2DSYA

Crystal structure of ttha0281 from thermus thermophilus hb8
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
GMGTLTRYLEEAMARARYELIADEEPYYGEIPDLPGVWATGKSLKECEANLQAALEDWLLFLLSRGETPPPLGEVRIELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a UPF0150-family protein from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA0281
total genus 21
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dsyA00
3KWRA 2DSYA 2YZTA 4P78A 4P7DA
chains in the Genus database with same CATH superfamily
5KL6A 4LFAE 1DQ3A 5TSEA 1ZBQA 1IBME 2L3JA 1WHNA 2EQ0A 2EN7A 1I94E 2EMFA 2EQ3A 5A6KA 1DGCA 4LF5E 1HNXE 2EPMX 3C6KA 2EN2A 2V87A 2YWQA 1Z1BA 2F4VE 4LTYA 4X62E 2DLKA 4F9BB 4M2ZA 2EL5A 2VQFE 2K4VA 2L2KB 1PDAA 5ADZA 5KL2A 2ZM6E 1A1JA 3ADJA 2VF1A 2RSIA 4N4RB 4NHRA 2JY9A 2UUCE 2EN8A 2LE2A 1BB8A 2VE7C 3C4BA 4F6NA 1MEYC 4WX9A 1WXRA 2VRDA 2EPAA 4LF8E 4RHBB 1UN6B 4GEQB 3UK3C 1J5EE 1YYKA 4X9JA 3J81C 1HR0E 5IXMB 3KZYA 2LJUA 2EOOA 2MC6A 2FGGA 2LTSA 2WCC3 1NEIA 2LCEA 1X49A 1XNQE 2WZOA 2MC5A 1PJSA 3C4TA 3EPHA 2YTNA 4R2EA 4L5NC 2EPPA 4JI0E 2B9DA 2MKDA 2YTDA 2EOXA 2ODRD 2UXDE 4AQYE 2EOHA 4BC9A 4B3SE 2EMWA 3ZOQB 4KHPE 2V85A 2EM5A 2EOFA 2YRHA 2YTEA 4M30A 3VK6A 1X3CA 1A1GA 4IS1C 4F6MA 1J26A 2RS6A 2R76A 1EH7A 2G7HA 1T38A 1BBGA 3RMPA 2F8BA 2DB2A 1GZ6A 1JK1A 3LMLA 1G2FC 4B3TE 4IJDA 4KWYA 2M4IA 3M99B 2EL4A 1N33E 2GPIA 3HXLA 2FTXB 4GKKE 2YT4A 4GZNC 3T1YE 4NXNE 3BGHA 2YTIA 2WBSA 4TUGA 1TF6A 4JV5E 2EORA 2M7QA 2E72A 2EMHA 1N32E 2M9AA 1XMOE 4DV6E 2HGHA 1RQ0A 2EMIA 2EPUA 4DV4E 1ZU1A 2DLQA 1YUIA 1RMDA 3K6QA 1P47A 4Q28A 4RH8A 4WYQB 4M0VA 4OOGC 4JI4E 2Q8UA 3HQ1A 4DMIA 2EP3A 4DV7E 3TQMA 2NABA 4R2SA 5CFFE 2WBTA 3BIDA 2EPLX 4O5GA 2ENCA 1PJTA 2EN1A 4JI2E 4JI6E 2B7VA 1BBOA 4DUZE 2V8QB 2YTJA 4R2DA 4DV5E 5BR8E 2LBSB 4R03A 2YRMA 4WXCA 2LVHA 2EOYA 4B3ME 2EN6A 1YYOA 1RC7A 4X65E 4DV3E 2EMLA 2MKNA 5AC4A 2DMYA 2EM6A 2M1SA 4HTGA 1A1KA 2HC5A 4BHBA 2MDGA 1EKZA 2HHHE 3KWRA 2N3GA 5A6BA 1EH8A 3MHSC 4DR1E 1A1HA 1UILA 4R2CA 4LFBE 2RPCA 5KL5A 2UUBE 3AV0A 2EPNA 2EMXA 1AAYA 3HTXA 2EPOA 2JP9A 1HNZE 2CSHA 3LLHA 3ADIA 2V83A 2YTPA 2N3HA 2JVAA 3HPSA 4WPYA 4WSPA 2EMYA 2FV4B 3MHHC 3BBGA 2KOUA 3P1XA 2ADRA 4LF7E 4DR4E 2EM8A 2ENAA 4DV0E 2EOEA 4HEIA 3F6GA 3JAMC 2EMAA 2DMIA 4FK5C 2UUAE 2I9IA 2CT1A 2YTQA 4WXDA 1GTKA 1T4LB 3THNA 4Q35B 5AE1A 4DUYE 3JTZA 2EPRA 2EPCA 1SR9A 4R8OA 1WRJA 4R2AA 4DR3E 4BHCA 2LV2A 4LFCE 1IMUA 2BBGA 2L33A 3C6MA 2R1FA 4DR2E 5LLQA 4B3RE 2MDRA 2LT7A 1ZAAC 5IV8B 2JR1A 3ADLA 2JPAA 2LUQA 2LRSA 2L2NA 2EL6A 2EJ4A 4LU9A 1FKAE 1G2DC 2EM9A 2JXPA 1YSAC 2YU5A 2B3TB 5AC5A 3EPJA 4F9AB 2CPNA 4BMJA 2K7IA 3F6HA 2V89A 4ZYEA 2ODRC 5A69A 2VQEE 1B69A 2EZ6A 4F2JC 4O43A 4MLVA 1A1LA 4JI7E 3H09A 4BBYA 1IQSA 5A2QC 1YPNA 4I8OA 2JOXA 5LL6R 4ZYDA 1STUA 2B7TA 5LMUE 1IQOA 2V88A 4TUIA 1EH6A 1N3GA 2RTXA 2DIXA 1YUJA 1TN9A 2RQLA 5KL3A 2EOSA 2EWLA 2JWOA 4YY3E 4NXME 4BCAA 3HPZA 4ZYHA 1HNWE 3T1HE 2I13A 1F2IG 4JI8E 4F9CB 2EM3A 4LF4E 2YSPA 3EQ1A 3JU0A 2EOZA 4KZSA 2EOMA 3IWBA 2RSMA 2H36X 2EQ1A 5A6JA 4DV1E 4JYAE 2UXBE 3BF2A 4O24A 4JI3E 4GKJE 3QG5C 1X6FA 5AASA 2NUFA 4L8NA 1AH5A 4P7DA 4R2PA 1X47A 2LMZA 4X66E 3AUZA 2DSYA 4YHHE 2YSOA 4DV2E 5T6JA 2PRTA 5AE3A 2EM0A 3IWDA 1PJQA 1YYWA 4BC7A 2EM4A 1YFHA 2CTDA 1T39A 2A25A 2HJJA 2LTRA 1UBDC 1A1FA 2N8XA 5IT9C 2WBUA 3OMLA 2EMBA 2EPXA 2EM7A 2IHR1 2L92A 3J7Yp 4MLQA 2ELZA 1YZ9A 4LF6E 5LMNE 2KONA 5F3WA 4X64E 2LUPB 5AE2A 2LO3A 2L2MA 3DJWA 1XNRE 4O4KA 5DNYA 4OX9E 2YTGA 2V86A 4M9VC 3VHTB 5A6AA 2GHFA 1T4OA 4F54A 1L4SA 2L3CA 1NCSA 1N36E 4WFTA 2E1MA 5FLXC 2RS7A 4X8WA 3VYYA 1X6HA 1A1IA 2ELYA 2EN3A 1X6EA 1IBLE 3L00A 5KL7A 1QU6A 2EN4A 1QNTA 3J80C 1KJKA 3MSWA 1SFEA 2E5LE 1WJPA 2YU8A 2DRPA 2UXCE 4JI5E 2YZTA 1PKPA 2EM2A 3IWCA 2EOIA 3ECRA 2LJHA 1XMQE 1GQEA 2EE8A 4P78A 3OTOE 1DI2A 2EMZA 1X48A 3THOB 4DR6E 2DGCA 4R2RA 2NA2A 2EMGA 1N34E 2EOQA 2KHXA 4R2QA 2GLIA 1O0WA 1MGTA 2L8TA 3ADGA 4DR7E 2NUEA 5A6BD 2EPKX 5KL4A 3EPLA 2L6MA 1ZR9A 3FIGA 2BB8A 2J7JA 2JOBA 4NZVA 1WHQA 4ZYGA 1ZBTA 3J7AG 1UHZA 4J8ZA 2JYAA 2NUGA 4DKKA 1TF3A 1LLMC 4DR5E 5IWAE 3VYXA 2YRKA 4JI1E 2D9HA 2EMKA 3EPKA 3KZZA 2UU9E 4WSGA 2EPZA 2EMCA 1IBKE 1KYQA 4LF9E 4K0KE 2YTOA 1T4NA 2EOJA 2YPNA 1JK2A 2YTFA 3DF6A 1X5WA 2ENHA 1FJGE 4BS9A
chains in the Genus database with same CATH topology
2M7QA 4DUYE 3JTZA 1YYWA 4BC7A 1N32E 1XMOE 1SR9A 2LTRA 4R8OA 4LFAE 1DQ3A 4DV6E 1ZBQA 5IT9C 2L3JA 1WHNA 4DR3E 1IBME 1RQ0A 4LFCE 3OMLA 2IHR1 2L92A 1I94E 4DV4E 4GKKE 3J7Yp 4LF5E 2L33A 1HNXE 4DR2E 4B3RE 2MDRA 2V87A 2F4VE 1YZ9A 4LF6E 4LTYA 4X62E 3K6QA 4Q28A 5LMNE 2KONA 5F3WA 4WYQB 4F9BB 4X64E 4M2ZA 2JR1A 2VQFE 5AE2A 2K4VA 2L2KB 2LUPB 3ADLA 2L2MA 3DJWA 4M0VA 5ADZA 5DNYA 2LUQA 2LRSA 2L2NA 3ADJA 2VF1A 2V86A 4OOGC 2ZM6E 4JI4E 3HQ1A 2JY9A 4LU9A 4DMIA 1FKAE 2UUCE 4DV7E 1T4OA 4F54A 2L3CA 2LE2A 1N36E 4WFTA 2E1MA 2VE7C 3C4BA 5CFFE 1WXRA 5FLXC 2RS7A 2B3TB 4LF8E 4X8WA 4F9AB 3VYYA 2CPNA 4GEQB 1YYKA 1J5EE 4BMJA 3J81C 1HR0E 3F6HA 1IBLE 4JI2E 4JI6E 2V89A 2ODRC 1QU6A 2B7VA 2VQEE 2MC6A 3J80C 2FGGA 2LTSA 2V8QB 4DUZE 4DV5E 2EZ6A 3MSWA 5BR8E 2E5LE 1X49A 2LBSB 2WZOA 4R03A 4JI7E 2MC5A 3H09A 4BBYA 1XNQE 3C4TA 2UXCE 5A2QC 4I8OA 4L5NC 4B3ME 4JI5E 4JI0E 2JOXA 5LL6R 2YZTA 1STUA 1PKPA 2B7TA 2B9DA 3IWCA 5LMUE 1YYOA 1RC7A 2LJHA 4X65E 4DV3E 2V88A 4TUIA 1XMQE 2ODRD 1GQEA 2DMYA 4P78A 1XNRE 2M1SA 2UXDE 3OTOE 4AQYE 1DI2A 2RTXA 4BC9A 2DIXA 4B3SE 1EKZA 2HHHE 3ZOQB 2EWLA 3KWRA 2N3GA 2JWOA 1X48A 2V85A 4YY3E 4DR1E 4NXME 4DR6E 4KHPE 1UILA 4LFBE 4BCAA 4M30A 3HPZA 3VK6A 1HNWE 2NA2A 3T1HE 2UUBE 1N34E 4JI8E 4F9CB 2KHXA 3AV0A 4LF4E 1O0WA 3JU0A 4KZSA 2L8TA 3HTXA 2RS6A 1J26A 3ADGA 1HNZE 2NUEA 3IWBA 4DR7E 2RSMA 2G7HA 2H36X 3LLHA 4DV1E 3ADIA 4JYAE 2L6MA 3RMPA 2V83A 2N3HA 3FIGA 2F8BA 2DB2A 2UXBE 1GZ6A 2JVAA 3LMLA 2JOBA 4B3TE 3HPSA 1WHQA 4JI3E 1ZBTA 4WPYA 1UHZA 4J8ZA 3J7AG 4GKJE 4WSPA 4OX9E 2NUGA 4DKKA 2FV4B 3VYXA 4DR5E 2KOUA 3P1XA 5AASA 5IWAE 4LF7E 2NUFA 4JI1E 4L8NA 2M4IA 4DR4E 2UU9E 4P7DA 1IBKE 1N33E 4DV0E 3HXLA 4LF9E 4K0KE 2FTXB 1X47A 1T4NA 2LMZA 2YT4A 3F6GA 3AUZA 2DSYA 3JAMC 4X66E 4YHHE 3T1YE 4DV2E 2UUAE 4NXNE 3DF6A 5T6JA 1T4LB 5AE3A 4TUGA 4JV5E 3IWDA 1FJGE 4BS9A 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWR A;  2DSY A;  2YZT A;  4P78 A;  4P7D A; 
#chains in the Genus database with same CATH topology
 5KL6 A;  4LFA E;  1DQ3 A;  5TSE A;  1ZBQ A;  1IBM E;  2L3J A;  1WHN A;  2EQ0 A;  2EN7 A;  1I94 E;  2EMF A;  2EQ3 A;  5A6K A;  1DGC A;  4LF5 E;  1HNX E;  2EPM X;  3C6K A;  2EN2 A;  2V87 A;  2YWQ A;  1Z1B A;  2F4V E;  4LTY A;  4X62 E;  2DLK A;  4F9B B;  4M2Z A;  2EL5 A;  2VQF E;  2K4V A;  2L2K B;  1PDA A;  5ADZ A;  5KL2 A;  2ZM6 E;  1A1J A;  3ADJ A;  2VF1 A;  2RSI A;  4N4R B;  4NHR A;  2JY9 A;  2UUC E;  2EN8 A;  2LE2 A;  1BB8 A;  2VE7 C;  3C4B A;  4F6N A;  1MEY C;  4WX9 A;  1WXR A;  2VRD A;  2EPA A;  4LF8 E;  4RHB B;  1UN6 B;  4GEQ B;  3UK3 C;  1J5E E;  1YYK A;  4X9J A;  3J81 C;  1HR0 E;  5IXM B;  3KZY A;  2LJU A;  2EOO A;  2MC6 A;  2FGG A;  2LTS A;  2WCC 3;  1NEI A;  2LCE A;  1X49 A;  1XNQ E;  2WZO A;  2MC5 A;  1PJS A;  3C4T A;  3EPH A;  2YTN A;  4R2E A;  4L5N C;  2EPP A;  4JI0 E;  2B9D A;  2MKD A;  2YTD A;  2EOX A;  2ODR D;  2UXD E;  4AQY E;  2EOH A;  4BC9 A;  4B3S E;  2EMW A;  3ZOQ B;  4KHP E;  2V85 A;  2EM5 A;  2EOF A;  2YRH A;  2YTE A;  4M30 A;  3VK6 A;  1X3C A;  1A1G A;  4IS1 C;  4F6M A;  1J26 A;  2RS6 A;  2R76 A;  1EH7 A;  2G7H A;  1T38 A;  1BBG A;  3RMP A;  2F8B A;  2DB2 A;  1GZ6 A;  1JK1 A;  3LML A;  1G2F C;  4B3T E;  4IJD A;  4KWY A;  2M4I A;  3M99 B;  2EL4 A;  1N33 E;  2GPI A;  3HXL A;  2FTX B;  4GKK E;  2YT4 A;  4GZN C;  3T1Y E;  4NXN E;  3BGH A;  2YTI A;  2WBS A;  4TUG A;  1TF6 A;  4JV5 E;  2EOR A;  2M7Q A;  2E72 A;  2EMH A;  1N32 E;  2M9A A;  1XMO E;  4DV6 E;  2HGH A;  1RQ0 A;  2EMI A;  2EPU A;  4DV4 E;  1ZU1 A;  2DLQ A;  1YUI A;  1RMD A;  3K6Q A;  1P47 A;  4Q28 A;  4RH8 A;  4WYQ B;  4M0V A;  4OOG C;  4JI4 E;  2Q8U A;  3HQ1 A;  4DMI A;  2EP3 A;  4DV7 E;  3TQM A;  2NAB A;  4R2S A;  5CFF E;  2WBT A;  3BID A;  2EPL X;  4O5G A;  2ENC A;  1PJT A;  2EN1 A;  4JI2 E;  4JI6 E;  2B7V A;  1BBO A;  4DUZ E;  2V8Q B;  2YTJ A;  4R2D A;  4DV5 E;  5BR8 E;  2LBS B;  4R03 A;  2YRM A;  4WXC A;  2LVH A;  2EOY A;  4B3M E;  2EN6 A;  1YYO A;  1RC7 A;  4X65 E;  4DV3 E;  2EML A;  2MKN A;  5AC4 A;  2DMY A;  2EM6 A;  2M1S A;  4HTG A;  1A1K A;  2HC5 A;  4BHB A;  2MDG A;  1EKZ A;  2HHH E;  3KWR A;  2N3G A;  5A6B A;  1EH8 A;  3MHS C;  4DR1 E;  1A1H A;  1UIL A;  4R2C A;  4LFB E;  2RPC A;  5KL5 A;  2UUB E;  3AV0 A;  2EPN A;  2EMX A;  1AAY A;  3HTX A;  2EPO A;  2JP9 A;  1HNZ E;  2CSH A;  3LLH A;  3ADI A;  2V83 A;  2YTP A;  2N3H A;  2JVA A;  3HPS A;  4WPY A;  4WSP A;  2EMY A;  2FV4 B;  3MHH C;  3BBG A;  2KOU A;  3P1X A;  2ADR A;  4LF7 E;  4DR4 E;  2EM8 A;  2ENA A;  4DV0 E;  2EOE A;  4HEI A;  3F6G A;  3JAM C;  2EMA A;  2DMI A;  4FK5 C;  2UUA E;  2I9I A;  2CT1 A;  2YTQ A;  4WXD A;  1GTK A;  1T4L B;  3THN A;  4Q35 B;  5AE1 A;  4DUY E;  3JTZ A;  2EPR A;  2EPC A;  1SR9 A;  4R8O A;  1WRJ A;  4R2A A;  4DR3 E;  4BHC A;  2LV2 A;  4LFC E;  1IMU A;  2BBG A;  2L33 A;  3C6M A;  2R1F A;  4DR2 E;  5LLQ A;  4B3R E;  2MDR A;  2LT7 A;  1ZAA C;  5IV8 B;  2JR1 A;  3ADL A;  2JPA A;  2LUQ A;  2LRS A;  2L2N A;  2EL6 A;  2EJ4 A;  4LU9 A;  1FKA E;  1G2D C;  2EM9 A;  2JXP A;  1YSA C;  2YU5 A;  2B3T B;  5AC5 A;  3EPJ A;  4F9A B;  2CPN A;  4BMJ A;  2K7I A;  3F6H A;  2V89 A;  4ZYE A;  2ODR C;  5A69 A;  2VQE E;  1B69 A;  2EZ6 A;  4F2J C;  4O43 A;  4MLV A;  1A1L A;  4JI7 E;  3H09 A;  4BBY A;  1IQS A;  5A2Q C;  1YPN A;  4I8O A;  2JOX A;  5LL6 R;  4ZYD A;  1STU A;  2B7T A;  5LMU E;  1IQO A;  2V88 A;  4TUI A;  1EH6 A;  1N3G A;  2RTX A;  2DIX A;  1YUJ A;  1TN9 A;  2RQL A;  5KL3 A;  2EOS A;  2EWL A;  2JWO A;  4YY3 E;  4NXM E;  4BCA A;  3HPZ A;  4ZYH A;  1HNW E;  3T1H E;  2I13 A;  1F2I G;  4JI8 E;  4F9C B;  2EM3 A;  4LF4 E;  2YSP A;  3EQ1 A;  3JU0 A;  2EOZ A;  4KZS A;  2EOM A;  3IWB A;  2RSM A;  2H36 X;  2EQ1 A;  5A6J A;  4DV1 E;  4JYA E;  2UXB E;  3BF2 A;  4O24 A;  4JI3 E;  4GKJ E;  3QG5 C;  1X6F A;  5AAS A;  2NUF A;  4L8N A;  1AH5 A;  4P7D A;  4R2P A;  1X47 A;  2LMZ A;  4X66 E;  3AUZ A;  2DSY A;  4YHH E;  2YSO A;  4DV2 E;  5T6J A;  2PRT A;  5AE3 A;  2EM0 A;  3IWD A;  1PJQ A;  1YYW A;  4BC7 A;  2EM4 A;  1YFH A;  2CTD A;  1T39 A;  2A25 A;  2HJJ A;  2LTR A;  1UBD C;  1A1F A;  2N8X A;  5IT9 C;  2WBU A;  3OML A;  2EMB A;  2EPX A;  2EM7 A;  2IHR 1;  2L92 A;  3J7Y p;  4MLQ A;  2ELZ A;  1YZ9 A;  4LF6 E;  5LMN E;  2KON A;  5F3W A;  4X64 E;  2LUP B;  5AE2 A;  2LO3 A;  2L2M A;  3DJW A;  1XNR E;  4O4K A;  5DNY A;  4OX9 E;  2YTG A;  2V86 A;  4M9V C;  3VHT B;  5A6A A;  2GHF A;  1T4O A;  4F54 A;  1L4S A;  2L3C A;  1NCS A;  1N36 E;  4WFT A;  2E1M A;  5FLX C;  2RS7 A;  4X8W A;  3VYY A;  1X6H A;  1A1I A;  2ELY A;  2EN3 A;  1X6E A;  1IBL E;  3L00 A;  5KL7 A;  1QU6 A;  2EN4 A;  1QNT A;  3J80 C;  1KJK A;  3MSW A;  1SFE A;  2E5L E;  1WJP A;  2YU8 A;  2DRP A;  2UXC E;  4JI5 E;  2YZT A;  1PKP A;  2EM2 A;  3IWC A;  2EOI A;  3ECR A;  2LJH A;  1XMQ E;  1GQE A;  2EE8 A;  4P78 A;  3OTO E;  1DI2 A;  2EMZ A;  1X48 A;  3THO B;  4DR6 E;  2DGC A;  4R2R A;  2NA2 A;  2EMG A;  1N34 E;  2EOQ A;  2KHX A;  4R2Q A;  2GLI A;  1O0W A;  1MGT A;  2L8T A;  3ADG A;  4DR7 E;  2NUE A;  5A6B D;  2EPK X;  5KL4 A;  3EPL A;  2L6M A;  1ZR9 A;  3FIG A;  2BB8 A;  2J7J A;  2JOB A;  4NZV A;  1WHQ A;  4ZYG A;  1ZBT A;  3J7A G;  1UHZ A;  4J8Z A;  2JYA A;  2NUG A;  4DKK A;  1TF3 A;  1LLM C;  4DR5 E;  5IWA E;  3VYX A;  2YRK A;  4JI1 E;  2D9H A;  2EMK A;  3EPK A;  3KZZ A;  2UU9 E;  4WSG A;  2EPZ A;  2EMC A;  1IBK E;  1KYQ A;  4LF9 E;  4K0K E;  2YTO A;  1T4N A;  2EOJ A;  2YPN A;  1JK2 A;  2YTF A;  3DF6 A;  1X5W A;  2ENH A;  1FJG E;  4BS9 A; 
#chains in the Genus database with same CATH homology
 2M7Q A;  4DUY E;  3JTZ A;  1YYW A;  4BC7 A;  1N32 E;  1XMO E;  1SR9 A;  2LTR A;  4R8O A;  4LFA E;  1DQ3 A;  4DV6 E;  1ZBQ A;  5IT9 C;  2L3J A;  1WHN A;  4DR3 E;  1IBM E;  1RQ0 A;  4LFC E;  3OML A;  2IHR 1;  2L92 A;  1I94 E;  4DV4 E;  4GKK E;  3J7Y p;  4LF5 E;  2L33 A;  1HNX E;  4DR2 E;  4B3R E;  2MDR A;  2V87 A;  2F4V E;  1YZ9 A;  4LF6 E;  4LTY A;  4X62 E;  3K6Q A;  4Q28 A;  5LMN E;  2KON A;  5F3W A;  4WYQ B;  4F9B B;  4X64 E;  4M2Z A;  2JR1 A;  2VQF E;  5AE2 A;  2K4V A;  2L2K B;  2LUP B;  3ADL A;  2L2M A;  3DJW A;  4M0V A;  5ADZ A;  5DNY A;  2LUQ A;  2LRS A;  2L2N A;  3ADJ A;  2VF1 A;  2V86 A;  4OOG C;  2ZM6 E;  4JI4 E;  3HQ1 A;  2JY9 A;  4LU9 A;  4DMI A;  1FKA E;  2UUC E;  4DV7 E;  1T4O A;  4F54 A;  2L3C A;  2LE2 A;  1N36 E;  4WFT A;  2E1M A;  2VE7 C;  3C4B A;  5CFF E;  1WXR A;  5FLX C;  2RS7 A;  2B3T B;  4LF8 E;  4X8W A;  4F9A B;  3VYY A;  2CPN A;  4GEQ B;  1YYK A;  1J5E E;  4BMJ A;  3J81 C;  1HR0 E;  3F6H A;  1IBL E;  4JI2 E;  4JI6 E;  2V89 A;  2ODR C;  1QU6 A;  2B7V A;  2VQE E;  2MC6 A;  3J80 C;  2FGG A;  2LTS A;  2V8Q B;  4DUZ E;  4DV5 E;  2EZ6 A;  3MSW A;  5BR8 E;  2E5L E;  1X49 A;  2LBS B;  2WZO A;  4R03 A;  4JI7 E;  2MC5 A;  3H09 A;  4BBY A;  1XNQ E;  3C4T A;  2UXC E;  5A2Q C;  4I8O A;  4L5N C;  4B3M E;  4JI5 E;  4JI0 E;  2JOX A;  5LL6 R;  2YZT A;  1STU A;  1PKP A;  2B7T A;  2B9D A;  3IWC A;  5LMU E;  1YYO A;  1RC7 A;  2LJH A;  4X65 E;  4DV3 E;  2V88 A;  4TUI A;  1XMQ E;  2ODR D;  1GQE A;  2DMY A;  4P78 A;  1XNR E;  2M1S A;  2UXD E;  3OTO E;  4AQY E;  1DI2 A;  2RTX A;  4BC9 A;  2DIX A;  4B3S E;  1EKZ A;  2HHH E;  3ZOQ B;  2EWL A;  3KWR A;  2N3G A;  2JWO A;  1X48 A;  2V85 A;  4YY3 E;  4DR1 E;  4NXM E;  4DR6 E;  4KHP E;  1UIL A;  4LFB E;  4BCA A;  4M30 A;  3HPZ A;  3VK6 A;  1HNW E;  2NA2 A;  3T1H E;  2UUB E;  1N34 E;  4JI8 E;  4F9C B;  2KHX A;  3AV0 A;  4LF4 E;  1O0W A;  3JU0 A;  4KZS A;  2L8T A;  3HTX A;  2RS6 A;  1J26 A;  3ADG A;  1HNZ E;  2NUE A;  3IWB A;  4DR7 E;  2RSM A;  2G7H A;  2H36 X;  3LLH A;  4DV1 E;  3ADI A;  4JYA E;  2L6M A;  3RMP A;  2V83 A;  2N3H A;  3FIG A;  2F8B A;  2DB2 A;  2UXB E;  1GZ6 A;  2JVA A;  3LML A;  2JOB A;  4B3T E;  3HPS A;  1WHQ A;  4JI3 E;  1ZBT A;  4WPY A;  1UHZ A;  4J8Z A;  3J7A G;  4GKJ E;  4WSP A;  4OX9 E;  2NUG A;  4DKK A;  2FV4 B;  3VYX A;  4DR5 E;  2KOU A;  3P1X A;  5AAS A;  5IWA E;  4LF7 E;  2NUF A;  4JI1 E;  4L8N A;  2M4I A;  4DR4 E;  2UU9 E;  4P7D A;  1IBK E;  1N33 E;  4DV0 E;  3HXL A;  4LF9 E;  4K0K E;  2FTX B;  1X47 A;  1T4N A;  2LMZ A;  2YT4 A;  3F6G A;  3AUZ A;  2DSY A;  3JAM C;  4X66 E;  4YHH E;  3T1Y E;  4DV2 E;  2UUA E;  4NXN E;  3DF6 A;  5T6J A;  1T4L B;  5AE3 A;  4TUG A;  4JV5 E;  3IWD A;  1FJG E;  4BS9 A;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...