2DSYA

Crystal structure of ttha0281 from thermus thermophilus hb8
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
GMGTLTRYLEEAMARARYELIADEEPYYGEIPDLPGVWATGKSLKECEANLQAALEDWLLFLLSRGETPPPLGEVRIELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TTHA0281
publication title Structure of a UPF0150-family protein from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 21
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dsyA00
4P7DA 2DSYA 2YZTA 4P78A 3KWRA
chains in the Genus database with same CATH superfamily
1YFHA 5FLXC 2YRHA 5F3WA 1BBOA 3BIDA 1T4NA 4M9VC 2EPZA 2EN3A 2JVAA 1N3GA 3QG5C 4L8NA 2EMIA 4NXNE 2LRSA 2NABA 2YPNA 3JAMC 5LMUE 2EJ4A 3C4BA 1IBME 4DV5E 1X6EA 2DMIA 4M2ZA 2YTPA 4F2JC 3IWCA 2Q8UA 2CPNA 2EPRA 1N32E 1ZU1A 1EH8A 2EMZA 2LTSA 4BBYA 2ELZA 2GPIA 2I9IA 2G7HA 1G2DC 1ZAAC 3J7AG 2LT7A 5T6JA 4B3ME 5A69A 5TSEA 1N33E 4DV7E 1BB8A 2FGGA 3BBGA 1SFEA 4DR2E 5AASA 3HPSA 4M30A 5A6BA 3FIGA 1UN6B 5KL3A 2JY9A 4B3TE 4BHCA 3MHSC 4RH8A 5KL4A 3ADJA 5IV8B 1X47A 3JTZA 3MHHC 2EN6A 2EMAA 2V86A 1JK2A 2NUEA 2V89A 4RHBB 1DGCA 3AV0A 2YTEA 4JV5E 1F2IG 2LE2A 4YHHE 1N36E 1X6HA 1PJTA 4J8ZA 4WSGA 2MKDA 4KWYA 2JWOA 4B3SE 1IQSA 2YT4A 2DIXA 2DGCA 2EPPA 2E5LE 2KONA 1EH6A 1O0WA 4JI0E 1XNRE 2V85A 3ADIA 2WCC3 5LL6R 4LTYA 3VYXA 1FKAE 1L4SA 1A1IA 5LMNE 1IQOA 4X64E 5IXMB 1HR0E 3C4TA 2YSOA 2EMYA 2LJUA 1FJGE 2B9DA 1LLMC 4JI5E 4DR7E 1YPNA 4X9JA 5A6AA 4WFTA 4DR6E 4F54A 2FV4B 2R1FA 3ECRA 4WXCA 3MSWA 4LFBE 2GHFA 1YUIA 2KHXA 2JR1A 4TUIA 1X48A 4JI2E 3DJWA 5A6KA 3VYYA 4DV6E 2MKNA 2JP9A 2YRKA 1HNZE 3EPLA 3C6KA 2HGHA 2EMGA 2ELYA 2YTJA 2LUQA 4L5NC 4O4KA 4IJDA 3LMLA 4AQYE 2YU5A 3HTXA 1XMOE 2B3TB 2V88A 1YUJA 2A25A 4OOGC 1UBDC 4GZNC 2EOEA 1BBGA 4JI8E 3F6HA 2WBSA 4WYQB 4R2QA 2R76A 4R2DA 2EMLA 2FTXB 2LJHA 4BC9A 2V8QB 2UXDE 5KL2A 2HHHE 2EM3A 2EOIA 3ADLA 2EMBA 2YZTA 2L2KB 2YRMA 4LF4E 4DR5E 1Z1BA 2EM8A 2EOYA 2YTFA 5LLQA 1ZBTA 4Q28A 1WRJA 2YTDA 5KL6A 4GEQB 2RQLA 4DMIA 3DF6A 3VK6A 3J81C 2EN1A 2ENAA 2EPMX 4HEIA 4WX9A 2V83A 2EPXA 3H09A 4F6MA 2WBUA 1PDAA 1X3CA 4X66E 3EPJA 4DV4E 2RTXA 2VQEE 2H36X 1DI2A 2YTGA 2D9HA 3EQ1A 2F4VE 1WJPA 4B3RE 2L92A 1YYOA 2EM7A 2E72A 2RS7A 2EMCA 2M1SA 2K7IA 4HTGA 4NHRA 2NUFA 2JXPA 4P78A 1YYKA 4JYAE 4KHPE 2M7QA 4TUGA 2YTQA 2ENHA 4R2RA 1EKZA 1DQ3A 2DB2A 2EMFA 2YWQA 2EN4A 2LV2A 1A1FA 2EE8A 2BBGA 2WBTA 2L3CA 4R03A 1GQEA 2VRDA 2EMHA 4F9BB 2EL6A 2EPOA 2UU9E 4LFCE 1NEIA 2EN7A 1A1JA 5IWAE 3VHTB 3J7Yp 4GKJE 2MDGA 2WZOA 1X5WA 1PKPA 1QU6A 2LTRA 2EOSA 3T1HE 4JI6E 2DLQA 4X8WA 4IS1C 2EQ0A 2EPAA 4DV2E 4ZYHA 1QNTA 3LLHA 4MLQA 5A6BD 4JI1E 4DV1E 2L3JA 1RQ0A 2DRPA 2BB8A 4M0VA 2ENCA 1XMQE 2JPAA 2VF1A 2I13A 2VE7C 2JYAA 4F9CB 4BC7A 4DUZE 3EPHA 4ZYGA 1T38A 5AE3A 1IBKE 2L2NA 4BCAA 1YSAC 2L6MA 1UILA 1WXRA 1IBLE 2LMZA 2N3GA 2LO3A 2EL4A 3BGHA 4R8OA 4JI4E 4O43A 2EL5A 4LF5E 3K6QA 4NZVA 2ODRC 2EMWA 5ADZA 1YZ9A 2E1MA 1G2FC 1AAYA 1TF6A 1X6FA 1HNXE 4O5GA 1T4LB 2N3HA 2HC5A 2EORA 4X62E 1AH5A 2L33A 1YYWA 1STUA 2EM4A 3AUZA 1WHQA 2EQ3A 4DKKA 2LBSB 2CTDA 2V87A 1XNQE 3HPZA 3IWDA 4ZYEA 1RMDA 2EOFA 1T39A 4GKKE 2EM6A 2YTNA 3L00A 2YU8A 2NA2A 2EPNA 2ZM6E 1KYQA 2JOXA 4DUYE 4ZYDA 1RC7A 5DNYA 2EN8A 2IHR1 1WHNA 2UUCE 2GLIA 2EM0A 4O24A 1NCSA 1ZR9A 1A1LA 2EPLX 2YSPA 2KOUA 4BS9A 4DR1E 1I94E 1A1HA 3KWRA 2L2MA 5KL7A 2MC5A 2RSMA 2EOXA 4KZSA 4JI3E 2RPCA 2EWLA 2EPKX 1UHZA 1HNWE 2M4IA 4JI7E 3ZOQB 5AE2A 5AC5A 2M9AA 5IT9C 2EOOA 4OX9E 2UUBE 1TN9A 1J5EE 1B69A 4DV0E 4F6NA 4R2AA 4R2CA 2UXBE 3C6MA 5AE1A 3RMPA 1GZ6A 2ADRA 4R2EA 1P47A 3J80C 1GTKA 3THOB 4LF7E 1A1GA 2NUGA 5A6JA 2N8XA 2MC6A 4K0KE 2EM2A 2EOZA 4LF9E 2ODRD 2LVHA 2EQ1A 4X65E 4N4RB 2EPCA 3OMLA 3TQMA 4YY3E 1EH7A 2YTOA 2RS6A 2PRTA 5KL5A 2EN2A 2B7VA 3KZYA 3OTOE 2VQFE 2J7JA 2RSIA 4R2PA 3F6GA 3IWBA 2EOQA 2CSHA 4LF8E 1IMUA 3UK3C 1A1KA 2EMKA 4F9AB 3HXLA 4LFAE 3THNA 2DSYA 4BHBA 4FK5C 4Q35B 1TF3A 1SR9A 3KZZA 2EM5A 1MEYC 4LF6E 2EOHA 4I8OA 2K4VA 3T1YE 4LU9A 2UUAE 2EPUA 4DR4E 3ADGA 1T4OA 1MGTA 5A2QC 4P7DA 4WXDA 4MLVA 2LUPB 3M99B 2B7TA 1J26A 2CT1A 2F8BA 2EM9A 3EPKA 4NXME 2EOJA 2HJJA 4WPYA 4DR3E 2EZ6A 1JK1A 2UXCE 3P1XA 1PJQA 2EOMA 3BF2A 4DV3E 4R2SA 4WSPA 5CFFE 2JOBA 1PJSA 1ZBQA 4BMJA 5BR8E 1N34E 2LCEA 2YTIA 2L8TA 1X49A 3HQ1A 5AC4A 2DLKA 1KJKA 2DMYA 2EP3A 2MDRA 3JU0A 2EMXA
chains in the Genus database with same CATH topology
4R03A 1GQEA 2M4IA 4JI7E 3ZOQB 2KHXA 2JR1A 5AE2A 1X48A 5FLXC 4TUIA 3DJWA 4JI2E 5F3WA 3VYYA 4DV6E 4F9BB 5IT9C 1T4NA 1HNZE 2UUBE 4OX9E 1J5EE 2UU9E 4LFCE 2JVAA 4DV0E 5IWAE 4L8NA 3J7Yp 4NXNE 4GKJE 2LRSA 2UXBE 2WZOA 5AE1A 1GZ6A 3RMPA 1PKPA 1QU6A 2LTRA 3JAMC 3J80C 3C4BA 5LMUE 3T1HE 4JI6E 4X8WA 2LUQA 4L5NC 1IBME 4LF7E 2NUGA 3LMLA 4DV5E 4DV2E 2MC6A 4K0KE 4M2ZA 3LLHA 4AQYE 4DV1E 4JI1E 3IWCA 2L3JA 2CPNA 3HTXA 1RQ0A 1N32E 4LF9E 2ODRD 2LTSA 1XMOE 4M0VA 4BBYA 1XMQE 2B3TB 2V88A 2VF1A 2G7HA 3J7AG 4X65E 4OOGC 5T6JA 2VE7C 4B3ME 4F9CB 3OMLA 4BC7A 4YY3E 4DUZE 4JI8E 2RS6A 5AE3A 1IBKE 4DV7E 1N33E 2L2NA 3F6HA 4WYQB 2L6MA 1UILA 4BCAA 2FGGA 2LMZA 1WXRA 1IBLE 2B7VA 2N3GA 2FTXB 2LJHA 3OTOE 2VQFE 4BC9A 4DR2E 5AASA 3F6GA 2V8QB 4R8OA 3IWBA 4JI4E 3HPSA 4M30A 2UXDE 3FIGA 4LF8E 2HHHE 3ADLA 2L2KB 2YZTA 4LF5E 2JY9A 3K6QA 1XNRE 4B3TE 4F9AB 3HXLA 4LF4E 2ODRC 4DR5E 5ADZA 4LFAE 1YZ9A 2DSYA 2E1MA 1ZBTA 4Q28A 1HNXE 1SR9A 4GEQB 1HNWE 4DMIA 1T4LB 3ADJA 2N3HA 3DF6A 1X47A 3JTZA 3VK6A 4LF6E 4X62E 3J81C 4I8OA 2K4VA 2L33A 2V86A 1YYWA 1STUA 3AUZA 4DKKA 1WHQA 2V89A 3T1YE 2NUEA 3AV0A 4LU9A 2LBSB 2UUAE 4JV5E 2V83A 2LE2A 4DR4E 3ADGA 2V87A 1T4OA 3H09A 1XNQE 4YHHE 4X66E 3HPZA 1N36E 4DV4E 5A2QC 4P7DA 3IWDA 4J8ZA 2RTXA 2VQEE 2H36X 2LUPB 1DI2A 2JWOA 4B3SE 4GKKE 2YT4A 2F4VE 2DIXA 4B3RE 2L92A 2NA2A 2B7TA 2KONA 1YYOA 2E5LE 1J26A 1O0WA 2F8BA 2ZM6E 4JI0E 2JOXA 2V85A 4WPYA 4DR3E 4NXME 4DUYE 5LL6R 1RC7A 2EZ6A 3ADIA 2RS7A 5DNYA 2UXCE 4LTYA 2IHR1 3P1XA 1WHNA 2UUCE 3VYXA 1FKAE 2M1SA 5LMNE 4X64E 4DV3E 2NUFA 1HR0E 3C4TA 4WSPA 5CFFE 2JOBA 2KOUA 4P78A 4BS9A 4DR1E 1I94E 1YYKA 3KWRA 2L2MA 1FJGE 2B9DA 2M7QA 4JI5E 4TUGA 4DR7E 4JYAE 4KHPE 1ZBQA 2MC5A 4BMJA 2RSMA 4KZSA 4JI3E 1EKZA 4WFTA 1DQ3A 5BR8E 2DB2A 1N34E 4DR6E 4F54A 2FV4B 2L8TA 1X49A 3HQ1A 2EWLA 3MSWA 2DMYA 1UHZA 2MDRA 3JU0A 2L3CA 4LFBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7D A;  2DSY A;  2YZT A;  4P78 A;  3KWR A; 
#chains in the Genus database with same CATH topology
 1YFH A;  5FLX C;  2YRH A;  5F3W A;  1BBO A;  3BID A;  1T4N A;  4M9V C;  2EPZ A;  2EN3 A;  2JVA A;  1N3G A;  3QG5 C;  4L8N A;  2EMI A;  4NXN E;  2LRS A;  2NAB A;  2YPN A;  3JAM C;  5LMU E;  2EJ4 A;  3C4B A;  1IBM E;  4DV5 E;  1X6E A;  2DMI A;  4M2Z A;  2YTP A;  4F2J C;  3IWC A;  2Q8U A;  2CPN A;  2EPR A;  1N32 E;  1ZU1 A;  1EH8 A;  2EMZ A;  2LTS A;  4BBY A;  2ELZ A;  2GPI A;  2I9I A;  2G7H A;  1G2D C;  1ZAA C;  3J7A G;  2LT7 A;  5T6J A;  4B3M E;  5A69 A;  5TSE A;  1N33 E;  4DV7 E;  1BB8 A;  2FGG A;  3BBG A;  1SFE A;  4DR2 E;  5AAS A;  3HPS A;  4M30 A;  5A6B A;  3FIG A;  1UN6 B;  5KL3 A;  2JY9 A;  4B3T E;  4BHC A;  3MHS C;  4RH8 A;  5KL4 A;  3ADJ A;  5IV8 B;  1X47 A;  3JTZ A;  3MHH C;  2EN6 A;  2EMA A;  2V86 A;  1JK2 A;  2NUE A;  2V89 A;  4RHB B;  1DGC A;  3AV0 A;  2YTE A;  4JV5 E;  1F2I G;  2LE2 A;  4YHH E;  1N36 E;  1X6H A;  1PJT A;  4J8Z A;  4WSG A;  2MKD A;  4KWY A;  2JWO A;  4B3S E;  1IQS A;  2YT4 A;  2DIX A;  2DGC A;  2EPP A;  2E5L E;  2KON A;  1EH6 A;  1O0W A;  4JI0 E;  1XNR E;  2V85 A;  3ADI A;  2WCC 3;  5LL6 R;  4LTY A;  3VYX A;  1FKA E;  1L4S A;  1A1I A;  5LMN E;  1IQO A;  4X64 E;  5IXM B;  1HR0 E;  3C4T A;  2YSO A;  2EMY A;  2LJU A;  1FJG E;  2B9D A;  1LLM C;  4JI5 E;  4DR7 E;  1YPN A;  4X9J A;  5A6A A;  4WFT A;  4DR6 E;  4F54 A;  2FV4 B;  2R1F A;  3ECR A;  4WXC A;  3MSW A;  4LFB E;  2GHF A;  1YUI A;  2KHX A;  2JR1 A;  4TUI A;  1X48 A;  4JI2 E;  3DJW A;  5A6K A;  3VYY A;  4DV6 E;  2MKN A;  2JP9 A;  2YRK A;  1HNZ E;  3EPL A;  3C6K A;  2HGH A;  2EMG A;  2ELY A;  2YTJ A;  2LUQ A;  4L5N C;  4O4K A;  4IJD A;  3LML A;  4AQY E;  2YU5 A;  3HTX A;  1XMO E;  2B3T B;  2V88 A;  1YUJ A;  2A25 A;  4OOG C;  1UBD C;  4GZN C;  2EOE A;  1BBG A;  4JI8 E;  3F6H A;  2WBS A;  4WYQ B;  4R2Q A;  2R76 A;  4R2D A;  2EML A;  2FTX B;  2LJH A;  4BC9 A;  2V8Q B;  2UXD E;  5KL2 A;  2HHH E;  2EM3 A;  2EOI A;  3ADL A;  2EMB A;  2YZT A;  2L2K B;  2YRM A;  4LF4 E;  4DR5 E;  1Z1B A;  2EM8 A;  2EOY A;  2YTF A;  5LLQ A;  1ZBT A;  4Q28 A;  1WRJ A;  2YTD A;  5KL6 A;  4GEQ B;  2RQL A;  4DMI A;  3DF6 A;  3VK6 A;  3J81 C;  2EN1 A;  2ENA A;  2EPM X;  4HEI A;  4WX9 A;  2V83 A;  2EPX A;  3H09 A;  4F6M A;  2WBU A;  1PDA A;  1X3C A;  4X66 E;  3EPJ A;  4DV4 E;  2RTX A;  2VQE E;  2H36 X;  1DI2 A;  2YTG A;  2D9H A;  3EQ1 A;  2F4V E;  1WJP A;  4B3R E;  2L92 A;  1YYO A;  2EM7 A;  2E72 A;  2RS7 A;  2EMC A;  2M1S A;  2K7I A;  4HTG A;  4NHR A;  2NUF A;  2JXP A;  4P78 A;  1YYK A;  4JYA E;  4KHP E;  2M7Q A;  4TUG A;  2YTQ A;  2ENH A;  4R2R A;  1EKZ A;  1DQ3 A;  2DB2 A;  2EMF A;  2YWQ A;  2EN4 A;  2LV2 A;  1A1F A;  2EE8 A;  2BBG A;  2WBT A;  2L3C A;  4R03 A;  1GQE A;  2VRD A;  2EMH A;  4F9B B;  2EL6 A;  2EPO A;  2UU9 E;  4LFC E;  1NEI A;  2EN7 A;  1A1J A;  5IWA E;  3VHT B;  3J7Y p;  4GKJ E;  2MDG A;  2WZO A;  1X5W A;  1PKP A;  1QU6 A;  2LTR A;  2EOS A;  3T1H E;  4JI6 E;  2DLQ A;  4X8W A;  4IS1 C;  2EQ0 A;  2EPA A;  4DV2 E;  4ZYH A;  1QNT A;  3LLH A;  4MLQ A;  5A6B D;  4JI1 E;  4DV1 E;  2L3J A;  1RQ0 A;  2DRP A;  2BB8 A;  4M0V A;  2ENC A;  1XMQ E;  2JPA A;  2VF1 A;  2I13 A;  2VE7 C;  2JYA A;  4F9C B;  4BC7 A;  4DUZ E;  3EPH A;  4ZYG A;  1T38 A;  5AE3 A;  1IBK E;  2L2N A;  4BCA A;  1YSA C;  2L6M A;  1UIL A;  1WXR A;  1IBL E;  2LMZ A;  2N3G A;  2LO3 A;  2EL4 A;  3BGH A;  4R8O A;  4JI4 E;  4O43 A;  2EL5 A;  4LF5 E;  3K6Q A;  4NZV A;  2ODR C;  2EMW A;  5ADZ A;  1YZ9 A;  2E1M A;  1G2F C;  1AAY A;  1TF6 A;  1X6F A;  1HNX E;  4O5G A;  1T4L B;  2N3H A;  2HC5 A;  2EOR A;  4X62 E;  1AH5 A;  2L33 A;  1YYW A;  1STU A;  2EM4 A;  3AUZ A;  1WHQ A;  2EQ3 A;  4DKK A;  2LBS B;  2CTD A;  2V87 A;  1XNQ E;  3HPZ A;  3IWD A;  4ZYE A;  1RMD A;  2EOF A;  1T39 A;  4GKK E;  2EM6 A;  2YTN A;  3L00 A;  2YU8 A;  2NA2 A;  2EPN A;  2ZM6 E;  1KYQ A;  2JOX A;  4DUY E;  4ZYD A;  1RC7 A;  5DNY A;  2EN8 A;  2IHR 1;  1WHN A;  2UUC E;  2GLI A;  2EM0 A;  4O24 A;  1NCS A;  1ZR9 A;  1A1L A;  2EPL X;  2YSP A;  2KOU A;  4BS9 A;  4DR1 E;  1I94 E;  1A1H A;  3KWR A;  2L2M A;  5KL7 A;  2MC5 A;  2RSM A;  2EOX A;  4KZS A;  4JI3 E;  2RPC A;  2EWL A;  2EPK X;  1UHZ A;  1HNW E;  2M4I A;  4JI7 E;  3ZOQ B;  5AE2 A;  5AC5 A;  2M9A A;  5IT9 C;  2EOO A;  4OX9 E;  2UUB E;  1TN9 A;  1J5E E;  1B69 A;  4DV0 E;  4F6N A;  4R2A A;  4R2C A;  2UXB E;  3C6M A;  5AE1 A;  3RMP A;  1GZ6 A;  2ADR A;  4R2E A;  1P47 A;  3J80 C;  1GTK A;  3THO B;  4LF7 E;  1A1G A;  2NUG A;  5A6J A;  2N8X A;  2MC6 A;  4K0K E;  2EM2 A;  2EOZ A;  4LF9 E;  2ODR D;  2LVH A;  2EQ1 A;  4X65 E;  4N4R B;  2EPC A;  3OML A;  3TQM A;  4YY3 E;  1EH7 A;  2YTO A;  2RS6 A;  2PRT A;  5KL5 A;  2EN2 A;  2B7V A;  3KZY A;  3OTO E;  2VQF E;  2J7J A;  2RSI A;  4R2P A;  3F6G A;  3IWB A;  2EOQ A;  2CSH A;  4LF8 E;  1IMU A;  3UK3 C;  1A1K A;  2EMK A;  4F9A B;  3HXL A;  4LFA E;  3THN A;  2DSY A;  4BHB A;  4FK5 C;  4Q35 B;  1TF3 A;  1SR9 A;  3KZZ A;  2EM5 A;  1MEY C;  4LF6 E;  2EOH A;  4I8O A;  2K4V A;  3T1Y E;  4LU9 A;  2UUA E;  2EPU A;  4DR4 E;  3ADG A;  1T4O A;  1MGT A;  5A2Q C;  4P7D A;  4WXD A;  4MLV A;  2LUP B;  3M99 B;  2B7T A;  1J26 A;  2CT1 A;  2F8B A;  2EM9 A;  3EPK A;  4NXM E;  2EOJ A;  2HJJ A;  4WPY A;  4DR3 E;  2EZ6 A;  1JK1 A;  2UXC E;  3P1X A;  1PJQ A;  2EOM A;  3BF2 A;  4DV3 E;  4R2S A;  4WSP A;  5CFF E;  2JOB A;  1PJS A;  1ZBQ A;  4BMJ A;  5BR8 E;  1N34 E;  2LCE A;  2YTI A;  2L8T A;  1X49 A;  3HQ1 A;  5AC4 A;  2DLK A;  1KJK A;  2DMY A;  2EP3 A;  2MDR A;  3JU0 A;  2EMX A; 
#chains in the Genus database with same CATH homology
 4R03 A;  1GQE A;  2M4I A;  4JI7 E;  3ZOQ B;  2KHX A;  2JR1 A;  5AE2 A;  1X48 A;  5FLX C;  4TUI A;  3DJW A;  4JI2 E;  5F3W A;  3VYY A;  4DV6 E;  4F9B B;  5IT9 C;  1T4N A;  1HNZ E;  2UUB E;  4OX9 E;  1J5E E;  2UU9 E;  4LFC E;  2JVA A;  4DV0 E;  5IWA E;  4L8N A;  3J7Y p;  4NXN E;  4GKJ E;  2LRS A;  2UXB E;  2WZO A;  5AE1 A;  1GZ6 A;  3RMP A;  1PKP A;  1QU6 A;  2LTR A;  3JAM C;  3J80 C;  3C4B A;  5LMU E;  3T1H E;  4JI6 E;  4X8W A;  2LUQ A;  4L5N C;  1IBM E;  4LF7 E;  2NUG A;  3LML A;  4DV5 E;  4DV2 E;  2MC6 A;  4K0K E;  4M2Z A;  3LLH A;  4AQY E;  4DV1 E;  4JI1 E;  3IWC A;  2L3J A;  2CPN A;  3HTX A;  1RQ0 A;  1N32 E;  4LF9 E;  2ODR D;  2LTS A;  1XMO E;  4M0V A;  4BBY A;  1XMQ E;  2B3T B;  2V88 A;  2VF1 A;  2G7H A;  3J7A G;  4X65 E;  4OOG C;  5T6J A;  2VE7 C;  4B3M E;  4F9C B;  3OML A;  4BC7 A;  4YY3 E;  4DUZ E;  4JI8 E;  2RS6 A;  5AE3 A;  1IBK E;  4DV7 E;  1N33 E;  2L2N A;  3F6H A;  4WYQ B;  2L6M A;  1UIL A;  4BCA A;  2FGG A;  2LMZ A;  1WXR A;  1IBL E;  2B7V A;  2N3G A;  2FTX B;  2LJH A;  3OTO E;  2VQF E;  4BC9 A;  4DR2 E;  5AAS A;  3F6G A;  2V8Q B;  4R8O A;  3IWB A;  4JI4 E;  3HPS A;  4M30 A;  2UXD E;  3FIG A;  4LF8 E;  2HHH E;  3ADL A;  2L2K B;  2YZT A;  4LF5 E;  2JY9 A;  3K6Q A;  1XNR E;  4B3T E;  4F9A B;  3HXL A;  4LF4 E;  2ODR C;  4DR5 E;  5ADZ A;  4LFA E;  1YZ9 A;  2DSY A;  2E1M A;  1ZBT A;  4Q28 A;  1HNX E;  1SR9 A;  4GEQ B;  1HNW E;  4DMI A;  1T4L B;  3ADJ A;  2N3H A;  3DF6 A;  1X47 A;  3JTZ A;  3VK6 A;  4LF6 E;  4X62 E;  3J81 C;  4I8O A;  2K4V A;  2L33 A;  2V86 A;  1YYW A;  1STU A;  3AUZ A;  4DKK A;  1WHQ A;  2V89 A;  3T1Y E;  2NUE A;  3AV0 A;  4LU9 A;  2LBS B;  2UUA E;  4JV5 E;  2V83 A;  2LE2 A;  4DR4 E;  3ADG A;  2V87 A;  1T4O A;  3H09 A;  1XNQ E;  4YHH E;  4X66 E;  3HPZ A;  1N36 E;  4DV4 E;  5A2Q C;  4P7D A;  3IWD A;  4J8Z A;  2RTX A;  2VQE E;  2H36 X;  2LUP B;  1DI2 A;  2JWO A;  4B3S E;  4GKK E;  2YT4 A;  2F4V E;  2DIX A;  4B3R E;  2L92 A;  2NA2 A;  2B7T A;  2KON A;  1YYO A;  2E5L E;  1J26 A;  1O0W A;  2F8B A;  2ZM6 E;  4JI0 E;  2JOX A;  2V85 A;  4WPY A;  4DR3 E;  4NXM E;  4DUY E;  5LL6 R;  1RC7 A;  2EZ6 A;  3ADI A;  2RS7 A;  5DNY A;  2UXC E;  4LTY A;  2IHR 1;  3P1X A;  1WHN A;  2UUC E;  3VYX A;  1FKA E;  2M1S A;  5LMN E;  4X64 E;  4DV3 E;  2NUF A;  1HR0 E;  3C4T A;  4WSP A;  5CFF E;  2JOB A;  2KOU A;  4P78 A;  4BS9 A;  4DR1 E;  1I94 E;  1YYK A;  3KWR A;  2L2M A;  1FJG E;  2B9D A;  2M7Q A;  4JI5 E;  4TUG A;  4DR7 E;  4JYA E;  4KHP E;  1ZBQ A;  2MC5 A;  4BMJ A;  2RSM A;  4KZS A;  4JI3 E;  1EKZ A;  4WFT A;  1DQ3 A;  5BR8 E;  2DB2 A;  1N34 E;  4DR6 E;  4F54 A;  2FV4 B;  2L8T A;  1X49 A;  3HQ1 A;  2EWL A;  3MSW A;  2DMY A;  1UHZ A;  2MDR A;  3JU0 A;  2L3C A;  4LFB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...