2N8XA

Solution structure of lpte from pseudomonas aerigunosa
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
166
structure length
166
Chain Sequence
b'GTSGFQLRGLGDAQFALKEIDVSARNAYGPTVRELKETLENSGVKVTSNAPYHLVLVREDNQQRTVSYTGSARGAEFELTNTINYEIVGANDLVLMSNQVQVQKVYVHDENNLIGSDQEAAQLRSEMRRDLIQQLSMRLQALTPAQLDEAQRQAEAKAKAEAEALR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS-assembly lipoprotein LptE
publication title Solution Structure and Dynamics of LptE from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Lipid binding protein
total genus 39
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 2n8xA00
5IXMB 2R76A 4RHBB 4N4RB 4RH8A 4NHRA 5TSEA 5IV8B 4Q35B 3BF2A 2JXPA 2N8XA 4KWYA
chains in the Genus database with same CATH superfamily
4GKJE 1HNZE 2CPNA 5LL6R 3ADLA 2YSPA 4WSPA 4KHPE 2EM4A 2EQ3A 2Q8UA 3J80C 1NEIA 2R1FA 5A6BD 2EM0A 3KWRA 3HQ1A 4BMJA 4B3TE 4TUGA 4F6NA 4GEQB 3J81C 4X65E 2NUEA 3L00A 1BB8A 1STUA 2EPKX 2YU8A 5DNYA 4JYAE 5A6KA 1TN9A 2EPOA 4R2RA 3HTXA 4P7DA 4O5GA 4F6MA 4LF6E 2V8QB 2M4IA 2FV4B 2DSYA 4WYQB 1KYQA 2HHHE 4R2EA 5F3WA 2LJUA 1B69A 2EPAA 2YTPA 2YRMA 4BC7A 4B3SE 4R2PA 1YUIA 4R2SA 2RPCA 2LT7A 2JP9A 1J26A 2EN3A 4F9BB 4O43A 1GQEA 3IWBA 2ELZA 2GLIA 5AC5A 4RH8A 2BBGA 5KL3A 2EL6A 4M2ZA 2I13A 1T4NA 4L8NA 2V87A 1YZ9A 3BGHA 1X48A 2YWQA 3OMLA 1YFHA 2N3HA 1I94E 1MGTA 2RSMA 5A2QC 4F54A 2DLKA 1WJPA 2L92A 4NHRA 2EN2A 4BC9A 4LF5E 2JY9A 5IXMB 4DR4E 2M9AA 3VK6A 5KL6A 1WHNA 4WXCA 2EQ1A 2GPIA 4LF7E 2L3JA 1ZU1A 2MDGA 1WXRA 1DQ3A 2FGGA 2DGCA 2ENHA 4DV4E 2EMZA 2L2MA 1IBME 2ADRA 2BB8A 3BIDA 4IS1C 4LF9E 2UXBE 2EPZA 2RSIA 4LF8E 3UK3C 4X9JA 4DKKA 1XNRE 1FJGE 2G7HA 4Q35B 2EMWA 2EM2A 4X62E 1IQOA 2LRSA 2EMKA 2EM6A 1WRJA 2EPPA 4HTGA 3MHSC 2EM7A 2YRHA 3J7AG 2DMYA 4F2JC 1BBGA 1N3GA 2ELYA 2L33A 5LMNE 4WFTA 2V88A 2YTFA 2JPAA 2EOEA 2YTEA 4ZYEA 2EOJA 1A1KA 2L2KB 1RQ0A 4R2AA 4AQYE 2EM8A 3K6QA 2EOQA 4DV5E 4B3RE 2DLQA 4M9VC 1DI2A 1KJKA 2EN8A 1PKPA 3ECRA 4TUIA 2HC5A 2CTDA 2VQEE 4LFAE 2F4VE 1PDAA 1PJQA 4WSGA 3C4TA 1ZBQA 4O24A 2JXPA 4F9CB 2KHXA 4R2CA 3THNA 2K4VA 1PJSA 3MHHC 4DV2E 2EPNA 2H36X 2LJHA 4R03A 2K7IA 2EOIA 3JAMC 2EMAA 5KL7A 1A1JA 2MDRA 2GHFA 4WPYA 1T39A 2VF1A 3QG5C 3M99B 2EPLX 2J7JA 4F9AB 1N32E 1GZ6A 4Q28A 1FKAE 2YTGA 2M1SA 4DV7E 2D9HA 1ZAAC 2L6MA 2MC5A 2EN6A 4ZYDA 1IBKE 1AAYA 4DR6E 2EM3A 4LFCE 3THOB 1HNWE 1MEYC 4WX9A 2KOUA 2EOYA 2YTJA 4J8ZA 4JV5E 2LTSA 2YZTA 2CSHA 5BR8E 2ENAA 2NA2A 2L2NA 1UILA 1X3CA 4KWYA 2LCEA 2EE8A 1A1LA 2M7QA 2NUGA 1PJTA 3ADJA 3BF2A 4DMIA 1UBDC 4R2QA 1SR9A 5AE2A 2DIXA 2VQFE 4P78A 1HR0E 4ZYGA 4R2DA 2VRDA 1XNQE 2EOFA 2EJ4A 2NUFA 4I8OA 5A69A 2WBUA 1G2FC 3F6GA 1N34E 1BBOA 2EOXA 2EPCA 2WCC3 1L4SA 3VYXA 2L8TA 5A6AA 4B3ME 2EPXA 1X6HA 1Z1BA 1YYKA 1AH5A 2WZOA 2V86A 1A1HA 4LU9A 3P1XA 1N33E 2EN1A 3ADIA 2LMZA 5AE1A 3LLHA 5FLXC 2DMIA 4JI1E 2YPNA 4BBYA 2WBSA 4JI5E 1X5WA 2DRPA 5AASA 3HPSA 4M30A 4JI8E 5KL2A 4DR3E 2EORA 1EKZA 2UUCE 2HGHA 1RMDA 4O4KA 2YU5A 4DR1E 2EM5A 4YHHE 2EMIA 3HPZA 4WXDA 1XMQE 2YTDA 2RQLA 1UHZA 5A6JA 2F8BA 3MSWA 4GKKE 4OOGC 3IWDA 2V85A 1ZR9A 2R76A 3LMLA 4LF4E 1YYOA 4DUYE 2EOHA 2V83A 3ADGA 4DR5E 2E1MA 4R8OA 2EZ6A 2EL5A 2N3GA 5AC4A 2LO3A 2IHR1 2B7VA 2UU9E 1HNXE 2UXCE 3DJWA 2YTQA 1X6EA 2UXDE 4DV3E 1YYWA 2EQ0A 2N8XA 1F2IG 1X49A 1EH7A 1A1GA 3VYYA 1A1FA 2LV2A 2EN7A 1JK2A 2LUQA 4LFBE 4X66E 4ZYHA 1IMUA 1J5EE 2EOSA 2JR1A 3C6KA 2A25A 1YSAC 4KZSA 4JI3E 4DV6E 2ODRC 5ADZA 3AV0A 2CT1A 3DF6A 3EQ1A 2B9DA 4BS9A 5T6JA 1LLMC 1IBLE 2ZM6E 3JU0A 1RC7A 1G2DC 1WHQA 2ODRD 4LTYA 1YUJA 4DR7E 5IV8B 3VHTB 4NZVA 2NABA 1X47A 1X6FA 2DB2A 2EPMX 1JK1A 2B3TB 2VE7C 4GZNC 2JOXA 2MKNA 4DV1E 4RHBB 3T1YE 1NCSA 2EMFA 4N4RB 1O0WA 2E72A 2LUPB 2EMYA 3FIGA 2EOZA 1QNTA 2MC6A 2MKDA 2UUBE 3KZZA 2EWLA 4DV0E 4OX9E 2YTOA 3KZYA 1T4LB 2LVHA 3HXLA 1EH6A 2UUAE 2JWOA 1YPNA 2FTXB 3JTZA 5LMUE 2LTRA 4DR2E 3AUZA 3EPLA 2YT4A 3TQMA 5KL5A 4NXNE 4JI6E 2EL4A 3J7Yp 2YSOA 2EMBA 1N36E 2E5LE 2RS7A 4M0VA 2YTNA 2EN4A 4HEIA 2EMHA 5LLQA 2RS6A 5TSEA 4BHBA 5A6BA 4X64E 2WBTA 4JI4E 3EPHA 2KONA 4L5NC 2YRKA 2L3CA 4BHCA 2JVAA 4IJDA 5CFFE 1P47A 2EPRA 1IQSA 1SFEA 2PRTA 4MLVA 3EPJA 4JI7E 2V89A 2EPUA 1QU6A 1DGCA 1TF3A 2EMCA 2ENCA 5IWAE 2EOMA 2EOOA 2LE2A 2JYAA 2LBSB 1GTKA 2EP3A 2JOBA 3OTOE 3H09A 2EMXA 3BBGA 5KL4A 2RTXA 3IWCA 3EPKA 2I9IA 1A1IA 1ZBTA 1T38A 3F6HA 4NXME 5IT9C 2B7TA 3ZOQB 2HJJA 1EH8A 4BCAA 4YY3E 4X8WA 3C6MA 5AE3A 4JI2E 2EM9A 1XMOE 3T1HE 4FK5C 4DUZE 1TF6A 4MLQA 1T4OA 2EMLA 4JI0E 2EMGA 1UN6B 3C4BA 3RMPA 4K0KE 2YTIA
chains in the Genus database with same CATH topology
5IXMB 2R76A 4RHBB 4N4RB 4RH8A 4NHRA 5TSEA 5IV8B 4Q35B 3BF2A 2JXPA 2N8XA 4KWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IXM B;  2R76 A;  4RHB B;  4N4R B;  4RH8 A;  4NHR A;  5TSE A;  5IV8 B;  4Q35 B;  3BF2 A;  2JXP A;  2N8X A;  4KWY A; 
#chains in the Genus database with same CATH topology
 4GKJ E;  1HNZ E;  2CPN A;  5LL6 R;  3ADL A;  2YSP A;  4WSP A;  4KHP E;  2EM4 A;  2EQ3 A;  2Q8U A;  3J80 C;  1NEI A;  2R1F A;  5A6B D;  2EM0 A;  3KWR A;  3HQ1 A;  4BMJ A;  4B3T E;  4TUG A;  4F6N A;  4GEQ B;  3J81 C;  4X65 E;  2NUE A;  3L00 A;  1BB8 A;  1STU A;  2EPK X;  2YU8 A;  5DNY A;  4JYA E;  5A6K A;  1TN9 A;  2EPO A;  4R2R A;  3HTX A;  4P7D A;  4O5G A;  4F6M A;  4LF6 E;  2V8Q B;  2M4I A;  2FV4 B;  2DSY A;  4WYQ B;  1KYQ A;  2HHH E;  4R2E A;  5F3W A;  2LJU A;  1B69 A;  2EPA A;  2YTP A;  2YRM A;  4BC7 A;  4B3S E;  4R2P A;  1YUI A;  4R2S A;  2RPC A;  2LT7 A;  2JP9 A;  1J26 A;  2EN3 A;  4F9B B;  4O43 A;  1GQE A;  3IWB A;  2ELZ A;  2GLI A;  5AC5 A;  4RH8 A;  2BBG A;  5KL3 A;  2EL6 A;  4M2Z A;  2I13 A;  1T4N A;  4L8N A;  2V87 A;  1YZ9 A;  3BGH A;  1X48 A;  2YWQ A;  3OML A;  1YFH A;  2N3H A;  1I94 E;  1MGT A;  2RSM A;  5A2Q C;  4F54 A;  2DLK A;  1WJP A;  2L92 A;  4NHR A;  2EN2 A;  4BC9 A;  4LF5 E;  2JY9 A;  5IXM B;  4DR4 E;  2M9A A;  3VK6 A;  5KL6 A;  1WHN A;  4WXC A;  2EQ1 A;  2GPI A;  4LF7 E;  2L3J A;  1ZU1 A;  2MDG A;  1WXR A;  1DQ3 A;  2FGG A;  2DGC A;  2ENH A;  4DV4 E;  2EMZ A;  2L2M A;  1IBM E;  2ADR A;  2BB8 A;  3BID A;  4IS1 C;  4LF9 E;  2UXB E;  2EPZ A;  2RSI A;  4LF8 E;  3UK3 C;  4X9J A;  4DKK A;  1XNR E;  1FJG E;  2G7H A;  4Q35 B;  2EMW A;  2EM2 A;  4X62 E;  1IQO A;  2LRS A;  2EMK A;  2EM6 A;  1WRJ A;  2EPP A;  4HTG A;  3MHS C;  2EM7 A;  2YRH A;  3J7A G;  2DMY A;  4F2J C;  1BBG A;  1N3G A;  2ELY A;  2L33 A;  5LMN E;  4WFT A;  2V88 A;  2YTF A;  2JPA A;  2EOE A;  2YTE A;  4ZYE A;  2EOJ A;  1A1K A;  2L2K B;  1RQ0 A;  4R2A A;  4AQY E;  2EM8 A;  3K6Q A;  2EOQ A;  4DV5 E;  4B3R E;  2DLQ A;  4M9V C;  1DI2 A;  1KJK A;  2EN8 A;  1PKP A;  3ECR A;  4TUI A;  2HC5 A;  2CTD A;  2VQE E;  4LFA E;  2F4V E;  1PDA A;  1PJQ A;  4WSG A;  3C4T A;  1ZBQ A;  4O24 A;  2JXP A;  4F9C B;  2KHX A;  4R2C A;  3THN A;  2K4V A;  1PJS A;  3MHH C;  4DV2 E;  2EPN A;  2H36 X;  2LJH A;  4R03 A;  2K7I A;  2EOI A;  3JAM C;  2EMA A;  5KL7 A;  1A1J A;  2MDR A;  2GHF A;  4WPY A;  1T39 A;  2VF1 A;  3QG5 C;  3M99 B;  2EPL X;  2J7J A;  4F9A B;  1N32 E;  1GZ6 A;  4Q28 A;  1FKA E;  2YTG A;  2M1S A;  4DV7 E;  2D9H A;  1ZAA C;  2L6M A;  2MC5 A;  2EN6 A;  4ZYD A;  1IBK E;  1AAY A;  4DR6 E;  2EM3 A;  4LFC E;  3THO B;  1HNW E;  1MEY C;  4WX9 A;  2KOU A;  2EOY A;  2YTJ A;  4J8Z A;  4JV5 E;  2LTS A;  2YZT A;  2CSH A;  5BR8 E;  2ENA A;  2NA2 A;  2L2N A;  1UIL A;  1X3C A;  4KWY A;  2LCE A;  2EE8 A;  1A1L A;  2M7Q A;  2NUG A;  1PJT A;  3ADJ A;  3BF2 A;  4DMI A;  1UBD C;  4R2Q A;  1SR9 A;  5AE2 A;  2DIX A;  2VQF E;  4P78 A;  1HR0 E;  4ZYG A;  4R2D A;  2VRD A;  1XNQ E;  2EOF A;  2EJ4 A;  2NUF A;  4I8O A;  5A69 A;  2WBU A;  1G2F C;  3F6G A;  1N34 E;  1BBO A;  2EOX A;  2EPC A;  2WCC 3;  1L4S A;  3VYX A;  2L8T A;  5A6A A;  4B3M E;  2EPX A;  1X6H A;  1Z1B A;  1YYK A;  1AH5 A;  2WZO A;  2V86 A;  1A1H A;  4LU9 A;  3P1X A;  1N33 E;  2EN1 A;  3ADI A;  2LMZ A;  5AE1 A;  3LLH A;  5FLX C;  2DMI A;  4JI1 E;  2YPN A;  4BBY A;  2WBS A;  4JI5 E;  1X5W A;  2DRP A;  5AAS A;  3HPS A;  4M30 A;  4JI8 E;  5KL2 A;  4DR3 E;  2EOR A;  1EKZ A;  2UUC E;  2HGH A;  1RMD A;  4O4K A;  2YU5 A;  4DR1 E;  2EM5 A;  4YHH E;  2EMI A;  3HPZ A;  4WXD A;  1XMQ E;  2YTD A;  2RQL A;  1UHZ A;  5A6J A;  2F8B A;  3MSW A;  4GKK E;  4OOG C;  3IWD A;  2V85 A;  1ZR9 A;  2R76 A;  3LML A;  4LF4 E;  1YYO A;  4DUY E;  2EOH A;  2V83 A;  3ADG A;  4DR5 E;  2E1M A;  4R8O A;  2EZ6 A;  2EL5 A;  2N3G A;  5AC4 A;  2LO3 A;  2IHR 1;  2B7V A;  2UU9 E;  1HNX E;  2UXC E;  3DJW A;  2YTQ A;  1X6E A;  2UXD E;  4DV3 E;  1YYW A;  2EQ0 A;  2N8X A;  1F2I G;  1X49 A;  1EH7 A;  1A1G A;  3VYY A;  1A1F A;  2LV2 A;  2EN7 A;  1JK2 A;  2LUQ A;  4LFB E;  4X66 E;  4ZYH A;  1IMU A;  1J5E E;  2EOS A;  2JR1 A;  3C6K A;  2A25 A;  1YSA C;  4KZS A;  4JI3 E;  4DV6 E;  2ODR C;  5ADZ A;  3AV0 A;  2CT1 A;  3DF6 A;  3EQ1 A;  2B9D A;  4BS9 A;  5T6J A;  1LLM C;  1IBL E;  2ZM6 E;  3JU0 A;  1RC7 A;  1G2D C;  1WHQ A;  2ODR D;  4LTY A;  1YUJ A;  4DR7 E;  5IV8 B;  3VHT B;  4NZV A;  2NAB A;  1X47 A;  1X6F A;  2DB2 A;  2EPM X;  1JK1 A;  2B3T B;  2VE7 C;  4GZN C;  2JOX A;  2MKN A;  4DV1 E;  4RHB B;  3T1Y E;  1NCS A;  2EMF A;  4N4R B;  1O0W A;  2E72 A;  2LUP B;  2EMY A;  3FIG A;  2EOZ A;  1QNT A;  2MC6 A;  2MKD A;  2UUB E;  3KZZ A;  2EWL A;  4DV0 E;  4OX9 E;  2YTO A;  3KZY A;  1T4L B;  2LVH A;  3HXL A;  1EH6 A;  2UUA E;  2JWO A;  1YPN A;  2FTX B;  3JTZ A;  5LMU E;  2LTR A;  4DR2 E;  3AUZ A;  3EPL A;  2YT4 A;  3TQM A;  5KL5 A;  4NXN E;  4JI6 E;  2EL4 A;  3J7Y p;  2YSO A;  2EMB A;  1N36 E;  2E5L E;  2RS7 A;  4M0V A;  2YTN A;  2EN4 A;  4HEI A;  2EMH A;  5LLQ A;  2RS6 A;  5TSE A;  4BHB A;  5A6B A;  4X64 E;  2WBT A;  4JI4 E;  3EPH A;  2KON A;  4L5N C;  2YRK A;  2L3C A;  4BHC A;  2JVA A;  4IJD A;  5CFF E;  1P47 A;  2EPR A;  1IQS A;  1SFE A;  2PRT A;  4MLV A;  3EPJ A;  4JI7 E;  2V89 A;  2EPU A;  1QU6 A;  1DGC A;  1TF3 A;  2EMC A;  2ENC A;  5IWA E;  2EOM A;  2EOO A;  2LE2 A;  2JYA A;  2LBS B;  1GTK A;  2EP3 A;  2JOB A;  3OTO E;  3H09 A;  2EMX A;  3BBG A;  5KL4 A;  2RTX A;  3IWC A;  3EPK A;  2I9I A;  1A1I A;  1ZBT A;  1T38 A;  3F6H A;  4NXM E;  5IT9 C;  2B7T A;  3ZOQ B;  2HJJ A;  1EH8 A;  4BCA A;  4YY3 E;  4X8W A;  3C6M A;  5AE3 A;  4JI2 E;  2EM9 A;  1XMO E;  3T1H E;  4FK5 C;  4DUZ E;  1TF6 A;  4MLQ A;  1T4O A;  2EML A;  4JI0 E;  2EMG A;  1UN6 B;  3C4B A;  3RMP A;  4K0K E;  2YTI A; 
#chains in the Genus database with same CATH homology
 5IXM B;  2R76 A;  4RHB B;  4N4R B;  4RH8 A;  4NHR A;  5TSE A;  5IV8 B;  4Q35 B;  3BF2 A;  2JXP A;  2N8X A;  4KWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...