2DSYA

Crystal structure of ttha0281 from thermus thermophilus hb8
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
GMGTLTRYLEEAMARARYELIADEEPYYGEIPDLPGVWATGKSLKECEANLQAALEDWLLFLLSRGETPPPLGEVRIELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA0281
publication title Structure of a UPF0150-family protein from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 21
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dsyA00
2DSYA 4P7DA 4P78A 2YZTA 3KWRA
chains in the Genus database with same CATH superfamily
3IWDA 2IHR1 2JWOA 2EP3A 2YU8A 2HJJA 2EL6A 3H09A 3ECRA 2LRSA 2H36X 5A69A 4O5GA 2UUCE 2EM5A 3C6KA 4GKJE 4MLVA 4WFTA 3MSWA 4ZYHA 2N8XA 4K0KE 2N3GA 1YPNA 1KJKA 2RTXA 4X8WA 4LF7E 2VQEE 3TQMA 2EN3A 2MKDA 2VF1A 2V87A 3EQ1A 1A1GA 2EMAA 3T1HE 5KL7A 4DR4E 2VQFE 2ODRD 2CT1A 4DV2E 4WSPA 1G2FC 2EN1A 2EOEA 2YTNA 1T4OA 2EOZA 1DQ3A 2EZ6A 1PDAA 1XMQE 1I94E 1YUJA 3DJWA 2DB2A 1ZBQA 1UHZA 2F8BA 2ELYA 5BR8E 1T4LB 1UN6B 2KOUA 2WBUA 4DR2E 2NUEA 2K7IA 4LF5E 2YT4A 2L3CA 3KWRA 1FKAE 3J80C 5ADZA 1TN9A 4ZYEA 4BC7A 4O4KA 4LFCE 4X64E 4JI4E 1J5EE 4P7DA 2DMIA 2YWQA 2V89A 2LCEA 4DKKA 1RQ0A 2E1MA 2EPNA 2EMHA 2B3TB 4L5NC 3F6HA 1FJGE 2JR1A 4TUGA 1O0WA 4RH8A 2LUPB 1PJTA 2R76A 1GZ6A 2YTJA 4L8NA 4NHRA 2M1SA 2UU9E 4TUIA 1A1IA 2GLIA 5A2QC 4R2SA 4NZVA 1A1LA 1PKPA 4LFBE 2JXPA 3HXLA 4DUYE 1N34E 2MC5A 4R2CA 4JYAE 2LTSA 1PJSA 1A1KA 1IBLE 2KONA 4NXME 2YTQA 2MC6A 4F54A 3JAMC 2RS6A 2YPNA 3F6GA 4I8OA 2EMWA 1HNZE 5A6AA 4BS9A 2ENCA 4M0VA 2HHHE 2JYAA 1IQOA 2K4VA 4WX9A 2UUAE 2KHXA 2EM6A 3QG5C 4WXCA 4YY3E 4B3SE 2CPNA 4M30A 4GKKE 5IT9C 5A6JA 1ZAAC 2EN8A 2ADRA 4R2EA 5KL6A 4Q35B 2M9AA 4R2PA 1T39A 2EN4A 2WBTA 4LTYA 4O24A 1GTKA 2GPIA 2EPOA 2YRKA 4F9BB 4DR3E 3L00A 3K6QA 4WXDA 2JOBA 2EMIA 1WHQA 2YTPA 1WRJA 2CTDA 4WYQB 1LLMC 1RMDA 4X62E 5AASA 3OMLA 4DR1E 4N4RB 4IJDA 3AV0A 2YU5A 3VK6A 2YRHA 2G7HA 2GHFA 1IMUA 1Z1BA 5F3WA 2YRMA 3J81C 3ADGA 3VYYA 4JI6E 1NCSA 1A1HA 2L3JA 2LO3A 2UXDE 3THNA 2RSIA 2EOSA 3HQ1A 3ADIA 1X5WA 1STUA 2YZTA 1TF3A 2EPMX 3FIGA 2MKNA 2EN7A 4JI5E 2LVHA 3MHHC 4WPYA 5T6JA 2EJ4A 1XNRE 2V88A 2ENHA 1X6FA 4F9CB 4BC9A 3T1YE 2DLQA 5AE1A 4KHPE 2EE8A 2EPLX 2YTEA 4BHBA 2JPAA 4JI3E 2WCC3 2EPKX 1YFHA 4B3ME 2NUGA 3MHSC 4F6MA 1RC7A 5KL5A 4YHHE 1J26A 2L2NA 2EOOA 2DSYA 3BBGA 4DMIA 4DV6E 1QNTA 2B9DA 3HPZA 3BIDA 2ENAA 3J7Yp 2YSOA 4NXNE 4GZNC 4LF8E 3IWCA 2A25A 2EOHA 1IBME 4LF9E 4KWYA 2EM4A 3J7AG 2CSHA 2L6MA 4DV4E 4R2RA 3JU0A 1ZBTA 2V86A 2EPZA 1N3GA 2EWLA 3DF6A 5A6BD 4DV7E 4DV5E 2BBGA 2JY9A 1PJQA 2EM2A 4R2AA 1WXRA 4DV0E 4P78A 1X3CA 2B7VA 2MDRA 1XNQE 4R2QA 1N36E 2I9IA 1UILA 2Q8UA 3P1XA 4ZYDA 2EQ3A 2EMKA 2VRDA 4BBYA 4BMJA 3EPLA 2RPCA 4F9AB 5AE3A 4JI0E 2YTDA 1ZU1A 2EQ0A 2D9HA 1P47A 2J7JA 2UXBE 3HPSA 2DGCA 5LL6R 2M4IA 3C6MA 1N32E 2HGHA 4B3RE 2JOXA 2YTFA 2LE2A 2LTRA 1EH7A 2NA2A 1A1FA 4J8ZA 2FGGA 3VHTB 1A1JA 2E72A 3IWBA 4R8OA 1HR0E 2EOXA 3EPKA 4RHBB 2L2MA 3BF2A 2L8TA 4M9VC 2FV4B 4X66E 4FK5C 3ADLA 1EKZA 4X9JA 2I13A 4DV1E 5IWAE 2M7QA 1XMOE 4BHCA 1B69A 3HTXA 2EPCA 4JV5E 2LT7A 4LF4E 3UK3C 1GQEA 5AC5A 4AQYE 1UBDC 2R1FA 2VE7C 2B7TA 2YSPA 1YYWA 2EPUA 4R03A 2EN6A 2DIXA 4O43A 5KL3A 1SR9A 2UXCE 1T38A 2EMCA 2WZOA 1QU6A 4DV3E 3ADJA 1BBGA 2LJUA 2V83A 2EMBA 4IS1C 2LBSB 1BBOA 4WSGA 1F2IG 2EOIA 5LLQA 2L92A 4ZYGA 2JP9A 3EPHA 2DRPA 1G2DC 2N3HA 2E5LE 2EM3A 4MLQA 4KZSA 1JK1A 5TSEA 5CFFE 1AH5A 2V8QB 4OOGC 1X49A 2EPXA 2EPAA 2NABA 2EMFA 1X47A 1SFEA 2LJHA 2DLKA 4R2DA 2ZM6E 2EL5A 3EPJA 2EMGA 4B3TE 2EQ1A 1AAYA 4BCAA 4DR6E 4HTGA 5IXMB 2EN2A 1EH8A 4F6NA 3KZZA 3THOB 2LV2A 4DR7E 1DI2A 1EH6A 1IBKE 1TF6A 1MEYC 2EMLA 4DR5E 5A6KA 3AUZA 5KL4A 2EM0A 1IQSA 2ELZA 2RQLA 3M99B 2BB8A 1YUIA 4F2JC 1YZ9A 2EMZA 2EOMA 2JVAA 1YYKA 5FLXC 5A6BA 2EM7A 4GEQB 5AE2A 2PRTA 3ZOQB 1L4SA 4JI1E 1NEIA 2LUQA 4X65E 3C4TA 2EOQA 3KZYA 3LMLA 2YTOA 5IV8B 1MGTA 1WHNA 5LMNE 1HNWE 2NUFA 2EOFA 1BB8A 2EORA 3JTZA 1YYOA 1N33E 5LMUE 1X48A 1KYQA 2EMYA 2EMXA 3VYXA 4JI8E 4LFAE 2YTGA 4OX9E 2L2KB 2EM9A 2FTXB 3RMPA 3C4BA 1JK2A 1WJPA 2HC5A 5AC4A 4Q28A 5DNYA 2UUBE 2EPRA 1T4NA 2MDGA 2EPPA 1X6HA 1YSAC 2RSMA 2EOJA 2EOYA 2YTIA 1X6EA 2RS7A 4DUZE 2EM8A 2EL4A 2F4VE 2LMZA 4JI7E 5KL2A 4M2ZA 2DMYA 2V85A 1ZR9A 3BGHA 1DGCA 4LF6E 4LU9A 2WBSA 4JI2E 2L33A 4HEIA 3OTOE 1HNXE 2ODRC 3LLHA
chains in the Genus database with same CATH topology
2DSYA 4DMIA 3IWDA 2N3HA 2IHR1 2JWOA 2KONA 4KZSA 4DV6E 2E5LE 2B9DA 4JI5E 2MC6A 4NXME 4F54A 3HPZA 2RS6A 3JAMC 5CFFE 3J7Yp 2V8QB 3H09A 4OOGC 3F6GA 1X49A 2LRSA 4I8OA 4NXNE 2H36X 1HNZE 4LF8E 3IWCA 1X47A 2LJHA 4BS9A 4JI6E 2UUCE 1IBME 4LF9E 4M0VA 2ZM6E 2HHHE 3J7AG 4B3TE 2L6MA 2K4VA 4DV4E 2UUAE 4GKJE 3JU0A 1ZBTA 2KHXA 4BCAA 4DR6E 2V86A 4WFTA 2EWLA 3MSWA 3DF6A 1N33E 4YY3E 4B3SE 2CPNA 4DV7E 4DV5E 4K0KE 2N3GA 2JY9A 4M30A 4GKKE 2RTXA 5IT9C 4DR7E 4X8WA 1DI2A 4LF7E 1IBKE 1WXRA 4DV0E 4P78A 2VQEE 4DR5E 3AUZA 2B7VA 4LTYA 2MDRA 1XNQE 1N36E 2VF1A 1UILA 3P1XA 2V87A 4F9BB 4DR3E 3T1HE 4BBYA 4BMJA 4DR4E 3K6QA 2JOBA 4F9AB 5AE3A 1YZ9A 2VQFE 2ODRD 1WHQA 2JVAA 1YYKA 5FLXC 4DV2E 4WSPA 4WYQB 4JI0E 4GEQB 5AE2A 3ZOQB 4X62E 5AASA 1T4OA 3OMLA 4DR1E 4JI1E 4X65E 2LUQA 2EZ6A 1DQ3A 2UXBE 1XMQE 1I94E 3HPSA 3DJWA 3C4TA 5LL6R 3AV0A 2DB2A 2M4IA 3LMLA 1ZBQA 1UHZA 2F8BA 2G7HA 3VK6A 1N32E 4B3RE 2JOXA 2LE2A 1WHNA 5F3WA 2LTRA 5BR8E 1T4LB 2KOUA 2NA2A 3ADGA 3J81C 5LMNE 2NUFA 4J8ZA 3VYYA 4DR2E 1HNWE 2NUEA 2FGGA 3JTZA 4LF5E 2YT4A 3IWBA 4R8OA 3KWRA 2L3CA 5LMUE 1YYOA 1X48A 3J80C 1FKAE 5ADZA 2L3JA 1HR0E 4BC7A 2L2MA 2L8TA 2FV4B 4X66E 4LFCE 2UXDE 4X64E 3ADLA 1EKZA 3HQ1A 4JI4E 2ODRC 1J5EE 3ADIA 4DV1E 5IWAE 4P7DA 4JI8E 4LFAE 2M7QA 3VYXA 1XMOE 1STUA 4OX9E 3HTXA 2V89A 2YZTA 4JV5E 2L2KB 2FTXB 3RMPA 4DKKA 3C4BA 1RQ0A 2E1MA 3FIGA 4LF4E 4Q28A 1GQEA 2B3TB 4L5NC 3F6HA 5DNYA 5T6JA 2JR1A 4WPYA 4AQYE 2UUBE 1FJGE 4TUGA 1XNRE 1O0WA 1T4NA 2V88A 2LUPB 2VE7C 2B7TA 4BC9A 1GZ6A 4F9CB 5AE1A 2RSMA 3T1YE 4KHPE 4L8NA 1YYWA 4R03A 2DIXA 2RS7A 4DUZE 2M1SA 2UU9E 1SR9A 2F4VE 2UXCE 2LMZA 2L2NA 4JI7E 4TUIA 4M2ZA 5A2QC 2WZOA 2DMYA 2V85A 1QU6A 4DV3E 3ADJA 4JI3E 4LF6E 2NUGA 2V83A 4B3ME 4LU9A 1PKPA 2L33A 4JI2E 3HXLA 4DUYE 2LBSB 3OTOE 1RC7A 4LFBE 1N34E 4YHHE 1J26A 2MC5A 1HNXE 4JYAE 2LTSA 2L92A 3LLHA 1IBLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSY A;  4P7D A;  4P78 A;  2YZT A;  3KWR A; 
#chains in the Genus database with same CATH topology
 3IWD A;  2IHR 1;  2JWO A;  2EP3 A;  2YU8 A;  2HJJ A;  2EL6 A;  3H09 A;  3ECR A;  2LRS A;  2H36 X;  5A69 A;  4O5G A;  2UUC E;  2EM5 A;  3C6K A;  4GKJ E;  4MLV A;  4WFT A;  3MSW A;  4ZYH A;  2N8X A;  4K0K E;  2N3G A;  1YPN A;  1KJK A;  2RTX A;  4X8W A;  4LF7 E;  2VQE E;  3TQM A;  2EN3 A;  2MKD A;  2VF1 A;  2V87 A;  3EQ1 A;  1A1G A;  2EMA A;  3T1H E;  5KL7 A;  4DR4 E;  2VQF E;  2ODR D;  2CT1 A;  4DV2 E;  4WSP A;  1G2F C;  2EN1 A;  2EOE A;  2YTN A;  1T4O A;  2EOZ A;  1DQ3 A;  2EZ6 A;  1PDA A;  1XMQ E;  1I94 E;  1YUJ A;  3DJW A;  2DB2 A;  1ZBQ A;  1UHZ A;  2F8B A;  2ELY A;  5BR8 E;  1T4L B;  1UN6 B;  2KOU A;  2WBU A;  4DR2 E;  2NUE A;  2K7I A;  4LF5 E;  2YT4 A;  2L3C A;  3KWR A;  1FKA E;  3J80 C;  5ADZ A;  1TN9 A;  4ZYE A;  4BC7 A;  4O4K A;  4LFC E;  4X64 E;  4JI4 E;  1J5E E;  4P7D A;  2DMI A;  2YWQ A;  2V89 A;  2LCE A;  4DKK A;  1RQ0 A;  2E1M A;  2EPN A;  2EMH A;  2B3T B;  4L5N C;  3F6H A;  1FJG E;  2JR1 A;  4TUG A;  1O0W A;  4RH8 A;  2LUP B;  1PJT A;  2R76 A;  1GZ6 A;  2YTJ A;  4L8N A;  4NHR A;  2M1S A;  2UU9 E;  4TUI A;  1A1I A;  2GLI A;  5A2Q C;  4R2S A;  4NZV A;  1A1L A;  1PKP A;  4LFB E;  2JXP A;  3HXL A;  4DUY E;  1N34 E;  2MC5 A;  4R2C A;  4JYA E;  2LTS A;  1PJS A;  1A1K A;  1IBL E;  2KON A;  4NXM E;  2YTQ A;  2MC6 A;  4F54 A;  3JAM C;  2RS6 A;  2YPN A;  3F6G A;  4I8O A;  2EMW A;  1HNZ E;  5A6A A;  4BS9 A;  2ENC A;  4M0V A;  2HHH E;  2JYA A;  1IQO A;  2K4V A;  4WX9 A;  2UUA E;  2KHX A;  2EM6 A;  3QG5 C;  4WXC A;  4YY3 E;  4B3S E;  2CPN A;  4M30 A;  4GKK E;  5IT9 C;  5A6J A;  1ZAA C;  2EN8 A;  2ADR A;  4R2E A;  5KL6 A;  4Q35 B;  2M9A A;  4R2P A;  1T39 A;  2EN4 A;  2WBT A;  4LTY A;  4O24 A;  1GTK A;  2GPI A;  2EPO A;  2YRK A;  4F9B B;  4DR3 E;  3L00 A;  3K6Q A;  4WXD A;  2JOB A;  2EMI A;  1WHQ A;  2YTP A;  1WRJ A;  2CTD A;  4WYQ B;  1LLM C;  1RMD A;  4X62 E;  5AAS A;  3OML A;  4DR1 E;  4N4R B;  4IJD A;  3AV0 A;  2YU5 A;  3VK6 A;  2YRH A;  2G7H A;  2GHF A;  1IMU A;  1Z1B A;  5F3W A;  2YRM A;  3J81 C;  3ADG A;  3VYY A;  4JI6 E;  1NCS A;  1A1H A;  2L3J A;  2LO3 A;  2UXD E;  3THN A;  2RSI A;  2EOS A;  3HQ1 A;  3ADI A;  1X5W A;  1STU A;  2YZT A;  1TF3 A;  2EPM X;  3FIG A;  2MKN A;  2EN7 A;  4JI5 E;  2LVH A;  3MHH C;  4WPY A;  5T6J A;  2EJ4 A;  1XNR E;  2V88 A;  2ENH A;  1X6F A;  4F9C B;  4BC9 A;  3T1Y E;  2DLQ A;  5AE1 A;  4KHP E;  2EE8 A;  2EPL X;  2YTE A;  4BHB A;  2JPA A;  4JI3 E;  2WCC 3;  2EPK X;  1YFH A;  4B3M E;  2NUG A;  3MHS C;  4F6M A;  1RC7 A;  5KL5 A;  4YHH E;  1J26 A;  2L2N A;  2EOO A;  2DSY A;  3BBG A;  4DMI A;  4DV6 E;  1QNT A;  2B9D A;  3HPZ A;  3BID A;  2ENA A;  3J7Y p;  2YSO A;  4NXN E;  4GZN C;  4LF8 E;  3IWC A;  2A25 A;  2EOH A;  1IBM E;  4LF9 E;  4KWY A;  2EM4 A;  3J7A G;  2CSH A;  2L6M A;  4DV4 E;  4R2R A;  3JU0 A;  1ZBT A;  2V86 A;  2EPZ A;  1N3G A;  2EWL A;  3DF6 A;  5A6B D;  4DV7 E;  4DV5 E;  2BBG A;  2JY9 A;  1PJQ A;  2EM2 A;  4R2A A;  1WXR A;  4DV0 E;  4P78 A;  1X3C A;  2B7V A;  2MDR A;  1XNQ E;  4R2Q A;  1N36 E;  2I9I A;  1UIL A;  2Q8U A;  3P1X A;  4ZYD A;  2EQ3 A;  2EMK A;  2VRD A;  4BBY A;  4BMJ A;  3EPL A;  2RPC A;  4F9A B;  5AE3 A;  4JI0 E;  2YTD A;  1ZU1 A;  2EQ0 A;  2D9H A;  1P47 A;  2J7J A;  2UXB E;  3HPS A;  2DGC A;  5LL6 R;  2M4I A;  3C6M A;  1N32 E;  2HGH A;  4B3R E;  2JOX A;  2YTF A;  2LE2 A;  2LTR A;  1EH7 A;  2NA2 A;  1A1F A;  4J8Z A;  2FGG A;  3VHT B;  1A1J A;  2E72 A;  3IWB A;  4R8O A;  1HR0 E;  2EOX A;  3EPK A;  4RHB B;  2L2M A;  3BF2 A;  2L8T A;  4M9V C;  2FV4 B;  4X66 E;  4FK5 C;  3ADL A;  1EKZ A;  4X9J A;  2I13 A;  4DV1 E;  5IWA E;  2M7Q A;  1XMO E;  4BHC A;  1B69 A;  3HTX A;  2EPC A;  4JV5 E;  2LT7 A;  4LF4 E;  3UK3 C;  1GQE A;  5AC5 A;  4AQY E;  1UBD C;  2R1F A;  2VE7 C;  2B7T A;  2YSP A;  1YYW A;  2EPU A;  4R03 A;  2EN6 A;  2DIX A;  4O43 A;  5KL3 A;  1SR9 A;  2UXC E;  1T38 A;  2EMC A;  2WZO A;  1QU6 A;  4DV3 E;  3ADJ A;  1BBG A;  2LJU A;  2V83 A;  2EMB A;  4IS1 C;  2LBS B;  1BBO A;  4WSG A;  1F2I G;  2EOI A;  5LLQ A;  2L92 A;  4ZYG A;  2JP9 A;  3EPH A;  2DRP A;  1G2D C;  2N3H A;  2E5L E;  2EM3 A;  4MLQ A;  4KZS A;  1JK1 A;  5TSE A;  5CFF E;  1AH5 A;  2V8Q B;  4OOG C;  1X49 A;  2EPX A;  2EPA A;  2NAB A;  2EMF A;  1X47 A;  1SFE A;  2LJH A;  2DLK A;  4R2D A;  2ZM6 E;  2EL5 A;  3EPJ A;  2EMG A;  4B3T E;  2EQ1 A;  1AAY A;  4BCA A;  4DR6 E;  4HTG A;  5IXM B;  2EN2 A;  1EH8 A;  4F6N A;  3KZZ A;  3THO B;  2LV2 A;  4DR7 E;  1DI2 A;  1EH6 A;  1IBK E;  1TF6 A;  1MEY C;  2EML A;  4DR5 E;  5A6K A;  3AUZ A;  5KL4 A;  2EM0 A;  1IQS A;  2ELZ A;  2RQL A;  3M99 B;  2BB8 A;  1YUI A;  4F2J C;  1YZ9 A;  2EMZ A;  2EOM A;  2JVA A;  1YYK A;  5FLX C;  5A6B A;  2EM7 A;  4GEQ B;  5AE2 A;  2PRT A;  3ZOQ B;  1L4S A;  4JI1 E;  1NEI A;  2LUQ A;  4X65 E;  3C4T A;  2EOQ A;  3KZY A;  3LML A;  2YTO A;  5IV8 B;  1MGT A;  1WHN A;  5LMN E;  1HNW E;  2NUF A;  2EOF A;  1BB8 A;  2EOR A;  3JTZ A;  1YYO A;  1N33 E;  5LMU E;  1X48 A;  1KYQ A;  2EMY A;  2EMX A;  3VYX A;  4JI8 E;  4LFA E;  2YTG A;  4OX9 E;  2L2K B;  2EM9 A;  2FTX B;  3RMP A;  3C4B A;  1JK2 A;  1WJP A;  2HC5 A;  5AC4 A;  4Q28 A;  5DNY A;  2UUB E;  2EPR A;  1T4N A;  2MDG A;  2EPP A;  1X6H A;  1YSA C;  2RSM A;  2EOJ A;  2EOY A;  2YTI A;  1X6E A;  2RS7 A;  4DUZ E;  2EM8 A;  2EL4 A;  2F4V E;  2LMZ A;  4JI7 E;  5KL2 A;  4M2Z A;  2DMY A;  2V85 A;  1ZR9 A;  3BGH A;  1DGC A;  4LF6 E;  4LU9 A;  2WBS A;  4JI2 E;  2L33 A;  4HEI A;  3OTO E;  1HNX E;  2ODR C;  3LLH A; 
#chains in the Genus database with same CATH homology
 2DSY A;  4DMI A;  3IWD A;  2N3H A;  2IHR 1;  2JWO A;  2KON A;  4KZS A;  4DV6 E;  2E5L E;  2B9D A;  4JI5 E;  2MC6 A;  4NXM E;  4F54 A;  3HPZ A;  2RS6 A;  3JAM C;  5CFF E;  3J7Y p;  2V8Q B;  3H09 A;  4OOG C;  3F6G A;  1X49 A;  2LRS A;  4I8O A;  4NXN E;  2H36 X;  1HNZ E;  4LF8 E;  3IWC A;  1X47 A;  2LJH A;  4BS9 A;  4JI6 E;  2UUC E;  1IBM E;  4LF9 E;  4M0V A;  2ZM6 E;  2HHH E;  3J7A G;  4B3T E;  2L6M A;  2K4V A;  4DV4 E;  2UUA E;  4GKJ E;  3JU0 A;  1ZBT A;  2KHX A;  4BCA A;  4DR6 E;  2V86 A;  4WFT A;  2EWL A;  3MSW A;  3DF6 A;  1N33 E;  4YY3 E;  4B3S E;  2CPN A;  4DV7 E;  4DV5 E;  4K0K E;  2N3G A;  2JY9 A;  4M30 A;  4GKK E;  2RTX A;  5IT9 C;  4DR7 E;  4X8W A;  1DI2 A;  4LF7 E;  1IBK E;  1WXR A;  4DV0 E;  4P78 A;  2VQE E;  4DR5 E;  3AUZ A;  2B7V A;  4LTY A;  2MDR A;  1XNQ E;  1N36 E;  2VF1 A;  1UIL A;  3P1X A;  2V87 A;  4F9B B;  4DR3 E;  3T1H E;  4BBY A;  4BMJ A;  4DR4 E;  3K6Q A;  2JOB A;  4F9A B;  5AE3 A;  1YZ9 A;  2VQF E;  2ODR D;  1WHQ A;  2JVA A;  1YYK A;  5FLX C;  4DV2 E;  4WSP A;  4WYQ B;  4JI0 E;  4GEQ B;  5AE2 A;  3ZOQ B;  4X62 E;  5AAS A;  1T4O A;  3OML A;  4DR1 E;  4JI1 E;  4X65 E;  2LUQ A;  2EZ6 A;  1DQ3 A;  2UXB E;  1XMQ E;  1I94 E;  3HPS A;  3DJW A;  3C4T A;  5LL6 R;  3AV0 A;  2DB2 A;  2M4I A;  3LML A;  1ZBQ A;  1UHZ A;  2F8B A;  2G7H A;  3VK6 A;  1N32 E;  4B3R E;  2JOX A;  2LE2 A;  1WHN A;  5F3W A;  2LTR A;  5BR8 E;  1T4L B;  2KOU A;  2NA2 A;  3ADG A;  3J81 C;  5LMN E;  2NUF A;  4J8Z A;  3VYY A;  4DR2 E;  1HNW E;  2NUE A;  2FGG A;  3JTZ A;  4LF5 E;  2YT4 A;  3IWB A;  4R8O A;  3KWR A;  2L3C A;  5LMU E;  1YYO A;  1X48 A;  3J80 C;  1FKA E;  5ADZ A;  2L3J A;  1HR0 E;  4BC7 A;  2L2M A;  2L8T A;  2FV4 B;  4X66 E;  4LFC E;  2UXD E;  4X64 E;  3ADL A;  1EKZ A;  3HQ1 A;  4JI4 E;  2ODR C;  1J5E E;  3ADI A;  4DV1 E;  5IWA E;  4P7D A;  4JI8 E;  4LFA E;  2M7Q A;  3VYX A;  1XMO E;  1STU A;  4OX9 E;  3HTX A;  2V89 A;  2YZT A;  4JV5 E;  2L2K B;  2FTX B;  3RMP A;  4DKK A;  3C4B A;  1RQ0 A;  2E1M A;  3FIG A;  4LF4 E;  4Q28 A;  1GQE A;  2B3T B;  4L5N C;  3F6H A;  5DNY A;  5T6J A;  2JR1 A;  4WPY A;  4AQY E;  2UUB E;  1FJG E;  4TUG A;  1XNR E;  1O0W A;  1T4N A;  2V88 A;  2LUP B;  2VE7 C;  2B7T A;  4BC9 A;  1GZ6 A;  4F9C B;  5AE1 A;  2RSM A;  3T1Y E;  4KHP E;  4L8N A;  1YYW A;  4R03 A;  2DIX A;  2RS7 A;  4DUZ E;  2M1S A;  2UU9 E;  1SR9 A;  2F4V E;  2UXC E;  2LMZ A;  2L2N A;  4JI7 E;  4TUI A;  4M2Z A;  5A2Q C;  2WZO A;  2DMY A;  2V85 A;  1QU6 A;  4DV3 E;  3ADJ A;  4JI3 E;  4LF6 E;  2NUG A;  2V83 A;  4B3M E;  4LU9 A;  1PKP A;  2L33 A;  4JI2 E;  3HXL A;  4DUY E;  2LBS B;  3OTO E;  1RC7 A;  4LFB E;  1N34 E;  4YHH E;  1J26 A;  2MC5 A;  1HNX E;  4JYA E;  2LTS A;  2L92 A;  3LLH A;  1IBL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...