1BB8A

N-terminal dna binding domain from tn916 integrase, nmr, 25 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
b'EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Site-specific DNA binding using a variation of the double stranded RNA binding motif.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Integrase
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1998-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bb8A00
2EL4A 4R2CA 2EP3A 2EOEA 3EPHA 1G2FC 1WJPA 2JP9A 2EQ0A 2EMWA 2MKNA 2E72A 2EPUA 2EM2A 2EN8A 2NABA 4FK5C 2EN7A 1F2IG 2EMLA 4WSGA 1X6HA 5KL7A 2GLIA 5KL2A 2EL6A 2DRPA 2GHFA 5KL5A 2EQ1A 3M99B 2YU8A 1UN6B 2EOHA 3EPJA 2YTNA 2EOJA 2YTDA 4IJDA 3EPLA 2EOQA 2YTEA 1MEYC 2EM7A 2EOMA 4R2SA 2A25A 2WBSA 3EPKA 2EM5A 1BB8A 2EMYA 1YUJA 2YTJA 1X5WA 2EPCA 2EN3A 2EM9A 2EMAA 2ENCA 2EOOA 2EPAA 2LVHA 2R1FA 4R2AA 2YTGA 1ZU1A 2ELYA 2EOZA 2YSOA 2PRTA 4R2QA 2YTFA 2LO3A 2EM8A 2LCEA 4F6MA 1DGCA 4R2PA 2EMBA 2EPRA 2WCC3 1P47A 1A1GA 1TF6A 2DLKA 2VRDA 2YRMA 1YSAC 2EPPA 2YTQA 2EN6A 2DMIA 2EOFA 2WBUA 2EQ3A 2EMFA 1B69A 2EPZA 3VHTB 2EOYA 2EM0A 2EMCA 1X6FA 1UBDC 2YU5A 2CSHA 1ZAAC 3UK3C 1BBOA 2EORA 2WBTA 2BB8A 2M9AA 2DGCA 2EJ4A 2ENAA 4IS1C 1A1HA 1G2DC 2EM4A 2EMIA 2EN2A 2EMHA 1A1KA 1NCSA 1A1FA 1JK1A 1A1LA 4X9JA 2RPCA 1A1IA 2YRKA 2YTPA 1A1JA 1LLMC 2EOIA 5KL6A 2YTIA 1KJKA 1YUIA 2DLQA 4R2EA 1TN9A 2MKDA 2CT1A 4R2RA 2MDGA 1JK2A 1ZR9A 1Z1BA 2EMXA 2EM6A 3MHSC 2CTDA 2EN1A 4F6NA 2EM3A 4F2JC 2YRHA 2EOSA 2J7JA 2ENHA 3MHHC 2I13A 2EOXA 4M9VC 2ELZA 2LT7A 4R2DA 2JPAA 2EPXA 2LV2A 2EMKA 4GZNC 1TF3A 2EMGA 2YSPA 2EE8A 5KL4A 2HGHA 2EN4A 2EL5A 2YTOA 1AAYA 1X6EA 2D9HA 2EMZA 2RSIA 5KL3A 2ADRA 1X3CA 1RMDA
chains in the Genus database with same CATH superfamily
1AH5A 3KZZA 4R2CA 2ODRC 1G2FC 2V88A 3IWBA 4JI5E 2JP9A 3KZYA 2EQ0A 2EMWA 5F3WA 1YZ9A 2K7IA 2EPUA 2EN8A 4BS9A 4DR2E 4X62E 1F2IG 2EZ6A 2VQEE 2DRPA 2VF1A 2GHFA 2YZTA 2YU8A 4Q35B 4P7DA 3EPJA 2EOJA 2V86A 1HNXE 4WFTA 4DUYE 2UXBE 4TUGA 4JI8E 3EPKA 5A6JA 5AE2A 2YTJA 5AE3A 2LRSA 1YYKA 1FJGE 4P78A 3ZOQB 2R1FA 5IWAE 1ZU1A 2UXDE 1UILA 2YTFA 2EM8A 4DR5E 2EMBA 1P47A 2N8XA 1YYWA 1TF6A 3IWCA 2WBUA 5T6JA 4L5NC 2RTXA 4DR1E 4HTGA 3C6MA 3QG5C 2UU9E 4DR7E 4LFCE 2CSHA 4DMIA 4BC7A 1BBOA 2EORA 2DGCA 2EJ4A 5AC4A 2ENAA 2ZM6E 2RSMA 1G2DC 2EN2A 2EMHA 3C6KA 2RPCA 2G7HA 1XMQE 4WYQB 5LLQA 2JY9A 2R76A 2EOIA 1LLMC 5LMNE 4JI7E 3BIDA 4BBYA 2FTXB 1JK2A 2K4VA 1N32E 3BGHA 2EM6A 1SFEA 5A6KA 4F2JC 2EPNA 2EOSA 4B3TE 1XMOE 2JPAA 2M7QA 4R2DA 2LTRA 4JI1E 2LV2A 2EMKA 4BHBA 4GZNC 2EMGA 4B3SE 2EE8A 2NUFA 2EPLX 2LBSB 4DV5E 4DV0E 2RSIA 1WHNA 5KL3A 1WRJA 1RC7A 2EP3A 5AC5A 4N4RB 2NA2A 3ECRA 1ZBQA 1WJPA 3J80C 1N36E 1XNRE 3C4TA 2EM2A 4DR4E 4BCAA 2GLIA 2M4IA 2FGGA 2JOBA 4Q28A 4YY3E 1N34E 3LMLA 2L3JA 1WHQA 2LE2A 2YTDA 4IJDA 3EPLA 2YT4A 1IBLE 1MEYC 2RQLA 2EOMA 4RH8A 2V89A 3ADIA 2JWOA 2A25A 2WBSA 1QU6A 2EM5A 1YUJA 4LFAE 3HQ1A 2EN3A 2EM9A 2ENCA 2LVHA 4R2AA 2NUEA 1DQ3A 2I9IA 2LUPB 4DV6E 1N33E 4F6MA 1X48A 4JI6E 2B7VA 2EPRA 2WCC3 4WSPA 1EH8A 3J7Yp 4X65E 5A6AA 1A1GA 3KWRA 2F4VE 2DLKA 2YRMA 2YTQA 2EN6A 1IQSA 1B69A 3C4BA 2EPZA 2HC5A 4ZYEA 2CPNA 2VQFE 1BBGA 1EH7A 4TUIA 2UXCE 1ZAAC 1IBME 4LU9A 4NHRA 3ADJA 2BB8A 5IV8B 2E1MA 1PJSA 4IS1C 2HHHE 1A1HA 2EMIA 2JVAA 1T39A 1JK1A 1A1LA 4X9JA 5A2QC 3F6GA 2EPOA 2YTPA 1HNZE 4MLVA 1T4LB 5LL6R 2KOUA 3BBGA 2MKDA 2Q8UA 4R2RA 2YWQA 5A69A 3H09A 4JV5E 2JXPA 1Z1BA 5LMUE 4LF7E 3MHSC 4F6NA 5AASA 2IHR1 2B9DA 2UUBE 3JAMC 4B3RE 4JYAE 4WPYA 2YRHA 1FKAE 3JTZA 4ZYHA 2EOXA 2HJJA 4F9CB 1X49A 2EPXA 2MC6A 4O24A 2YTOA 3THOB 1X6EA 1GQEA 4R8OA 2D9HA 2ADRA 4NZVA 3ADGA 2EL4A 2JOXA 1J5EE 5IXMB 2EPMX 2L92A 3EPHA 3OMLA 1XNQE 4BC9A 1T38A 2MDRA 2B3TB 2MKNA 4GKKE 4L8NA 2V87A 4M0VA 4FK5C 4I8OA 4BMJA 1X6HA 5KL7A 3K6QA 4DV1E 5KL2A 3P1XA 4OOGC 2EQ1A 4YHHE 3M99B 4DV7E 4WXCA 4DUZE 2EOHA 3ADLA 1GZ6A 1YPNA 2EOQA 1UHZA 1O0WA 4RHBB 5AE1A 2L2KB 4DR3E 4R03A 1MGTA 2YPNA 1BB8A 4X8WA 2EMYA 3J81C 2DSYA 1N3GA 3L00A 3HTXA 2EMAA 2EPAA 2F8BA 5A6BD 5TSEA 2ELYA 2L8TA 2EOZA 4M2ZA 2YSOA 4R2QA 1DGCA 4DV2E 4HEIA 4NXME 2VRDA 1STUA 2EPPA 4LFBE 2DMIA 2EOFA 2EQ3A 2EMFA 2RS7A 2EOYA 2EMCA 2L6MA 1UBDC 4WXDA 3HPSA 4BHCA 2YU5A 4X64E 2M1SA 3UK3C 2M9AA 1PJQA 4LF5E 4M30A 4ZYGA 4GEQB 2EM4A 1A1KA 2DMYA 4O43A 2UUCE 4F54A 1J26A 2YRKA 4NXNE 1A1JA 2L2NA 2JYAA 3VYXA 2EWLA 1KJKA 5A6BA 1YUIA 2JR1A 4R2EA 3HXLA 2UUAE 2V8QB 1YYOA 2V85A 5FLXC 2EMXA 4DV3E 2N3GA 2EN1A 2FV4B 2EM3A 2BBGA 5BR8E 2LMZA 2J7JA 2ENHA 3MHHC 4O4KA 1IMUA 4M9VC 2ELZA 2LT7A 2B7TA 1DI2A 1SR9A 4K0KE 1TF3A 2HGHA 4LF6E 2EL5A 2ODRD 5CFFE 3OTOE 4DKKA 1AAYA 3FIGA 3IWDA 1GTKA 2EMZA 2L3CA 3EQ1A 4LF9E 1IQOA 3BF2A 1T4OA 2EOEA 1L4SA 2LUQA 2L2MA 1X47A 2E72A 3TQMA 2V83A 2H36X 2NABA 3RMPA 2EN7A 2EMLA 4WSGA 4MLQA 4LF4E 4JI3E 1YFHA 4JI0E 2EL6A 2MC5A 5KL5A 4GKJE 1UN6B 2LJHA 2YTNA 2GPIA 2YTEA 3AUZA 4X66E 2EM7A 2NUGA 5DNYA 2KHXA 3THNA 4R2SA 1QNTA 3T1HE 1WXRA 3HPZA 3DJWA 1ZBTA 4KWYA 1X5WA 2EPCA 2DIXA 1EH6A 2EOOA 3MSWA 5ADZA 3T1YE 2YTGA 4OX9E 2PRTA 1HNWE 2LO3A 2LCEA 4F9AB 2EPKX 4R2PA 2VE7C 4AQYE 2E5LE 4DR6E 1YSAC 3AV0A 4J8ZA 5IT9C 1PJTA 3VHTB 2EM0A 2N3HA 1X6FA 3JU0A 4B3ME 4LTYA 4O5GA 2WZOA 4DV4E 4JI4E 2KONA 2LJUA 3VK6A 2WBTA 1NEIA 1KYQA 1A1FA 1NCSA 2LTSA 1IBKE 1A1IA 3LLHA 3DF6A 5KL6A 3F6HA 1PDAA 1PKPA 2YTIA 3VYYA 2DLQA 4WX9A 1TN9A 2CT1A 2MDGA 4LF8E 1ZR9A 4KZSA 2CTDA 1I94E 4KHPE 4ZYDA 2I13A 2RS6A 1HR0E 4F9BB 3J7AG 1RQ0A 2YSPA 5KL4A 2EN4A 2DB2A 1EKZA 4JI2E 1T4NA 2L33A 1X3CA 1RMDA
chains in the Genus database with same CATH topology
2EL4A 4R2CA 2EP3A 2EOEA 3EPHA 1G2FC 1WJPA 2JP9A 2EQ0A 2EMWA 2MKNA 2E72A 2EPUA 2EM2A 2EN8A 2NABA 4FK5C 2EN7A 1F2IG 2EMLA 4WSGA 1X6HA 5KL7A 2GLIA 5KL2A 2EL6A 2DRPA 2GHFA 5KL5A 2EQ1A 3M99B 2YU8A 1UN6B 2EOHA 3EPJA 2YTNA 2EOJA 2YTDA 4IJDA 3EPLA 2EOQA 2YTEA 1MEYC 2EM7A 2EOMA 4R2SA 2A25A 2WBSA 3EPKA 2EM5A 1BB8A 2EMYA 1YUJA 2YTJA 1X5WA 2EPCA 2EN3A 2EM9A 2EMAA 2ENCA 2EOOA 2EPAA 2LVHA 2R1FA 4R2AA 2YTGA 1ZU1A 2ELYA 2EOZA 2YSOA 2PRTA 4R2QA 2YTFA 2LO3A 2EM8A 2LCEA 4F6MA 1DGCA 4R2PA 2EMBA 2EPRA 2WCC3 1P47A 1A1GA 1TF6A 2DLKA 2VRDA 2YRMA 1YSAC 2EPPA 2YTQA 2EN6A 2DMIA 2EOFA 2WBUA 2EQ3A 2EMFA 1B69A 2EPZA 3VHTB 2EOYA 2EM0A 2EMCA 1X6FA 1UBDC 2YU5A 2CSHA 1ZAAC 3UK3C 1BBOA 2EORA 2WBTA 2BB8A 2M9AA 2DGCA 2EJ4A 2ENAA 4IS1C 1A1HA 1G2DC 2EM4A 2EMIA 2EN2A 2EMHA 1A1KA 1NCSA 1A1FA 1JK1A 1A1LA 4X9JA 2RPCA 1A1IA 2YRKA 2YTPA 1A1JA 1LLMC 2EOIA 5KL6A 2YTIA 1KJKA 1YUIA 2DLQA 4R2EA 1TN9A 2MKDA 2CT1A 4R2RA 2MDGA 1JK2A 1ZR9A 1Z1BA 2EMXA 2EM6A 3MHSC 2CTDA 2EN1A 4F6NA 2EM3A 4F2JC 2YRHA 2EOSA 2J7JA 2ENHA 3MHHC 2I13A 2EOXA 4M9VC 2ELZA 2LT7A 4R2DA 2JPAA 2EPXA 2LV2A 2EMKA 4GZNC 1TF3A 2EMGA 2YSPA 2EE8A 5KL4A 2HGHA 2EN4A 2EL5A 2YTOA 1AAYA 1X6EA 2D9HA 2EMZA 2RSIA 5KL3A 2ADRA 1X3CA 1RMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL4 A;  4R2C A;  2EP3 A;  2EOE A;  3EPH A;  1G2F C;  1WJP A;  2JP9 A;  2EQ0 A;  2EMW A;  2MKN A;  2E72 A;  2EPU A;  2EM2 A;  2EN8 A;  2NAB A;  4FK5 C;  2EN7 A;  1F2I G;  2EML A;  4WSG A;  1X6H A;  5KL7 A;  2GLI A;  5KL2 A;  2EL6 A;  2DRP A;  2GHF A;  5KL5 A;  2EQ1 A;  3M99 B;  2YU8 A;  1UN6 B;  2EOH A;  3EPJ A;  2YTN A;  2EOJ A;  2YTD A;  4IJD A;  3EPL A;  2EOQ A;  2YTE A;  1MEY C;  2EM7 A;  2EOM A;  4R2S A;  2A25 A;  2WBS A;  3EPK A;  2EM5 A;  1BB8 A;  2EMY A;  1YUJ A;  2YTJ A;  1X5W A;  2EPC A;  2EN3 A;  2EM9 A;  2EMA A;  2ENC A;  2EOO A;  2EPA A;  2LVH A;  2R1F A;  4R2A A;  2YTG A;  1ZU1 A;  2ELY A;  2EOZ A;  2YSO A;  2PRT A;  4R2Q A;  2YTF A;  2LO3 A;  2EM8 A;  2LCE A;  4F6M A;  1DGC A;  4R2P A;  2EMB A;  2EPR A;  2WCC 3;  1P47 A;  1A1G A;  1TF6 A;  2DLK A;  2VRD A;  2YRM A;  1YSA C;  2EPP A;  2YTQ A;  2EN6 A;  2DMI A;  2EOF A;  2WBU A;  2EQ3 A;  2EMF A;  1B69 A;  2EPZ A;  3VHT B;  2EOY A;  2EM0 A;  2EMC A;  1X6F A;  1UBD C;  2YU5 A;  2CSH A;  1ZAA C;  3UK3 C;  1BBO A;  2EOR A;  2WBT A;  2BB8 A;  2M9A A;  2DGC A;  2EJ4 A;  2ENA A;  4IS1 C;  1A1H A;  1G2D C;  2EM4 A;  2EMI A;  2EN2 A;  2EMH A;  1A1K A;  1NCS A;  1A1F A;  1JK1 A;  1A1L A;  4X9J A;  2RPC A;  1A1I A;  2YRK A;  2YTP A;  1A1J A;  1LLM C;  2EOI A;  5KL6 A;  2YTI A;  1KJK A;  1YUI A;  2DLQ A;  4R2E A;  1TN9 A;  2MKD A;  2CT1 A;  4R2R A;  2MDG A;  1JK2 A;  1ZR9 A;  1Z1B A;  2EMX A;  2EM6 A;  3MHS C;  2CTD A;  2EN1 A;  4F6N A;  2EM3 A;  4F2J C;  2YRH A;  2EOS A;  2J7J A;  2ENH A;  3MHH C;  2I13 A;  2EOX A;  4M9V C;  2ELZ A;  2LT7 A;  4R2D A;  2JPA A;  2EPX A;  2LV2 A;  2EMK A;  4GZN C;  1TF3 A;  2EMG A;  2YSP A;  2EE8 A;  5KL4 A;  2HGH A;  2EN4 A;  2EL5 A;  2YTO A;  1AAY A;  1X6E A;  2D9H A;  2EMZ A;  2RSI A;  5KL3 A;  2ADR A;  1X3C A;  1RMD A; 
#chains in the Genus database with same CATH topology
 1AH5 A;  3KZZ A;  4R2C A;  2ODR C;  1G2F C;  2V88 A;  3IWB A;  4JI5 E;  2JP9 A;  3KZY A;  2EQ0 A;  2EMW A;  5F3W A;  1YZ9 A;  2K7I A;  2EPU A;  2EN8 A;  4BS9 A;  4DR2 E;  4X62 E;  1F2I G;  2EZ6 A;  2VQE E;  2DRP A;  2VF1 A;  2GHF A;  2YZT A;  2YU8 A;  4Q35 B;  4P7D A;  3EPJ A;  2EOJ A;  2V86 A;  1HNX E;  4WFT A;  4DUY E;  2UXB E;  4TUG A;  4JI8 E;  3EPK A;  5A6J A;  5AE2 A;  2YTJ A;  5AE3 A;  2LRS A;  1YYK A;  1FJG E;  4P78 A;  3ZOQ B;  2R1F A;  5IWA E;  1ZU1 A;  2UXD E;  1UIL A;  2YTF A;  2EM8 A;  4DR5 E;  2EMB A;  1P47 A;  2N8X A;  1YYW A;  1TF6 A;  3IWC A;  2WBU A;  5T6J A;  4L5N C;  2RTX A;  4DR1 E;  4HTG A;  3C6M A;  3QG5 C;  2UU9 E;  4DR7 E;  4LFC E;  2CSH A;  4DMI A;  4BC7 A;  1BBO A;  2EOR A;  2DGC A;  2EJ4 A;  5AC4 A;  2ENA A;  2ZM6 E;  2RSM A;  1G2D C;  2EN2 A;  2EMH A;  3C6K A;  2RPC A;  2G7H A;  1XMQ E;  4WYQ B;  5LLQ A;  2JY9 A;  2R76 A;  2EOI A;  1LLM C;  5LMN E;  4JI7 E;  3BID A;  4BBY A;  2FTX B;  1JK2 A;  2K4V A;  1N32 E;  3BGH A;  2EM6 A;  1SFE A;  5A6K A;  4F2J C;  2EPN A;  2EOS A;  4B3T E;  1XMO E;  2JPA A;  2M7Q A;  4R2D A;  2LTR A;  4JI1 E;  2LV2 A;  2EMK A;  4BHB A;  4GZN C;  2EMG A;  4B3S E;  2EE8 A;  2NUF A;  2EPL X;  2LBS B;  4DV5 E;  4DV0 E;  2RSI A;  1WHN A;  5KL3 A;  1WRJ A;  1RC7 A;  2EP3 A;  5AC5 A;  4N4R B;  2NA2 A;  3ECR A;  1ZBQ A;  1WJP A;  3J80 C;  1N36 E;  1XNR E;  3C4T A;  2EM2 A;  4DR4 E;  4BCA A;  2GLI A;  2M4I A;  2FGG A;  2JOB A;  4Q28 A;  4YY3 E;  1N34 E;  3LML A;  2L3J A;  1WHQ A;  2LE2 A;  2YTD A;  4IJD A;  3EPL A;  2YT4 A;  1IBL E;  1MEY C;  2RQL A;  2EOM A;  4RH8 A;  2V89 A;  3ADI A;  2JWO A;  2A25 A;  2WBS A;  1QU6 A;  2EM5 A;  1YUJ A;  4LFA E;  3HQ1 A;  2EN3 A;  2EM9 A;  2ENC A;  2LVH A;  4R2A A;  2NUE A;  1DQ3 A;  2I9I A;  2LUP B;  4DV6 E;  1N33 E;  4F6M A;  1X48 A;  4JI6 E;  2B7V A;  2EPR A;  2WCC 3;  4WSP A;  1EH8 A;  3J7Y p;  4X65 E;  5A6A A;  1A1G A;  3KWR A;  2F4V E;  2DLK A;  2YRM A;  2YTQ A;  2EN6 A;  1IQS A;  1B69 A;  3C4B A;  2EPZ A;  2HC5 A;  4ZYE A;  2CPN A;  2VQF E;  1BBG A;  1EH7 A;  4TUI A;  2UXC E;  1ZAA C;  1IBM E;  4LU9 A;  4NHR A;  3ADJ A;  2BB8 A;  5IV8 B;  2E1M A;  1PJS A;  4IS1 C;  2HHH E;  1A1H A;  2EMI A;  2JVA A;  1T39 A;  1JK1 A;  1A1L A;  4X9J A;  5A2Q C;  3F6G A;  2EPO A;  2YTP A;  1HNZ E;  4MLV A;  1T4L B;  5LL6 R;  2KOU A;  3BBG A;  2MKD A;  2Q8U A;  4R2R A;  2YWQ A;  5A69 A;  3H09 A;  4JV5 E;  2JXP A;  1Z1B A;  5LMU E;  4LF7 E;  3MHS C;  4F6N A;  5AAS A;  2IHR 1;  2B9D A;  2UUB E;  3JAM C;  4B3R E;  4JYA E;  4WPY A;  2YRH A;  1FKA E;  3JTZ A;  4ZYH A;  2EOX A;  2HJJ A;  4F9C B;  1X49 A;  2EPX A;  2MC6 A;  4O24 A;  2YTO A;  3THO B;  1X6E A;  1GQE A;  4R8O A;  2D9H A;  2ADR A;  4NZV A;  3ADG A;  2EL4 A;  2JOX A;  1J5E E;  5IXM B;  2EPM X;  2L92 A;  3EPH A;  3OML A;  1XNQ E;  4BC9 A;  1T38 A;  2MDR A;  2B3T B;  2MKN A;  4GKK E;  4L8N A;  2V87 A;  4M0V A;  4FK5 C;  4I8O A;  4BMJ A;  1X6H A;  5KL7 A;  3K6Q A;  4DV1 E;  5KL2 A;  3P1X A;  4OOG C;  2EQ1 A;  4YHH E;  3M99 B;  4DV7 E;  4WXC A;  4DUZ E;  2EOH A;  3ADL A;  1GZ6 A;  1YPN A;  2EOQ A;  1UHZ A;  1O0W A;  4RHB B;  5AE1 A;  2L2K B;  4DR3 E;  4R03 A;  1MGT A;  2YPN A;  1BB8 A;  4X8W A;  2EMY A;  3J81 C;  2DSY A;  1N3G A;  3L00 A;  3HTX A;  2EMA A;  2EPA A;  2F8B A;  5A6B D;  5TSE A;  2ELY A;  2L8T A;  2EOZ A;  4M2Z A;  2YSO A;  4R2Q A;  1DGC A;  4DV2 E;  4HEI A;  4NXM E;  2VRD A;  1STU A;  2EPP A;  4LFB E;  2DMI A;  2EOF A;  2EQ3 A;  2EMF A;  2RS7 A;  2EOY A;  2EMC A;  2L6M A;  1UBD C;  4WXD A;  3HPS A;  4BHC A;  2YU5 A;  4X64 E;  2M1S A;  3UK3 C;  2M9A A;  1PJQ A;  4LF5 E;  4M30 A;  4ZYG A;  4GEQ B;  2EM4 A;  1A1K A;  2DMY A;  4O43 A;  2UUC E;  4F54 A;  1J26 A;  2YRK A;  4NXN E;  1A1J A;  2L2N A;  2JYA A;  3VYX A;  2EWL A;  1KJK A;  5A6B A;  1YUI A;  2JR1 A;  4R2E A;  3HXL A;  2UUA E;  2V8Q B;  1YYO A;  2V85 A;  5FLX C;  2EMX A;  4DV3 E;  2N3G A;  2EN1 A;  2FV4 B;  2EM3 A;  2BBG A;  5BR8 E;  2LMZ A;  2J7J A;  2ENH A;  3MHH C;  4O4K A;  1IMU A;  4M9V C;  2ELZ A;  2LT7 A;  2B7T A;  1DI2 A;  1SR9 A;  4K0K E;  1TF3 A;  2HGH A;  4LF6 E;  2EL5 A;  2ODR D;  5CFF E;  3OTO E;  4DKK A;  1AAY A;  3FIG A;  3IWD A;  1GTK A;  2EMZ A;  2L3C A;  3EQ1 A;  4LF9 E;  1IQO A;  3BF2 A;  1T4O A;  2EOE A;  1L4S A;  2LUQ A;  2L2M A;  1X47 A;  2E72 A;  3TQM A;  2V83 A;  2H36 X;  2NAB A;  3RMP A;  2EN7 A;  2EML A;  4WSG A;  4MLQ A;  4LF4 E;  4JI3 E;  1YFH A;  4JI0 E;  2EL6 A;  2MC5 A;  5KL5 A;  4GKJ E;  1UN6 B;  2LJH A;  2YTN A;  2GPI A;  2YTE A;  3AUZ A;  4X66 E;  2EM7 A;  2NUG A;  5DNY A;  2KHX A;  3THN A;  4R2S A;  1QNT A;  3T1H E;  1WXR A;  3HPZ A;  3DJW A;  1ZBT A;  4KWY A;  1X5W A;  2EPC A;  2DIX A;  1EH6 A;  2EOO A;  3MSW A;  5ADZ A;  3T1Y E;  2YTG A;  4OX9 E;  2PRT A;  1HNW E;  2LO3 A;  2LCE A;  4F9A B;  2EPK X;  4R2P A;  2VE7 C;  4AQY E;  2E5L E;  4DR6 E;  1YSA C;  3AV0 A;  4J8Z A;  5IT9 C;  1PJT A;  3VHT B;  2EM0 A;  2N3H A;  1X6F A;  3JU0 A;  4B3M E;  4LTY A;  4O5G A;  2WZO A;  4DV4 E;  4JI4 E;  2KON A;  2LJU A;  3VK6 A;  2WBT A;  1NEI A;  1KYQ A;  1A1F A;  1NCS A;  2LTS A;  1IBK E;  1A1I A;  3LLH A;  3DF6 A;  5KL6 A;  3F6H A;  1PDA A;  1PKP A;  2YTI A;  3VYY A;  2DLQ A;  4WX9 A;  1TN9 A;  2CT1 A;  2MDG A;  4LF8 E;  1ZR9 A;  4KZS A;  2CTD A;  1I94 E;  4KHP E;  4ZYD A;  2I13 A;  2RS6 A;  1HR0 E;  4F9B B;  3J7A G;  1RQ0 A;  2YSP A;  5KL4 A;  2EN4 A;  2DB2 A;  1EKZ A;  4JI2 E;  1T4N A;  2L33 A;  1X3C A;  1RMD A; 
#chains in the Genus database with same CATH homology
 2EL4 A;  4R2C A;  2EP3 A;  2EOE A;  3EPH A;  1G2F C;  1WJP A;  2JP9 A;  2EQ0 A;  2EMW A;  2MKN A;  2E72 A;  2EPU A;  2EM2 A;  2EN8 A;  2NAB A;  4FK5 C;  2EN7 A;  1F2I G;  2EML A;  4WSG A;  1X6H A;  5KL7 A;  2GLI A;  5KL2 A;  2EL6 A;  2DRP A;  2GHF A;  5KL5 A;  2EQ1 A;  3M99 B;  2YU8 A;  1UN6 B;  2EOH A;  3EPJ A;  2YTN A;  2EOJ A;  2YTD A;  4IJD A;  3EPL A;  2EOQ A;  2YTE A;  1MEY C;  2EM7 A;  2EOM A;  4R2S A;  2A25 A;  2WBS A;  3EPK A;  2EM5 A;  1BB8 A;  2EMY A;  1YUJ A;  2YTJ A;  1X5W A;  2EPC A;  2EN3 A;  2EM9 A;  2EMA A;  2ENC A;  2EOO A;  2EPA A;  2LVH A;  2R1F A;  4R2A A;  2YTG A;  1ZU1 A;  2ELY A;  2EOZ A;  2YSO A;  2PRT A;  4R2Q A;  2YTF A;  2LO3 A;  2EM8 A;  2LCE A;  4F6M A;  1DGC A;  4R2P A;  2EMB A;  2EPR A;  2WCC 3;  1P47 A;  1A1G A;  1TF6 A;  2DLK A;  2VRD A;  2YRM A;  1YSA C;  2EPP A;  2YTQ A;  2EN6 A;  2DMI A;  2EOF A;  2WBU A;  2EQ3 A;  2EMF A;  1B69 A;  2EPZ A;  3VHT B;  2EOY A;  2EM0 A;  2EMC A;  1X6F A;  1UBD C;  2YU5 A;  2CSH A;  1ZAA C;  3UK3 C;  1BBO A;  2EOR A;  2WBT A;  2BB8 A;  2M9A A;  2DGC A;  2EJ4 A;  2ENA A;  4IS1 C;  1A1H A;  1G2D C;  2EM4 A;  2EMI A;  2EN2 A;  2EMH A;  1A1K A;  1NCS A;  1A1F A;  1JK1 A;  1A1L A;  4X9J A;  2RPC A;  1A1I A;  2YRK A;  2YTP A;  1A1J A;  1LLM C;  2EOI A;  5KL6 A;  2YTI A;  1KJK A;  1YUI A;  2DLQ A;  4R2E A;  1TN9 A;  2MKD A;  2CT1 A;  4R2R A;  2MDG A;  1JK2 A;  1ZR9 A;  1Z1B A;  2EMX A;  2EM6 A;  3MHS C;  2CTD A;  2EN1 A;  4F6N A;  2EM3 A;  4F2J C;  2YRH A;  2EOS A;  2J7J A;  2ENH A;  3MHH C;  2I13 A;  2EOX A;  4M9V C;  2ELZ A;  2LT7 A;  4R2D A;  2JPA A;  2EPX A;  2LV2 A;  2EMK A;  4GZN C;  1TF3 A;  2EMG A;  2YSP A;  2EE8 A;  5KL4 A;  2HGH A;  2EN4 A;  2EL5 A;  2YTO A;  1AAY A;  1X6E A;  2D9H A;  2EMZ A;  2RSI A;  5KL3 A;  2ADR A;  1X3C A;  1RMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...