X8WA 2DLKA 1A1HA 2ELZA 1P47A 1PJTA 5LMUE 1YUIA 5AE3A 5TSEA 2YZTA 1N3GA 2M1SA 2PRTA 1IBME 1BBGA 2V88A 2YSOA 4Q28A 5LLQA 4RH8A 1X47A 2RPCA 1PJSA 3EPJA 3HPZA 1X6FA 1X6EA 2B7VA 1YYWA 2EQ1A 5LL6R 1A1GA 4WFTA 2DGCA 2EOFA 4WXDA 2V85A 4F9BB 2WBSA 4DUZE 1WHQA 2LUQA 1HNXE 3EPLA 2Q8UA 4LU9A 1T4LB 2NUGA 4F9CB 1TN9A 1FJGE 3MSWA 4R2QA 2CTDA 2JR1A 2M4IA 4LFCE 4DV4E 4BC7A 4GKJE 2JPAA 4P7DA 4DKKA 1WHNA 5A6BA 3LMLA 1G2FC 2EPXA 2EPZA 4B3SE 2EPOA 2EPLX 4HTGA 1SR9A 4MLVA 2MDGA 1J5EE 1MEYC 4BC9A 3T1YE 3ZOQB 1YUJA 2EPUA 2NA2A 2GHFA 1O0WA 2DIXA 1UHZA 3ADLA 1T39A 2GPIA 1JK2A 5A6AA 5AE1A 2WBTA 2JYAA 2YTQA 4DUYE 4LFBE 1QU6A 2NABA 1I94E 1SFEA 1GTKA 2EM3A 1RQ0A 2EOQA 2DRPA 4JV5E 5KL2A 1N32E 4O5GA 1HR0E 2ENHA 2YTEA 3K6QA 5KL7A 4B3TE 2LVHA 4F54A 3C4TA 4NXNE 4BMJA 1WJPA 2EMGA 2EORA 3ADGA 1ZBTA 2VQEE 2UUAE 2ADRA 3JTZA 1AH5A 3UK3C 1FKAE 4LF6E 1X3CA 4M9VC 4P78A 4X9JA 2V87A 2EM4A 4DR6E 2EMKA 2EMZA 1IBKE 2MKDA 4O24A 5FLXC 4RHBB 1Z1BA 2EOOA 5CFFE 4ZYDA 5IWAE 3HPSA 2YTNA 3C6MA 2KHXA 4OX9E 2EM2A 3LLHA 2EPKX 4L8NA 5ADZA 4X64E 1HNZE 3IWBA 2YPNA 1EH7A 4R2PA 3ADIA 4DV5E 3JU0A 4R8OA 4K0KE 2K7IA 1JK1A 5KL4A 4R2EA 4DV2E 1A1LA 1YYKA 2B9DA 2LBSB 4R03A 2EMIA 2YTFA 2RSMA 4HEIA 5T6JA 2V83A 2JP9A 2LUPB 1N33E 1YZ9A 2HC5A 3H09A 2LT7A 1J26A 2EOJA 2FV4B 2ZM6E 2JXPA 1A1IA 3C6KA 3JAMC 2R1FA 2YTPA 2L2MA 2WBUA 4JI4E 4LF7E 1IBLE 3F6HA 4X65E 1GZ6A 2ODRC 2VRDA 4DR1E 1HNWE 2EMBA 4NXME 2WCC3 2EOYA 1WXRA 3DF6A 2VQFE 2EPPA 3C4BA 2LO3A 3EPKA 1WRJA 2EN8A 1L4SA 2UUBE 4DV1E 2EZ6A 4ZYGA 4F9AB 1MGTA 2V89A 2HHHE 2L6MA 2D9HA 4DMIA 1ZR9A 3THOB 2EN4A 4JI7E 2EM9A 1TF3A 1NEIA 5KL3A 2EOHA 2YTOA 4O43A 2YRHA 2EPMX 4JI6E 2EPRA 3AUZA 3VHTB 1EH8A 2EN2A 3BF2A 4X62E 1X48A 3L00A 3HTXA 2L3CA 2FTXB 4R2AA 2RQLA 3M99B 2EM5A 1A1JA 1IQSA 2JOXA 2EJ4A 5A6BD 2F8BA 2EMAA 3BIDA 2YU5A 4WSPA 2E1MA 3J80C 1QNTA 2UUCE 2G7HA 2EP3A 1YSAC 2B7TA 4R2RA 4DR2E 5F3WA 2LTSA 3BGHA 4WYQB 2NUFA 5AASA 2L2KB 2R76A 2YT4A 2N3HA 2EMYA 1STUA 2JY9A 1EH6A 4NHRA 4LF8E 2EL5A 4F2JC 4JI5E 3VK6A 4DR3E 4J8ZA 2N3GA 2CT1A 2EL4A 5IT9C 2YSPA 2F4VE 1XNQE 2J7JA 2DMYA 2EN1A 2EOSA 2YU8A 2I13A 4BBYA 1ZBQA 2ENAA 3IWDA 4R2DA 1TF6A 2VE7C 2L92A 3RMPA 4DV7E 2E5LE 4KZSA 2EM6A 4AQYE 2UXDE 2MC5A 3BBGA 4ZYHA 4DR7E 5IV8B 1N36E 1BBOA 2RS7A 4YHHE 2EOMA 4M0VA 4JI0E 1EKZA 3EQ1A 3IWCA 3VYXA 2EPAA 2EL6A 2KONA 3AV0A 2M9AA 2YTGA 2LJUA 2YTJA 4F6MA 4JI1E 2YRMA 4LTYA 4I8OA 2EMXA 4GKKE 4Q35B 2EMWA 1XNRE 2EMFA 1G2DC 2EOZA 2EN6A 5A6JA 4GEQB 2I9IA 2LCEA 1T4OA 1IMUA 2RTXA 2EPCA 4BHCA 5KL6A 3J81C 5BR8E 3EPHA 1LLMC 3J7AG 4O4KA 1KJKA 2L8TA 2EMHA 4R2SA 2H36X 2LE2A 1AAYA 2FGGA 2EQ0A 2N8XA 2V8QB 2NUEA 2ENCA 3TQMA 3MHHC 2YRKA 2EM0A 1ZAAC 2BB8A 4NZVA 4TUIA 1BB8A 2EN7A 4F6NA 1F2IG 2EWLA 3OMLA 1RC7A 2IHR1 5A6KA 2L3JA 4JYAE 5DNYA 1T4NA 2ODRD 2L2NA 2MKNA 4LFAE 4DV0E 1DI2A 4JI2E 5A2QC 2YTIA 1X49A 2K4VA 3KZZA 4WPYA 2EMCA 1PDAA 1YFHA
chains in the Genus database with same CATH topology
2CT1A 2RPCA 2CSHA 2EL4A 3MHSC 2YSPA 1JK1A 2J7JA 5KL4A 2EN1A 3EPJA 4R2EA 2EOSA 1X6FA 1X6EA 2YU8A 1A1LA 2EOEA 2I13A 2ENAA 2EMIA 2YTFA 2EQ1A 4R2DA 1A1GA 2JP9A 1TF6A 2DGCA 2LT7A 2EOFA 1NCSA 2EM6A 2GLIA 2WBSA 1X6HA 2EOJA 2YTDA 2A25A 1A1IA 2R1FA 2YTPA 1A1KA 3EPLA 2EQ3A 2WBUA 1BBOA 2EMLA 1TN9A 2EOMA 4R2QA 2EE8A 2HGHA 2CTDA 2VRDA 4IJDA 2EMBA 2DMIA 2WCC3 2EOYA 2EPAA 2EL6A 4GZNC 2JPAA 2EPPA 2LO3A 1UBDC 3EPKA 2M9AA 2YTGA 2EN8A 2YTJA 4IS1C 4F6MA 2EOXA 2YRMA 4R2CA 2EPXA 1G2FC 2D9HA 2EPZA 1ZR9A 2EMXA 2EN4A 2DLQA 2EM9A 2EM8A 1TF3A 2LV2A 2MDGA 2EMWA 1MEYC 1DGCA 5KL5A 5KL3A 2EMFA 2E72A 1YUJA 2EOHA 2EPUA 2YTOA 2GHFA 2YRHA 2EOZA 1G2DC 2EN6A 2EPRA 3VHTB 2LCEA 2RSIA 2EN2A 1JK2A 2WBTA 2EPCA 2YTQA 4R2AA 3M99B 2NABA 5KL6A 2EM5A 1A1JA 3EPHA 1LLMC 1A1FA 2EM7A 2EM3A 2DRPA 2EOQA 1KJKA 4FK5C 2EJ4A 5KL2A 1UN6B 2ELYA 2EMHA 2ENHA 1X5WA 2YTEA 2EMAA 5KL7A 4R2SA 2LVHA 1AAYA 2YU5A 4WSGA 2EQ0A 2EMGA 1WJPA 1ZU1A 2EORA 2ENCA 3MHHC 2YRKA 2ADRA 2EM0A 1ZAAC 2BB8A 2EOIA 3UK3C 1BB8A 2EN7A 4F6NA 1F2IG 1X3CA 2EP3A 1YSAC 4M9VC 4X9JA 2EM4A 4R2RA 2EMKA 2EMZA 2MKDA 1B69A 1Z1BA 2EOOA 2EN3A 1RMDA 2MKNA 2DLKA 1A1HA 2ELZA 1P47A 2YTNA 2YTIA 2EM2A 2EMYA 1YUIA 2EL5A 4F2JC 2PRTA 2EMCA 2YSOA 4R2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT1 A;  2RPC A;  2CSH A;  2EL4 A;  3MHS C;  2YSP A;  1JK1 A;  2J7J A;  5KL4 A;  2EN1 A;  3EPJ A;  4R2E A;  2EOS A;  1X6F A;  1X6E A;  2YU8 A;  1A1L A;  2EOE A;  2I13 A;  2ENA A;  2EMI A;  2YTF A;  2EQ1 A;  4R2D A;  1A1G A;  2JP9 A;  1TF6 A;  2DGC A;  2LT7 A;  2EOF A;  1NCS A;  2EM6 A;  2GLI A;  2WBS A;  1X6H A;  2EOJ A;  2YTD A;  2A25 A;  1A1I A;  2R1F A;  2YTP A;  1A1K A;  3EPL A;  2EQ3 A;  2WBU A;  1BBO A;  2EML A;  1TN9 A;  2EOM A;  4R2Q A;  2EE8 A;  2HGH A;  2CTD A;  2VRD A;  4IJD A;  2EMB A;  2DMI A;  2WCC 3;  2EOY A;  2EPA A;  2EL6 A;  4GZN C;  2JPA A;  2EPP A;  2LO3 A;  1UBD C;  3EPK A;  2M9A A;  2YTG A;  2EN8 A;  2YTJ A;  4IS1 C;  4F6M A;  2EOX A;  2YRM A;  4R2C A;  2EPX A;  1G2F C;  2D9H A;  2EPZ A;  1ZR9 A;  2EMX A;  2EN4 A;  2DLQ A;  2EM9 A;  2EM8 A;  1TF3 A;  2LV2 A;  2MDG A;  2EMW A;  1MEY C;  1DGC A;  5KL5 A;  5KL3 A;  2EMF A;  2E72 A;  1YUJ A;  2EOH A;  2EPU A;  2YTO A;  2GHF A;  2YRH A;  2EOZ A;  1G2D C;  2EN6 A;  2EPR A;  3VHT B;  2LCE A;  2RSI A;  2EN2 A;  1JK2 A;  2WBT A;  2EPC A;  2YTQ A;  4R2A A;  3M99 B;  2NAB A;  5KL6 A;  2EM5 A;  1A1J A;  3EPH A;  1LLM C;  1A1F A;  2EM7 A;  2EM3 A;  2DRP A;  2EOQ A;  1KJK A;  4FK5 C;  2EJ4 A;  5KL2 A;  1UN6 B;  2ELY A;  2EMH A;  2ENH A;  1X5W A;  2YTE A;  2EMA A;  5KL7 A;  4R2S A;  2LVH A;  1AAY A;  2YU5 A;  4WSG A;  2EQ0 A;  2EMG A;  1WJP A;  1ZU1 A;  2EOR A;  2ENC A;  3MHH C;  2YRK A;  2ADR A;  2EM0 A;  1ZAA C;  2BB8 A;  2EOI A;  3UK3 C;  1BB8 A;  2EN7 A;  4F6N A;  1F2I G;  1X3C A;  2EP3 A;  1YSA C;  4M9V C;  4X9J A;  2EM4 A;  4R2R A;  2EMK A;  2EMZ A;  2MKD A;  1B69 A;  1Z1B A;  2EOO A;  2EN3 A;  1RMD A;  2MKN A;  2DLK A;  1A1H A;  2ELZ A;  1P47 A;  2YTN A;  2YTI A;  2EM2 A;  2EMY A;  1YUI A;  2EL5 A;  4F2J C;  2PRT A;  2EMC A;  2YSO A;  4R2P A; 
#chains in the Genus database with same CATH topology
 3ADJ A;  2CSH A;  4M30 A;  3MHS C;  2EPN A;  2BBG A;  1N34 E;  2LJH A;  2EOE A;  1KYQ A;  4LF9 E;  3ECR A;  3OTO E;  3F6G A;  4LF4 E;  2B3T B;  4OOG C;  1PKP A;  1NCS A;  2GLI A;  3FIG A;  4BS9 A;  4WX9 A;  2WZO A;  1X6H A;  2YTD A;  2A25 A;  2UXC E;  2VF1 A;  1A1K A;  4MLQ A;  2YWQ A;  2EQ3 A;  2EML A;  1XMQ E;  4BHB A;  2EE8 A;  2HGH A;  5AC4 A;  2UXB E;  4JI8 E;  4IJD A;  3T1H E;  2DMI A;  1YPN A;  4GZN C;  5A69 A;  3DJW A;  1UBD C;  1T38 A;  4LF5 E;  3QG5 C;  4ZYE A;  2UU9 E;  3HQ1 A;  4B3M E;  4IS1 C;  3KZY A;  4L5N C;  2EOX A;  4DV3 E;  2L33 A;  4R2C A;  4TUG A;  2V86 A;  2JOB A;  2JVA A;  2DLQ A;  2EM8 A;  2LV2 A;  2CPN A;  1YYO A;  4KWY A;  1GQE A;  5KL5 A;  1DGC A;  3J7Y p;  4BCA A;  2DSY A;  2E72 A;  4M2Z A;  2LRS A;  1IQO A;  3KWR A;  4YY3 E;  4DV6 E;  5AC5 A;  3THN A;  2RSI A;  4WXC A;  3HXL A;  2KOU A;  2DB2 A;  4DR5 E;  4DR4 E;  2LTR A;  1DQ3 A;  1A1F A;  5LMN E;  2EM7 A;  4FK5 C;  1UN6 B;  1XMO E;  2ELY A;  1X5W A;  2MC6 A;  4B3R E;  4X66 E;  2RS6 A;  4N4R B;  4WSG A;  1ZU1 A;  4KHP E;  1UIL A;  2LMZ A;  5IXM B;  2EOI A;  2MDR A;  1PJQ A;  5AE2 A;  2M7Q A;  2HJJ A;  4JI3 E;  1B69 A;  3VYY A;  2EN3 A;  3P1X A;  1RMD A;  2JWO A;  4X8W A;  2DLK A;  1A1H A;  2ELZ A;  1P47 A;  1PJT A;  5LMU E;  1YUI A;  5AE3 A;  5TSE A;  2YZT A;  1N3G A;  2M1S A;  2PRT A;  1IBM E;  1BBG A;  2V88 A;  2YSO A;  4Q28 A;  5LLQ A;  4RH8 A;  1X47 A;  2RPC A;  1PJS A;  3EPJ A;  3HPZ A;  1X6F A;  1X6E A;  2B7V A;  1YYW A;  2EQ1 A;  5LL6 R;  1A1G A;  4WFT A;  2DGC A;  2EOF A;  4WXD A;  2V85 A;  4F9B B;  2WBS A;  4DUZ E;  1WHQ A;  2LUQ A;  1HNX E;  3EPL A;  2Q8U A;  4LU9 A;  1T4L B;  2NUG A;  4F9C B;  1TN9 A;  1FJG E;  3MSW A;  4R2Q A;  2CTD A;  2JR1 A;  2M4I A;  4LFC E;  4DV4 E;  4BC7 A;  4GKJ E;  2JPA A;  4P7D A;  4DKK A;  1WHN A;  5A6B A;  3LML A;  1G2F C;  2EPX A;  2EPZ A;  4B3S E;  2EPO A;  2EPL X;  4HTG A;  1SR9 A;  4MLV A;  2MDG A;  1J5E E;  1MEY C;  4BC9 A;  3T1Y E;  3ZOQ B;  1YUJ A;  2EPU A;  2NA2 A;  2GHF A;  1O0W A;  2DIX A;  1UHZ A;  3ADL A;  1T39 A;  2GPI A;  1JK2 A;  5A6A A;  5AE1 A;  2WBT A;  2JYA A;  2YTQ A;  4DUY E;  4LFB E;  1QU6 A;  2NAB A;  1I94 E;  1SFE A;  1GTK A;  2EM3 A;  1RQ0 A;  2EOQ A;  2DRP A;  4JV5 E;  5KL2 A;  1N32 E;  4O5G A;  1HR0 E;  2ENH A;  2YTE A;  3K6Q A;  5KL7 A;  4B3T E;  2LVH A;  4F54 A;  3C4T A;  4NXN E;  4BMJ A;  1WJP A;  2EMG A;  2EOR A;  3ADG A;  1ZBT A;  2VQE E;  2UUA E;  2ADR A;  3JTZ A;  1AH5 A;  3UK3 C;  1FKA E;  4LF6 E;  1X3C A;  4M9V C;  4P78 A;  4X9J A;  2V87 A;  2EM4 A;  4DR6 E;  2EMK A;  2EMZ A;  1IBK E;  2MKD A;  4O24 A;  5FLX C;  4RHB B;  1Z1B A;  2EOO A;  5CFF E;  4ZYD A;  5IWA E;  3HPS A;  2YTN A;  3C6M A;  2KHX A;  4OX9 E;  2EM2 A;  3LLH A;  2EPK X;  4L8N A;  5ADZ A;  4X64 E;  1HNZ E;  3IWB A;  2YPN A;  1EH7 A;  4R2P A;  3ADI A;  4DV5 E;  3JU0 A;  4R8O A;  4K0K E;  2K7I A;  1JK1 A;  5KL4 A;  4R2E A;  4DV2 E;  1A1L A;  1YYK A;  2B9D A;  2LBS B;  4R03 A;  2EMI A;  2YTF A;  2RSM A;  4HEI A;  5T6J A;  2V83 A;  2JP9 A;  2LUP B;  1N33 E;  1YZ9 A;  2HC5 A;  3H09 A;  2LT7 A;  1J26 A;  2EOJ A;  2FV4 B;  2ZM6 E;  2JXP A;  1A1I A;  3C6K A;  3JAM C;  2R1F A;  2YTP A;  2L2M A;  2WBU A;  4JI4 E;  4LF7 E;  1IBL E;  3F6H A;  4X65 E;  1GZ6 A;  2ODR C;  2VRD A;  4DR1 E;  1HNW E;  2EMB A;  4NXM E;  2WCC 3;  2EOY A;  1WXR A;  3DF6 A;  2VQF E;  2EPP A;  3C4B A;  2LO3 A;  3EPK A;  1WRJ A;  2EN8 A;  1L4S A;  2UUB E;  4DV1 E;  2EZ6 A;  4ZYG A;  4F9A B;  1MGT A;  2V89 A;  2HHH E;  2L6M A;  2D9H A;  4DMI A;  1ZR9 A;  3THO B;  2EN4 A;  4JI7 E;  2EM9 A;  1TF3 A;  1NEI A;  5KL3 A;  2EOH A;  2YTO A;  4O43 A;  2YRH A;  2EPM X;  4JI6 E;  2EPR A;  3AUZ A;  3VHT B;  1EH8 A;  2EN2 A;  3BF2 A;  4X62 E;  1X48 A;  3L00 A;  3HTX A;  2L3C A;  2FTX B;  4R2A A;  2RQL A;  3M99 B;  2EM5 A;  1A1J A;  1IQS A;  2JOX A;  2EJ4 A;  5A6B D;  2F8B A;  2EMA A;  3BID A;  2YU5 A;  4WSP A;  2E1M A;  3J80 C;  1QNT A;  2UUC E;  2G7H A;  2EP3 A;  1YSA C;  2B7T A;  4R2R A;  4DR2 E;  5F3W A;  2LTS A;  3BGH A;  4WYQ B;  2NUF A;  5AAS A;  2L2K B;  2R76 A;  2YT4 A;  2N3H A;  2EMY A;  1STU A;  2JY9 A;  1EH6 A;  4NHR A;  4LF8 E;  2EL5 A;  4F2J C;  4JI5 E;  3VK6 A;  4DR3 E;  4J8Z A;  2N3G A;  2CT1 A;  2EL4 A;  5IT9 C;  2YSP A;  2F4V E;  1XNQ E;  2J7J A;  2DMY A;  2EN1 A;  2EOS A;  2YU8 A;  2I13 A;  4BBY A;  1ZBQ A;  2ENA A;  3IWD A;  4R2D A;  1TF6 A;  2VE7 C;  2L92 A;  3RMP A;  4DV7 E;  2E5L E;  4KZS A;  2EM6 A;  4AQY E;  2UXD E;  2MC5 A;  3BBG A;  4ZYH A;  4DR7 E;  5IV8 B;  1N36 E;  1BBO A;  2RS7 A;  4YHH E;  2EOM A;  4M0V A;  4JI0 E;  1EKZ A;  3EQ1 A;  3IWC A;  3VYX A;  2EPA A;  2EL6 A;  2KON A;  3AV0 A;  2M9A A;  2YTG A;  2LJU A;  2YTJ A;  4F6M A;  4JI1 E;  2YRM A;  4LTY A;  4I8O A;  2EMX A;  4GKK E;  4Q35 B;  2EMW A;  1XNR E;  2EMF A;  1G2D C;  2EOZ A;  2EN6 A;  5A6J A;  4GEQ B;  2I9I A;  2LCE A;  1T4O A;  1IMU A;  2RTX A;  2EPC A;  4BHC A;  5KL6 A;  3J81 C;  5BR8 E;  3EPH A;  1LLM C;  3J7A G;  4O4K A;  1KJK A;  2L8T A;  2EMH A;  4R2S A;  2H36 X;  2LE2 A;  1AAY A;  2FGG A;  2EQ0 A;  2N8X A;  2V8Q B;  2NUE A;  2ENC A;  3TQM A;  3MHH C;  2YRK A;  2EM0 A;  1ZAA C;  2BB8 A;  4NZV A;  4TUI A;  1BB8 A;  2EN7 A;  4F6N A;  1F2I G;  2EWL A;  3OML A;  1RC7 A;  2IHR 1;  5A6K A;  2L3J A;  4JYA E;  5DNY A;  1T4N A;  2ODR D;  2L2N A;  2MKN A;  4LFA E;  4DV0 E;  1DI2 A;  4JI2 E;  5A2Q C;  2YTI A;  1X49 A;  2K4V A;  3KZZ A;  4WPY A;  2EMC A;  1PDA A;  1YFH A; 
#chains in the Genus database with same CATH homology
 2CT1 A;  2RPC A;  2CSH A;  2EL4 A;  3MHS C;  2YSP A;  1JK1 A;  2J7J A;  5KL4 A;  2EN1 A;  3EPJ A;  4R2E A;  2EOS A;  1X6F A;  1X6E A;  2YU8 A;  1A1L A;  2EOE A;  2I13 A;  2ENA A;  2EMI A;  2YTF A;  2EQ1 A;  4R2D A;  1A1G A;  2JP9 A;  1TF6 A;  2DGC A;  2LT7 A;  2EOF A;  1NCS A;  2EM6 A;  2GLI A;  2WBS A;  1X6H A;  2EOJ A;  2YTD A;  2A25 A;  1A1I A;  2R1F A;  2YTP A;  1A1K A;  3EPL A;  2EQ3 A;  2WBU A;  1BBO A;  2EML A;  1TN9 A;  2EOM A;  4R2Q A;  2EE8 A;  2HGH A;  2CTD A;  2VRD A;  4IJD A;  2EMB A;  2DMI A;  2WCC 3;  2EOY A;  2EPA A;  2EL6 A;  4GZN C;  2JPA A;  2EPP A;  2LO3 A;  1UBD C;  3EPK A;  2M9A A;  2YTG A;  2EN8 A;  2YTJ A;  4IS1 C;  4F6M A;  2EOX A;  2YRM A;  4R2C A;  2EPX A;  1G2F C;  2D9H A;  2EPZ A;  1ZR9 A;  2EMX A;  2EN4 A;  2DLQ A;  2EM9 A;  2EM8 A;  1TF3 A;  2LV2 A;  2MDG A;  2EMW A;  1MEY C;  1DGC A;  5KL5 A;  5KL3 A;  2EMF A;  2E72 A;  1YUJ A;  2EOH A;  2EPU A;  2YTO A;  2GHF A;  2YRH A;  2EOZ A;  1G2D C;  2EN6 A;  2EPR A;  3VHT B;  2LCE A;  2RSI A;  2EN2 A;  1JK2 A;  2WBT A;  2EPC A;  2YTQ A;  4R2A A;  3M99 B;  2NAB A;  5KL6 A;  2EM5 A;  1A1J A;  3EPH A;  1LLM C;  1A1F A;  2EM7 A;  2EM3 A;  2DRP A;  2EOQ A;  1KJK A;  4FK5 C;  2EJ4 A;  5KL2 A;  1UN6 B;  2ELY A;  2EMH A;  2ENH A;  1X5W A;  2YTE A;  2EMA A;  5KL7 A;  4R2S A;  2LVH A;  1AAY A;  2YU5 A;  4WSG A;  2EQ0 A;  2EMG A;  1WJP A;  1ZU1 A;  2EOR A;  2ENC A;  3MHH C;  2YRK A;  2ADR A;  2EM0 A;  1ZAA C;  2BB8 A;  2EOI A;  3UK3 C;  1BB8 A;  2EN7 A;  4F6N A;  1F2I G;  1X3C A;  2EP3 A;  1YSA C;  4M9V C;  4X9J A;  2EM4 A;  4R2R A;  2EMK A;  2EMZ A;  2MKD A;  1B69 A;  1Z1B A;  2EOO A;  2EN3 A;  1RMD A;  2MKN A;  2DLK A;  1A1H A;  2ELZ A;  1P47 A;  2YTN A;  2YTI A;  2EM2 A;  2EMY A;  1YUI A;  2EL5 A;  4F2J C;  2PRT A;  2EMC A;  2YSO A;  4R2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...