2DSYA

Crystal structure of ttha0281 from thermus thermophilus hb8
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
GMGTLTRYLEEAMARARYELIADEEPYYGEIPDLPGVWATGKSLKECEANLQAALEDWLLFLLSRGETPPPLGEVRIELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a UPF0150-family protein from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA0281
total genus 21
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dsyA00
4P7DA 3KWRA 2YZTA 2DSYA 4P78A
chains in the Genus database with same CATH superfamily
3BIDA 2EM3A 2VRDA 4X65E 3AUZA 2LVHA 2RPCA 2YTQA 3C4BA 5DNYA 4BCAA 2DRPA 2NABA 4DUYE 4DR7E 2EPCA 2KOUA 2YTFA 5AE2A 2LT7A 2EPUA 4ZYHA 4BHBA 4WX9A 2EE8A 2LCEA 2EM8A 5KL5A 2EP3A 1HR0E 2UXBE 2YWQA 2V86A 2WCC3 4F9AB 4DV5E 1BB8A 2B3TB 4JV5E 1X6EA 4BC9A 2ENCA 2NA2A 2EL6A 2EPKX 2KHXA 2EPOA 4DV3E 2R76A 4HEIA 4TUIA 3IWCA 2YRKA 4BHCA 5A69A 2LMZA 4P7DA 2EMBA 1BBGA 5KL7A 2CSHA 2FGGA 3OTOE 1UILA 2EMHA 2ELYA 2V85A 3C6KA 3IWDA 4O24A 2RQLA 4JI0E 4F6NA 1A1GA 2M9AA 2EOEA 1IBKE 4KHPE 2LJHA 3TQMA 4O43A 2LV2A 1DGCA 1WHNA 2J7JA 1F2IG 4JI6E 2ZM6E 4DR4E 2JOBA 1SR9A 2Q8UA 2VF1A 4JI5E 3BBGA 3KZYA 3UK3C 3EPHA 2I13A 3DJWA 1GTKA 4LF4E 2JPAA 2LUQA 3HTXA 2JXPA 4DV1E 3VYYA 2DGCA 1N33E 2VQFE 1IBME 2F4VE 2JP9A 1QNTA 2ENHA 2L2MA 1RQ0A 2N3HA 5KL6A 2EPXA 2FTXB 4NXME 1IQOA 2EQ3A 1A1IA 2DLKA 2MDRA 2V88A 4DKKA 4DV0E 3LLHA 2EOSA 5A2QC 2FV4B 4LFCE 2YRHA 2LE2A 2R1FA 5LMUE 3FIGA 1SFEA 2EM5A 2CT1A 5AE3A 4ZYDA 3ADJA 4NZVA 1X5WA 1PKPA 4JI7E 1WXRA 2YU5A 2EOQA 5AC5A 3ADIA 4OOGC 2EN6A 5LMNE 1FKAE 2EM6A 2EM9A 3KWRA 4X64E 3IWBA 5A6KA 1PJSA 1P47A 2LUPB 2WBUA 2EPMX 2EOXA 2EQ1A 1UN6B 1XNRE 2BBGA 2YPNA 1N34E 1X49A 4X66E 3F6GA 1WJPA 1L4SA 2UUAE 2M7QA 4R2EA 1GQEA 4IJDA 4LFAE 2YRMA 3ZOQB 4B3RE 2EMYA 2EN8A 4TUGA 2YTGA 3MHHC 5A6BA 2EZ6A 4NHRA 2L6MA 2I9IA 2JOXA 2ELZA 1GZ6A 4OX9E 5IXMB 4DMIA 2EMGA 2RSMA 2RS7A 2EN7A 4J8ZA 2EMZA 2JWOA 4R2RA 1YPNA 4DV4E 1ZR9A 2EMKA 5A6AA 4L5NC 2B7VA 2UUCE 1KJKA 4M9VC 4R2AA 3L00A 2WZOA 3RMPA 2YTNA 5LLQA 4DV7E 1DQ3A 2DMIA 5LL6R 4DV6E 1IMUA 4MLVA 2L3JA 4L8NA 2L3CA 2L2NA 4Q28A 2LTSA 2WBSA 1N3GA 4DR5E 4AQYE 2N3GA 3KZZA 5KL2A 2L92A 3EPLA 1ZBQA 1ZU1A 2EPAA 4DR3E 1HNZE 2YTIA 1XMQE 3H09A 4F9CB 2EJ4A 2ODRC 5KL4A 2V8QB 1HNWE 2L2KB 2EN4A 2YU8A 3F6HA 1T39A 1EH6A 2YZTA 5IWAE 3HXLA 2F8BA 2EMFA 4JI4E 2ODRD 2EMLA 4GZNC 4LF7E 2DIXA 2L33A 4B3SE 2EPNA 1G2FC 2V83A 2DB2A 2GHFA 2KONA 2L8TA 2EOZA 5AASA 2A25A 2EOOA 1T38A 4B3TE 2G7HA 2UXCE 2M1SA 2JVAA 3THOB 2EM2A 1BBOA 3MSWA 2M4IA 2NUFA 4O5GA 5IV8B 2B7TA 2YTDA 4ZYGA 5A6BD 1J5EE 4WXDA 3EPJA 1ZAAC 3DF6A 1A1LA 2WBTA 1YUIA 2EOHA 2UU9E 2EN2A 1RMDA 2MDGA 1ZBTA 2DLQA 2YTPA 1QU6A 3J80C 2YTEA 1WHQA 2BB8A 4F54A 3EQ1A 4F6MA 1O0WA 1YYKA 1FJGE 2K4VA 1A1FA 4R2DA 1MGTA 4B3ME 4JI8E 2LBSB 1DI2A 4WFTA 5FLXC 2JY9A 4MLQA 4IS1C 2E5LE 4DR6E 4WYQB 1YYWA 1AAYA 4DUZE 2NUGA 4JI2E 2VQEE 2HGHA 2EQ0A 1X6FA 1WRJA 2HHHE 3JAMC 1TF3A 4GKKE 1XNQE 4X62E 4HTGA 4N4RB 4R2PA 3VK6A 2IHR1 2EPPA 4JI3E 4M2ZA 5TSEA 4BC7A 3BGHA 5CFFE 1B69A 4YHHE 1EKZA 2EM4A 1IQSA 4F2JC 4Q35B 1TF6A 3HQ1A 3HPSA 4RHBB 2LTRA 4O4KA 3VHTB 1A1JA 3BF2A 4RH8A 4ZYEA 5A6JA 4YY3E 1MEYC 4BBYA 2DMYA 1IBLE 2PRTA 2UXDE 4LFBE 1AH5A 3P1XA 1Z1BA 4LU9A 2ENAA 1TN9A 2EN3A 3M99B 2LRSA 2ADRA 4GEQB 2EL4A 2EM7A 3J81C 2EOMA 2EPZA 3JTZA 2GPIA 2HJJA 1YFHA 2LJUA 5F3WA 4JYAE 4GKJE 2EOIA 2EMXA 4R03A 2YSPA 4WSPA 1XMOE 2E1MA 2B9DA 1EH7A 4LF5E 1JK2A 4LF6E 1T4OA 3THNA 1I94E 1UHZA 1PJQA 1JK1A 2EPLX 5T6JA 4LF9E 4LF8E 3EPKA 3ECRA 4BS9A 4R2CA 3OMLA 1X3CA 2EL5A 4WSGA 2EPRA 2MC6A 2YT4A 2RTXA 4NXNE 3J7AG 2JYAA 3ADGA 1PJTA 2RSIA 4R2QA 4M0VA 3T1HE 5IT9C 2EWLA 4WPYA 2LO3A 2V89A 3J7Yp 3VYXA 5KL3A 4X8WA 2YTOA 3QG5C 3HPZA 1LLMC 1HNXE 1N32E 4WXCA 4X9JA 1YYOA 2UUBE 2EOJA 4R8OA 4BMJA 5AE1A 2E72A 1EH8A 2DSYA 2N8XA 1X48A 4DV2E 2CPNA 3JU0A 3T1YE 2VE7C 4DR1E 4P78A 2HC5A 4I8OA 3AV0A 4KWYA 1N36E 4F9BB 2EOYA 2V87A 4K0KE 1G2DC 2EM0A 5AC4A 1PDAA 3MHSC 2EMAA 2YTJA 1YZ9A 4JI1E 2CTDA 4DR2E 3ADLA 5ADZA 2EMCA 4KZSA 2YSOA 2MKNA 1X6HA 1T4LB 2D9HA 1UBDC 4M30A 1T4NA 1X47A 1A1HA 3LMLA 2JR1A 1J26A 2H36X 2MKDA 2MC5A 4R2SA 2EN1A 2RS6A 1YSAC 2GLIA 2EOFA 1STUA 4FK5C 1KYQA 1NCSA 3C6MA 5BR8E 1YUJA 2EMWA 4LTYA 3C4TA 2NUEA 1NEIA 3K6QA 1A1KA 2EMIA 1RC7A 2K7IA 2EORA
chains in the Genus database with same CATH topology
5A2QC 2FV4B 4LF7E 4X65E 2DIXA 2LE2A 3AUZA 3JTZA 3J81C 4LFCE 5LMUE 3C4BA 5DNYA 4BCAA 2L33A 5F3WA 4JYAE 4DUYE 4GKJE 4DR7E 3FIGA 4R03A 4B3SE 4WSPA 1XMOE 2E1MA 2B9DA 2KOUA 2V83A 5AE3A 2DB2A 3ADJA 5AE2A 2KONA 2L8TA 4LF5E 5AASA 4LF6E 1PKPA 4JI7E 1WXRA 4B3TE 3ADIA 1T4OA 4OOGC 1DI2A 2G7HA 1I94E 2UXCE 2M1SA 2JVAA 1UHZA 5LMNE 1FKAE 1HR0E 3MSWA 2M4IA 2NUFA 2UXBE 3KWRA 4X64E 2B7TA 2V86A 3IWBA 5T6JA 4F9AB 4LF9E 4DV5E 4LF8E 2B3TB 1J5EE 4JV5E 4BS9A 3OMLA 4BC9A 3DF6A 2LUPB 2MC6A 2NA2A 2YT4A 2RTXA 4NXNE 1XNRE 2UU9E 2KHXA 3J7AG 3ADGA 1N34E 1X49A 1ZBTA 4X66E 1QU6A 3J80C 4DV3E 4M0VA 3F6GA 3T1HE 5IT9C 2EWLA 4WPYA 4TUIA 3IWCA 2UUAE 1WHQA 2M7QA 1GQEA 4LFAE 2V89A 3J7Yp 4F54A 3VYXA 4B3RE 4X8WA 1O0WA 3ZOQB 1YYKA 4TUGA 1FJGE 3HPZA 2K4VA 1HNXE 2LMZA 1N32E 2EZ6A 2L6MA 1YYOA 2UUBE 4P7DA 2JOXA 4R8OA 4BMJA 1GZ6A 5AE1A 4B3ME 4OX9E 2DSYA 2FGGA 4DMIA 4JI8E 1UILA 1X48A 2V85A 2RSMA 2RS7A 3OTOE 4DV2E 4WFTA 5FLXC 2CPNA 2JY9A 3IWDA 4J8ZA 2LBSB 3JU0A 3T1YE 2VE7C 4JI0E 4DR1E 2E5LE 2JWOA 4WYQB 4DR6E 4P78A 1YYWA 1IBKE 4KHPE 2LJHA 4I8OA 4DUZE 2NUGA 3AV0A 4JI2E 2VQEE 4DV4E 1WHNA 1N36E 4F9BB 4L5NC 4JI6E 2ZM6E 4DR4E 2JOBA 2HHHE 1SR9A 2V87A 3JAMC 4K0KE 1XNQE 4GKKE 4X62E 2B7VA 2VF1A 2UUCE 4JI5E 3VK6A 2IHR1 2WZOA 4JI3E 4M2ZA 4BC7A 3DJWA 4DV7E 3RMPA 4LF4E 1YZ9A 1DQ3A 5LL6R 5CFFE 4JI1E 4DV6E 4DR2E 2LUQA 3ADLA 4YHHE 2L3JA 5ADZA 4L8NA 2L3CA 1EKZA 3HTXA 2L2NA 4KZSA 4Q28A 4DV1E 2LTSA 4DR5E 1T4LB 3HQ1A 3VYYA 4AQYE 2N3GA 3HPSA 4M30A 1T4NA 1X47A 2L92A 2JR1A 2LTRA 3LMLA 2H36X 2VQFE 1N33E 1J26A 4YY3E 1IBME 2F4VE 2MC5A 2RS6A 1ZBQA 2L2MA 1RQ0A 1STUA 2N3HA 4DR3E 1HNZE 4BBYA 2FTXB 2DMYA 4NXME 1XMQE 1IBLE 3H09A 4F9CB 2ODRC 2UXDE 2V8QB 5BR8E 4LFBE 1HNWE 3P1XA 2L2KB 2MDRA 4LTYA 2V88A 3C4TA 4LU9A 2NUEA 4DKKA 3F6HA 3K6QA 4DV0E 2YZTA 2LRSA 3HXLA 3LLHA 5IWAE 2F8BA 1RC7A 4GEQB 4JI4E 2ODRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7D A;  3KWR A;  2YZT A;  2DSY A;  4P78 A; 
#chains in the Genus database with same CATH topology
 3BID A;  2EM3 A;  2VRD A;  4X65 E;  3AUZ A;  2LVH A;  2RPC A;  2YTQ A;  3C4B A;  5DNY A;  4BCA A;  2DRP A;  2NAB A;  4DUY E;  4DR7 E;  2EPC A;  2KOU A;  2YTF A;  5AE2 A;  2LT7 A;  2EPU A;  4ZYH A;  4BHB A;  4WX9 A;  2EE8 A;  2LCE A;  2EM8 A;  5KL5 A;  2EP3 A;  1HR0 E;  2UXB E;  2YWQ A;  2V86 A;  2WCC 3;  4F9A B;  4DV5 E;  1BB8 A;  2B3T B;  4JV5 E;  1X6E A;  4BC9 A;  2ENC A;  2NA2 A;  2EL6 A;  2EPK X;  2KHX A;  2EPO A;  4DV3 E;  2R76 A;  4HEI A;  4TUI A;  3IWC A;  2YRK A;  4BHC A;  5A69 A;  2LMZ A;  4P7D A;  2EMB A;  1BBG A;  5KL7 A;  2CSH A;  2FGG A;  3OTO E;  1UIL A;  2EMH A;  2ELY A;  2V85 A;  3C6K A;  3IWD A;  4O24 A;  2RQL A;  4JI0 E;  4F6N A;  1A1G A;  2M9A A;  2EOE A;  1IBK E;  4KHP E;  2LJH A;  3TQM A;  4O43 A;  2LV2 A;  1DGC A;  1WHN A;  2J7J A;  1F2I G;  4JI6 E;  2ZM6 E;  4DR4 E;  2JOB A;  1SR9 A;  2Q8U A;  2VF1 A;  4JI5 E;  3BBG A;  3KZY A;  3UK3 C;  3EPH A;  2I13 A;  3DJW A;  1GTK A;  4LF4 E;  2JPA A;  2LUQ A;  3HTX A;  2JXP A;  4DV1 E;  3VYY A;  2DGC A;  1N33 E;  2VQF E;  1IBM E;  2F4V E;  2JP9 A;  1QNT A;  2ENH A;  2L2M A;  1RQ0 A;  2N3H A;  5KL6 A;  2EPX A;  2FTX B;  4NXM E;  1IQO A;  2EQ3 A;  1A1I A;  2DLK A;  2MDR A;  2V88 A;  4DKK A;  4DV0 E;  3LLH A;  2EOS A;  5A2Q C;  2FV4 B;  4LFC E;  2YRH A;  2LE2 A;  2R1F A;  5LMU E;  3FIG A;  1SFE A;  2EM5 A;  2CT1 A;  5AE3 A;  4ZYD A;  3ADJ A;  4NZV A;  1X5W A;  1PKP A;  4JI7 E;  1WXR A;  2YU5 A;  2EOQ A;  5AC5 A;  3ADI A;  4OOG C;  2EN6 A;  5LMN E;  1FKA E;  2EM6 A;  2EM9 A;  3KWR A;  4X64 E;  3IWB A;  5A6K A;  1PJS A;  1P47 A;  2LUP B;  2WBU A;  2EPM X;  2EOX A;  2EQ1 A;  1UN6 B;  1XNR E;  2BBG A;  2YPN A;  1N34 E;  1X49 A;  4X66 E;  3F6G A;  1WJP A;  1L4S A;  2UUA E;  2M7Q A;  4R2E A;  1GQE A;  4IJD A;  4LFA E;  2YRM A;  3ZOQ B;  4B3R E;  2EMY A;  2EN8 A;  4TUG A;  2YTG A;  3MHH C;  5A6B A;  2EZ6 A;  4NHR A;  2L6M A;  2I9I A;  2JOX A;  2ELZ A;  1GZ6 A;  4OX9 E;  5IXM B;  4DMI A;  2EMG A;  2RSM A;  2RS7 A;  2EN7 A;  4J8Z A;  2EMZ A;  2JWO A;  4R2R A;  1YPN A;  4DV4 E;  1ZR9 A;  2EMK A;  5A6A A;  4L5N C;  2B7V A;  2UUC E;  1KJK A;  4M9V C;  4R2A A;  3L00 A;  2WZO A;  3RMP A;  2YTN A;  5LLQ A;  4DV7 E;  1DQ3 A;  2DMI A;  5LL6 R;  4DV6 E;  1IMU A;  4MLV A;  2L3J A;  4L8N A;  2L3C A;  2L2N A;  4Q28 A;  2LTS A;  2WBS A;  1N3G A;  4DR5 E;  4AQY E;  2N3G A;  3KZZ A;  5KL2 A;  2L92 A;  3EPL A;  1ZBQ A;  1ZU1 A;  2EPA A;  4DR3 E;  1HNZ E;  2YTI A;  1XMQ E;  3H09 A;  4F9C B;  2EJ4 A;  2ODR C;  5KL4 A;  2V8Q B;  1HNW E;  2L2K B;  2EN4 A;  2YU8 A;  3F6H A;  1T39 A;  1EH6 A;  2YZT A;  5IWA E;  3HXL A;  2F8B A;  2EMF A;  4JI4 E;  2ODR D;  2EML A;  4GZN C;  4LF7 E;  2DIX A;  2L33 A;  4B3S E;  2EPN A;  1G2F C;  2V83 A;  2DB2 A;  2GHF A;  2KON A;  2L8T A;  2EOZ A;  5AAS A;  2A25 A;  2EOO A;  1T38 A;  4B3T E;  2G7H A;  2UXC E;  2M1S A;  2JVA A;  3THO B;  2EM2 A;  1BBO A;  3MSW A;  2M4I A;  2NUF A;  4O5G A;  5IV8 B;  2B7T A;  2YTD A;  4ZYG A;  5A6B D;  1J5E E;  4WXD A;  3EPJ A;  1ZAA C;  3DF6 A;  1A1L A;  2WBT A;  1YUI A;  2EOH A;  2UU9 E;  2EN2 A;  1RMD A;  2MDG A;  1ZBT A;  2DLQ A;  2YTP A;  1QU6 A;  3J80 C;  2YTE A;  1WHQ A;  2BB8 A;  4F54 A;  3EQ1 A;  4F6M A;  1O0W A;  1YYK A;  1FJG E;  2K4V A;  1A1F A;  4R2D A;  1MGT A;  4B3M E;  4JI8 E;  2LBS B;  1DI2 A;  4WFT A;  5FLX C;  2JY9 A;  4MLQ A;  4IS1 C;  2E5L E;  4DR6 E;  4WYQ B;  1YYW A;  1AAY A;  4DUZ E;  2NUG A;  4JI2 E;  2VQE E;  2HGH A;  2EQ0 A;  1X6F A;  1WRJ A;  2HHH E;  3JAM C;  1TF3 A;  4GKK E;  1XNQ E;  4X62 E;  4HTG A;  4N4R B;  4R2P A;  3VK6 A;  2IHR 1;  2EPP A;  4JI3 E;  4M2Z A;  5TSE A;  4BC7 A;  3BGH A;  5CFF E;  1B69 A;  4YHH E;  1EKZ A;  2EM4 A;  1IQS A;  4F2J C;  4Q35 B;  1TF6 A;  3HQ1 A;  3HPS A;  4RHB B;  2LTR A;  4O4K A;  3VHT B;  1A1J A;  3BF2 A;  4RH8 A;  4ZYE A;  5A6J A;  4YY3 E;  1MEY C;  4BBY A;  2DMY A;  1IBL E;  2PRT A;  2UXD E;  4LFB E;  1AH5 A;  3P1X A;  1Z1B A;  4LU9 A;  2ENA A;  1TN9 A;  2EN3 A;  3M99 B;  2LRS A;  2ADR A;  4GEQ B;  2EL4 A;  2EM7 A;  3J81 C;  2EOM A;  2EPZ A;  3JTZ A;  2GPI A;  2HJJ A;  1YFH A;  2LJU A;  5F3W A;  4JYA E;  4GKJ E;  2EOI A;  2EMX A;  4R03 A;  2YSP A;  4WSP A;  1XMO E;  2E1M A;  2B9D A;  1EH7 A;  4LF5 E;  1JK2 A;  4LF6 E;  1T4O A;  3THN A;  1I94 E;  1UHZ A;  1PJQ A;  1JK1 A;  2EPL X;  5T6J A;  4LF9 E;  4LF8 E;  3EPK A;  3ECR A;  4BS9 A;  4R2C A;  3OML A;  1X3C A;  2EL5 A;  4WSG A;  2EPR A;  2MC6 A;  2YT4 A;  2RTX A;  4NXN E;  3J7A G;  2JYA A;  3ADG A;  1PJT A;  2RSI A;  4R2Q A;  4M0V A;  3T1H E;  5IT9 C;  2EWL A;  4WPY A;  2LO3 A;  2V89 A;  3J7Y p;  3VYX A;  5KL3 A;  4X8W A;  2YTO A;  3QG5 C;  3HPZ A;  1LLM C;  1HNX E;  1N32 E;  4WXC A;  4X9J A;  1YYO A;  2UUB E;  2EOJ A;  4R8O A;  4BMJ A;  5AE1 A;  2E72 A;  1EH8 A;  2DSY A;  2N8X A;  1X48 A;  4DV2 E;  2CPN A;  3JU0 A;  3T1Y E;  2VE7 C;  4DR1 E;  4P78 A;  2HC5 A;  4I8O A;  3AV0 A;  4KWY A;  1N36 E;  4F9B B;  2EOY A;  2V87 A;  4K0K E;  1G2D C;  2EM0 A;  5AC4 A;  1PDA A;  3MHS C;  2EMA A;  2YTJ A;  1YZ9 A;  4JI1 E;  2CTD A;  4DR2 E;  3ADL A;  5ADZ A;  2EMC A;  4KZS A;  2YSO A;  2MKN A;  1X6H A;  1T4L B;  2D9H A;  1UBD C;  4M30 A;  1T4N A;  1X47 A;  1A1H A;  3LML A;  2JR1 A;  1J26 A;  2H36 X;  2MKD A;  2MC5 A;  4R2S A;  2EN1 A;  2RS6 A;  1YSA C;  2GLI A;  2EOF A;  1STU A;  4FK5 C;  1KYQ A;  1NCS A;  3C6M A;  5BR8 E;  1YUJ A;  2EMW A;  4LTY A;  3C4T A;  2NUE A;  1NEI A;  3K6Q A;  1A1K A;  2EMI A;  1RC7 A;  2K7I A;  2EOR A; 
#chains in the Genus database with same CATH homology
 5A2Q C;  2FV4 B;  4LF7 E;  4X65 E;  2DIX A;  2LE2 A;  3AUZ A;  3JTZ A;  3J81 C;  4LFC E;  5LMU E;  3C4B A;  5DNY A;  4BCA A;  2L33 A;  5F3W A;  4JYA E;  4DUY E;  4GKJ E;  4DR7 E;  3FIG A;  4R03 A;  4B3S E;  4WSP A;  1XMO E;  2E1M A;  2B9D A;  2KOU A;  2V83 A;  5AE3 A;  2DB2 A;  3ADJ A;  5AE2 A;  2KON A;  2L8T A;  4LF5 E;  5AAS A;  4LF6 E;  1PKP A;  4JI7 E;  1WXR A;  4B3T E;  3ADI A;  1T4O A;  4OOG C;  1DI2 A;  2G7H A;  1I94 E;  2UXC E;  2M1S A;  2JVA A;  1UHZ A;  5LMN E;  1FKA E;  1HR0 E;  3MSW A;  2M4I A;  2NUF A;  2UXB E;  3KWR A;  4X64 E;  2B7T A;  2V86 A;  3IWB A;  5T6J A;  4F9A B;  4LF9 E;  4DV5 E;  4LF8 E;  2B3T B;  1J5E E;  4JV5 E;  4BS9 A;  3OML A;  4BC9 A;  3DF6 A;  2LUP B;  2MC6 A;  2NA2 A;  2YT4 A;  2RTX A;  4NXN E;  1XNR E;  2UU9 E;  2KHX A;  3J7A G;  3ADG A;  1N34 E;  1X49 A;  1ZBT A;  4X66 E;  1QU6 A;  3J80 C;  4DV3 E;  4M0V A;  3F6G A;  3T1H E;  5IT9 C;  2EWL A;  4WPY A;  4TUI A;  3IWC A;  2UUA E;  1WHQ A;  2M7Q A;  1GQE A;  4LFA E;  2V89 A;  3J7Y p;  4F54 A;  3VYX A;  4B3R E;  4X8W A;  1O0W A;  3ZOQ B;  1YYK A;  4TUG A;  1FJG E;  3HPZ A;  2K4V A;  1HNX E;  2LMZ A;  1N32 E;  2EZ6 A;  2L6M A;  1YYO A;  2UUB E;  4P7D A;  2JOX A;  4R8O A;  4BMJ A;  1GZ6 A;  5AE1 A;  4B3M E;  4OX9 E;  2DSY A;  2FGG A;  4DMI A;  4JI8 E;  1UIL A;  1X48 A;  2V85 A;  2RSM A;  2RS7 A;  3OTO E;  4DV2 E;  4WFT A;  5FLX C;  2CPN A;  2JY9 A;  3IWD A;  4J8Z A;  2LBS B;  3JU0 A;  3T1Y E;  2VE7 C;  4JI0 E;  4DR1 E;  2E5L E;  2JWO A;  4WYQ B;  4DR6 E;  4P78 A;  1YYW A;  1IBK E;  4KHP E;  2LJH A;  4I8O A;  4DUZ E;  2NUG A;  3AV0 A;  4JI2 E;  2VQE E;  4DV4 E;  1WHN A;  1N36 E;  4F9B B;  4L5N C;  4JI6 E;  2ZM6 E;  4DR4 E;  2JOB A;  2HHH E;  1SR9 A;  2V87 A;  3JAM C;  4K0K E;  1XNQ E;  4GKK E;  4X62 E;  2B7V A;  2VF1 A;  2UUC E;  4JI5 E;  3VK6 A;  2IHR 1;  2WZO A;  4JI3 E;  4M2Z A;  4BC7 A;  3DJW A;  4DV7 E;  3RMP A;  4LF4 E;  1YZ9 A;  1DQ3 A;  5LL6 R;  5CFF E;  4JI1 E;  4DV6 E;  4DR2 E;  2LUQ A;  3ADL A;  4YHH E;  2L3J A;  5ADZ A;  4L8N A;  2L3C A;  1EKZ A;  3HTX A;  2L2N A;  4KZS A;  4Q28 A;  4DV1 E;  2LTS A;  4DR5 E;  1T4L B;  3HQ1 A;  3VYY A;  4AQY E;  2N3G A;  3HPS A;  4M30 A;  1T4N A;  1X47 A;  2L92 A;  2JR1 A;  2LTR A;  3LML A;  2H36 X;  2VQF E;  1N33 E;  1J26 A;  4YY3 E;  1IBM E;  2F4V E;  2MC5 A;  2RS6 A;  1ZBQ A;  2L2M A;  1RQ0 A;  1STU A;  2N3H A;  4DR3 E;  1HNZ E;  4BBY A;  2FTX B;  2DMY A;  4NXM E;  1XMQ E;  1IBL E;  3H09 A;  4F9C B;  2ODR C;  2UXD E;  2V8Q B;  5BR8 E;  4LFB E;  1HNW E;  3P1X A;  2L2K B;  2MDR A;  4LTY A;  2V88 A;  3C4T A;  4LU9 A;  2NUE A;  4DKK A;  3F6H A;  3K6Q A;  4DV0 E;  2YZT A;  2LRS A;  3HXL A;  3LLH A;  5IWA E;  2F8B A;  1RC7 A;  4GEQ B;  4JI4 E;  2ODR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...