2NA2A

Drosha quad mutant double-stranded rna binding competent
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
GPGNDPISQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards understanding Drosha dsRBDs role in Microprocessing
rcsb
source organism Homo sapiens
molecule tags Nuclear protein/rna binding protein
molecule keywords Ribonuclease 3
total genus 12
structure length 82
sequence length 82
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2na2A00
1HR0E 4JI0E 1O0WA 5IWAE 4DUYE 1FJGE 2EZ6A 4X66E 1N34E 1N33E 1GQEA 4DV1E 3VYXA 4YY3E 1XNQE 4JI4E 2LTRA 5LMNE 4X8WA 4JI3E 4DV6E 4KHPE 4DR5E 4OOGC 3P1XA 4JI7E 4WYQB 1UHZA 2B7TA 1UILA 1YYWA 2JY9A 1N32E 2RS7A 4DV4E 1T4OA 4LF9E 1YYKA 4LF8E 4DR3E 1J26A 1EKZA 4NXME 3HTXA 2L2NA 1T4NA 4JI8E 2NUFA 2HHHE 4DV5E 2NA2A 3C4TA 2RSMA 1X47A 2N3GA 3OTOE 1YZ9A 4JYAE 2LRSA 4DV3E 2DMYA 4JI1E 4LFCE 1WHNA 4OX9E 1XMOE 1T4LB 1RC7A 4M30A 2UUCE 2CPNA 2KHXA 3ADGA 1IBKE 4NXNE 2UUAE 3VYYA 4DR6E 2UXDE 2MDRA 4DR1E 1I94E 1QU6A 1J5EE 4LFAE 1XNRE 4JI5E 2UXBE 4M2ZA 3ADJA 2L3JA 4JI2E 2L2KB 4DV0E 2UU9E 2NUEA 2L33A 1ZBTA 1X49A 2N3HA 1PKPA 3T1YE 4LFBE 4LF5E 2UXCE 1X48A 1HNXE 1IBME 4B3SE 2DB2A 2IHR1 4K0KE 3ADLA 4YHHE 1DI2A 4WFTA 4X64E 1N36E 2JVAA 4X62E 2LUPB 2F4VE 2B3TB 5CFFE 2L2MA 5LMUE 4LF7E 4DR2E 1STUA 4DR7E 2VQEE 2LTSA 2YT4A 2DIXA 4B3ME 4B3RE 2B7VA 4JV5E 2E5LE 1WHQA 4GKJE 3J7Yp 4AQYE 4LF4E 2NUGA 3C4BA 2LUQA 4X65E 2ZM6E 2VQFE 4DUZE 2L3CA 1FKAE 1HNZE 1RQ0A 3ADIA 4GKKE 4DV7E 2LJHA 1XMQE 4JI6E 2RTXA 2UUBE 4LF6E 4B3TE 2RS6A 1IBLE 4DKKA 3T1HE 4DV2E 4DR4E 3LLHA 2LBSB 1HNWE 5BR8E 1YYOA
chains in the Genus database with same CATH superfamily
4KZSA 5KL7A 2EMCA 2EOHA 2WBTA 4NHRA 2K4VA 2HGHA 1JK2A 2EOMA 4IJDA 2M4IA 2LV2A 4X9JA 2L8TA 2LE2A 4DR5E 5A6KA 3P1XA 4TUIA 2EM9A 1YYWA 2JY9A 3C6MA 4ZYDA 1N32E 3ECRA 1IMUA 1YYKA 4GEQB 2J7JA 2YTPA 1J26A 4MLQA 4O43A 1EKZA 1ZR9A 3J80C 4JI8E 4GZNC 1WRJA 1X47A 4ZYHA 2V8QB 2EMZA 2B9DA 3JU0A 3EPHA 2LRSA 2EL4A 2ENCA 1RC7A 2EPRA 4M30A 2EOOA 2JWOA 2KHXA 2LT7A 2UUAE 2UXDE 2V85A 2MDRA 1KJKA 4BHCA 3MSWA 1UN6B 2EMBA 1NCSA 4JI5E 4O5GA 2EM2A 1BBGA 4IS1C 3ADJA 2K7IA 1JK1A 2YTIA 2NUEA 1ZBTA 2EL5A 4R2RA 2UXCE 1NEIA 2VF1A 4RH8A 2EOJA 3BBGA 3ZOQB 2DB2A 1TF6A 1YUJA 4K0KE 2EOIA 4ZYEA 4X64E 2JVAA 2YRKA 2LUPB 2DLKA 2B3TB 4DR2E 4BCAA 2VQEE 2ELYA 1G2FC 2Q8UA 4B3ME 4JV5E 2N8XA 2M1SA 1AAYA 1X6EA 2JYAA 2DLQA 2EPNA 3HQ1A 2R76A 2YTDA 3F6HA 3M99B 1X6FA 4DMIA 4R2AA 2L6MA 4DV7E 1DGCA 2A25A 1SR9A 3T1HE 1MEYC 2MC6A 1G2DC 5KL2A 2JR1A 2EM8A 1YFHA 2F8BA 1HR0E 4JI0E 1ZBQA 4DUYE 1FJGE 1PJSA 1N34E 3VYXA 2YU8A 4YY3E 1XNQE 2KONA 5LMNE 3BF2A 5IV8B 4JI3E 4OOGC 2EN3A 4JI7E 2V88A 4WYQB 1Z1BA 2V83A 1UILA 3MHHC 2RS7A 4F9AB 3IWDA 3J81C 2RSIA 1A1LA 2YTEA 1PJTA 2RSMA 2EOXA 2N3GA 4BC7A 3AV0A 4JYAE 4JI1E 5A2QC 4R2QA 4OX9E 1BB8A 1XMOE 2YTGA 4KWYA 1T4LB 2EOQA 1YPNA 2GPIA 2GLIA 4WX9A 1L4SA 2CPNA 1IBKE 4NXNE 4DR6E 3VYYA 2EPZA 2ODRD 2EOZA 1QU6A 3FIGA 1J5EE 2EM4A 2I9IA 2JP9A 2UXBE 1T39A 3F6GA 1TF3A 5A6JA 3EPJA 2EPUA 2L3JA 2L2KB 2EL6A 2EP3A 4RHBB 1A1HA 1X49A 4LTYA 2MKNA 1X48A 2EPOA 1HNXE 2GHFA 2EOSA 3LMLA 2IHR1 3ADLA 1T38A 1P47A 2DGCA 1N36E 2EMGA 3L00A 2KOUA 4F9CB 1QNTA 1STUA 1UBDC 2R1FA 3VHTB 4HTGA 3DF6A 3IWCA 4AQYE 4Q35B 5DNYA 4X65E 4L5NC 2VQFE 2YTJA 4O4KA 3ADIA 2LJHA 3VK6A 3C6KA 1A1FA 2RTXA 2FV4B 2UUBE 3MHSC 4LF6E 2ODRC 2RS6A 3EQ1A 2LMZA 4DKKA 4BBYA 3LLHA 2EM5A 3J7AG 1YYOA 3K6QA 2RPCA 1BBOA 1O0WA 5IWAE 2E1MA 5IT9C 4X66E 1N33E 2EM3A 4JI4E 2YSPA 2EPAA 2LTRA 3AUZA 3EPLA 3H09A 2CT1A 4F54A 2L92A 2YU5A 1WJPA 2EPCA 2B7TA 4N4RB 2M9AA 5F3WA 1T4OA 4NZVA 4LF8E 4DR3E 4NXME 3HTXA 4R8OA 2NUFA 3KZYA 1ZAAC 1PDAA 2HHHE 4DV5E 2DRPA 3C4TA 1EH8A 2G7HA 2EQ1A 5A6AA 1YZ9A 4LFCE 2MC5A 2YRMA 5KL4A 2EMXA 5A6BD 4F2JC 1IQOA 1GTKA 3BGHA 4BMJA 5KL5A 2UUCE 1KYQA 5KL3A 5AE3A 1I94E 2EOYA 2YWQA 1XNRE 3KZZA 1ZU1A 4M2ZA 2YZTA 2DMIA 2MDGA 2YSOA 2WCC3 1B69A 2UU9E 2YTOA 2LJUA 4ZYGA 5AC4A 3T1YE 2VE7C 2EMIA 2EOFA 3BIDA 2BBGA 4BHBA 1IBME 4R2EA 4WXDA 4L8NA 4TUGA 5A69A 2EMFA 4YHHE 1A1GA 1DI2A 4WFTA 3JTZA 2F4VE 2L2MA 4DR7E 1TN9A 2EJ4A 3UK3C 2YT4A 2V86A 4B3RE 2B7VA 4M0VA 2EMWA 1WHQA 3OMLA 5ADZA 3HPSA 4F6NA 5IXMB 4LF4E 2EMYA 3C4BA 2ZM6E 4M9VC 2ENHA 5TSEA 5AE1A 1FKAE 1HNZE 4GKKE 1XMQE 1EH6A 4JI6E 2NABA 2JOXA 5AC5A 2EN7A 4LU9A 4DV2E 4DR4E 2LBSB 2EN8A 4R2DA 2I13A 2EZ6A 1GQEA 4R03A 2EOEA 2PRTA 2EQ0A 4DV1E 1LLMC 2EORA 2YRHA 4X8WA 5T6JA 2MKDA 1F2IG 2YPNA 4DV6E 2JPAA 4KHPE 5A6BA 1YUIA 2E72A 1UHZA 5AE2A 2BB8A 3HXLA 4P7DA 2EM7A 4O24A 4DV4E 4LF9E 4BC9A 2LCEA 2EN2A 1T4NA 2EMKA 2L2NA 3RMPA 1A1KA 2EQ3A 4R2PA 2ENAA 2NA2A 3KWRA 2HC5A 2EM6A 2EM0A 2HJJA 3DJWA 3HPZA 4HEIA 3OTOE 2V87A 4DV3E 2DMYA 2EN4A 2V89A 1PJQA 1WHNA 3THNA 2WBUA 2EPKX 3QG5C 2EPPA 3ADGA 1GZ6A 4DR1E 2JXPA 2EMAA 4LFAE 4J8ZA 3THOB 2YTFA 2M7QA 5FLXC 4JI2E 4DV0E 1N3GA 2L33A 2VRDA 2EPMX 2D9HA 2N3HA 1PKPA 4LFBE 4LF5E 2EE8A 2LVHA 1DQ3A 4B3SE 4R2SA 4F9BB 2ADRA 2RQLA 2WZOA 2EPLX 2EMHA 4R2CA 5KL6A 1X6HA 4Q28A 2YTQA 2CSHA 3EPKA 4X62E 1X3CA 2ELZA 5CFFE 5LMUE 4LF7E 2CTDA 2EN6A 1X5WA 2LTSA 1SFEA 2DIXA 2EPXA 2LO3A 4BS9A 2E5LE 3TQMA 1RMDA 4GKJE 2JOBA 2FTXB 3J7Yp 2WBSA 1A1JA 2EWLA 4F6MA 2NUGA 5LLQA 4WSGA 2DSYA 2LUQA 1EH7A 1YSAC 4WXCA 1A1IA 2EN1A 5LL6R 2L3CA 4DUZE 1RQ0A 1WXRA 5AASA 2YTNA 4MLVA 3JAMC 1IQSA 4B3TE 1IBLE 1MGTA 1AH5A 4FK5C 3IWBA 4WSPA 4P78A 2FGGA 2H36X 2EMLA 1HNWE 5BR8E 4I8OA 4WPYA
chains in the Genus database with same CATH topology
3K6QA 2F8BA 4KZSA 1HR0E 4JI0E 1ZBQA 1O0WA 5IWAE 4DUYE 2E1MA 5IT9C 4X66E 1N34E 1FJGE 2EZ6A 1GQEA 4R03A 1N33E 4DV1E 3VYXA 4YY3E 1XNQE 4JI4E 2KONA 2K4VA 2LTRA 3AUZA 4X8WA 5T6JA 5LMNE 3H09A 2M4IA 4F54A 4JI3E 2L92A 2L8TA 4DV6E 2LE2A 4DR5E 4KHPE 4OOGC 3P1XA 4JI7E 2V88A 1UHZA 2B7TA 2V83A 4WYQB 5AE2A 3HXLA 4P7DA 4TUIA 1UILA 1YYWA 2JY9A 1N32E 5F3WA 2RS7A 4DV4E 1T4OA 4BC9A 4F9AB 4LF9E 4GEQB 1YYKA 4LF8E 4DR3E 1J26A 1EKZA 4NXME 3HTXA 3IWDA 3J81C 2L2NA 1T4NA 3J80C 4R8OA 4JI8E 3RMPA 2NUFA 2HHHE 4DV5E 2NA2A 3KWRA 3C4TA 2RSMA 1X47A 2V8QB 2G7HA 2N3GA 3DJWA 3HPZA 2B9DA 4BC7A 3AV0A 3JU0A 3OTOE 1YZ9A 2V87A 2LRSA 4DV3E 2DMYA 2MC5A 5A2QC 4JI1E 4LFCE 4JYAE 2V89A 1WHNA 4OX9E 1XMOE 1T4LB 1RC7A 4M30A 2JWOA 4BMJA 2CPNA 2KHXA 2UUCE 3ADGA 1IBKE 4NXNE 2UUAE 3VYYA 4DR6E 2UXDE 1GZ6A 2V85A 2ODRD 2MDRA 5AE3A 4DR1E 1I94E 4GKKE 1QU6A 3FIGA 1J5EE 4LFAE 3MSWA 1XNRE 4J8ZA 4JI5E 2UXBE 3F6GA 2M7QA 5FLXC 4M2ZA 3ADJA 2YZTA 2L3JA 1YYOA 2L2KB 4DV0E 4JI2E 2UU9E 2NUEA 2L33A 1ZBTA 1X49A 2N3HA 1PKPA 2VE7C 4LTYA 3T1YE 4LF5E 4LFBE 1X48A 1HNXE 2UXCE 1DQ3A 1IBME 4B3SE 4F9BB 2VF1A 2WZOA 3LMLA 2DB2A 3ZOQB 2IHR1 4L8NA 4TUGA 3ADLA 4K0KE 4YHHE 4Q28A 1DI2A 4WFTA 3JTZA 4X64E 1N36E 2JVAA 4X62E 2LUPB 2KOUA 4F9CB 2F4VE 2B3TB 5CFFE 2L2MA 5LMUE 4LF7E 4DR2E 4BCAA 1STUA 4DR7E 2VQEE 2LTSA 2YT4A 2V86A 2DIXA 4BS9A 4B3ME 4B3RE 2B7VA 4JV5E 2E5LE 4M0VA 1WHQA 3DF6A 3OMLA 4GKJE 3IWCA 2JOBA 2FTXB 5ADZA 3HPSA 3J7Yp 4AQYE 3ADIA 2M1SA 2EWLA 4LF4E 2NUGA 1HNWE 3C4BA 5DNYA 2DSYA 2LUQA 4X65E 4L5NC 2ZM6E 3HQ1A 2VQFE 3F6HA 4DMIA 4DUZE 5LL6R 5AE1A 2L3CA 1RQ0A 1FKAE 2L6MA 4DV7E 1HNZE 2LJHA 5AASA 3VK6A 1WXRA 1XMQE 4JI6E 2RTXA 3JAMC 2FV4B 2UUBE 4LF6E 2ODRC 4B3TE 2RS6A 1SR9A 1IBLE 2JOXA 2LMZA 4LU9A 4DKKA 3T1HE 4BBYA 3IWBA 4WSPA 4P78A 2MC6A 4DV2E 4DR4E 3LLHA 2FGGA 2H36X 2LBSB 3J7AG 5BR8E 2JR1A 4I8OA 4WPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 E;  4JI0 E;  1O0W A;  5IWA E;  4DUY E;  1FJG E;  2EZ6 A;  4X66 E;  1N34 E;  1N33 E;  1GQE A;  4DV1 E;  3VYX A;  4YY3 E;  1XNQ E;  4JI4 E;  2LTR A;  5LMN E;  4X8W A;  4JI3 E;  4DV6 E;  4KHP E;  4DR5 E;  4OOG C;  3P1X A;  4JI7 E;  4WYQ B;  1UHZ A;  2B7T A;  1UIL A;  1YYW A;  2JY9 A;  1N32 E;  2RS7 A;  4DV4 E;  1T4O A;  4LF9 E;  1YYK A;  4LF8 E;  4DR3 E;  1J26 A;  1EKZ A;  4NXM E;  3HTX A;  2L2N A;  1T4N A;  4JI8 E;  2NUF A;  2HHH E;  4DV5 E;  2NA2 A;  3C4T A;  2RSM A;  1X47 A;  2N3G A;  3OTO E;  1YZ9 A;  4JYA E;  2LRS A;  4DV3 E;  2DMY A;  4JI1 E;  4LFC E;  1WHN A;  4OX9 E;  1XMO E;  1T4L B;  1RC7 A;  4M30 A;  2UUC E;  2CPN A;  2KHX A;  3ADG A;  1IBK E;  4NXN E;  2UUA E;  3VYY A;  4DR6 E;  2UXD E;  2MDR A;  4DR1 E;  1I94 E;  1QU6 A;  1J5E E;  4LFA E;  1XNR E;  4JI5 E;  2UXB E;  4M2Z A;  3ADJ A;  2L3J A;  4JI2 E;  2L2K B;  4DV0 E;  2UU9 E;  2NUE A;  2L33 A;  1ZBT A;  1X49 A;  2N3H A;  1PKP A;  3T1Y E;  4LFB E;  4LF5 E;  2UXC E;  1X48 A;  1HNX E;  1IBM E;  4B3S E;  2DB2 A;  2IHR 1;  4K0K E;  3ADL A;  4YHH E;  1DI2 A;  4WFT A;  4X64 E;  1N36 E;  2JVA A;  4X62 E;  2LUP B;  2F4V E;  2B3T B;  5CFF E;  2L2M A;  5LMU E;  4LF7 E;  4DR2 E;  1STU A;  4DR7 E;  2VQE E;  2LTS A;  2YT4 A;  2DIX A;  4B3M E;  4B3R E;  2B7V A;  4JV5 E;  2E5L E;  1WHQ A;  4GKJ E;  3J7Y p;  4AQY E;  4LF4 E;  2NUG A;  3C4B A;  2LUQ A;  4X65 E;  2ZM6 E;  2VQF E;  4DUZ E;  2L3C A;  1FKA E;  1HNZ E;  1RQ0 A;  3ADI A;  4GKK E;  4DV7 E;  2LJH A;  1XMQ E;  4JI6 E;  2RTX A;  2UUB E;  4LF6 E;  4B3T E;  2RS6 A;  1IBL E;  4DKK A;  3T1H E;  4DV2 E;  4DR4 E;  3LLH A;  2LBS B;  1HNW E;  5BR8 E;  1YYO A; 
#chains in the Genus database with same CATH topology
 4KZS A;  5KL7 A;  2EMC A;  2EOH A;  2WBT A;  4NHR A;  2K4V A;  2HGH A;  1JK2 A;  2EOM A;  4IJD A;  2M4I A;  2LV2 A;  4X9J A;  2L8T A;  2LE2 A;  4DR5 E;  5A6K A;  3P1X A;  4TUI A;  2EM9 A;  1YYW A;  2JY9 A;  3C6M A;  4ZYD A;  1N32 E;  3ECR A;  1IMU A;  1YYK A;  4GEQ B;  2J7J A;  2YTP A;  1J26 A;  4MLQ A;  4O43 A;  1EKZ A;  1ZR9 A;  3J80 C;  4JI8 E;  4GZN C;  1WRJ A;  1X47 A;  4ZYH A;  2V8Q B;  2EMZ A;  2B9D A;  3JU0 A;  3EPH A;  2LRS A;  2EL4 A;  2ENC A;  1RC7 A;  2EPR A;  4M30 A;  2EOO A;  2JWO A;  2KHX A;  2LT7 A;  2UUA E;  2UXD E;  2V85 A;  2MDR A;  1KJK A;  4BHC A;  3MSW A;  1UN6 B;  2EMB A;  1NCS A;  4JI5 E;  4O5G A;  2EM2 A;  1BBG A;  4IS1 C;  3ADJ A;  2K7I A;  1JK1 A;  2YTI A;  2NUE A;  1ZBT A;  2EL5 A;  4R2R A;  2UXC E;  1NEI A;  2VF1 A;  4RH8 A;  2EOJ A;  3BBG A;  3ZOQ B;  2DB2 A;  1TF6 A;  1YUJ A;  4K0K E;  2EOI A;  4ZYE A;  4X64 E;  2JVA A;  2YRK A;  2LUP B;  2DLK A;  2B3T B;  4DR2 E;  4BCA A;  2VQE E;  2ELY A;  1G2F C;  2Q8U A;  4B3M E;  4JV5 E;  2N8X A;  2M1S A;  1AAY A;  1X6E A;  2JYA A;  2DLQ A;  2EPN A;  3HQ1 A;  2R76 A;  2YTD A;  3F6H A;  3M99 B;  1X6F A;  4DMI A;  4R2A A;  2L6M A;  4DV7 E;  1DGC A;  2A25 A;  1SR9 A;  3T1H E;  1MEY C;  2MC6 A;  1G2D C;  5KL2 A;  2JR1 A;  2EM8 A;  1YFH A;  2F8B A;  1HR0 E;  4JI0 E;  1ZBQ A;  4DUY E;  1FJG E;  1PJS A;  1N34 E;  3VYX A;  2YU8 A;  4YY3 E;  1XNQ E;  2KON A;  5LMN E;  3BF2 A;  5IV8 B;  4JI3 E;  4OOG C;  2EN3 A;  4JI7 E;  2V88 A;  4WYQ B;  1Z1B A;  2V83 A;  1UIL A;  3MHH C;  2RS7 A;  4F9A B;  3IWD A;  3J81 C;  2RSI A;  1A1L A;  2YTE A;  1PJT A;  2RSM A;  2EOX A;  2N3G A;  4BC7 A;  3AV0 A;  4JYA E;  4JI1 E;  5A2Q C;  4R2Q A;  4OX9 E;  1BB8 A;  1XMO E;  2YTG A;  4KWY A;  1T4L B;  2EOQ A;  1YPN A;  2GPI A;  2GLI A;  4WX9 A;  1L4S A;  2CPN A;  1IBK E;  4NXN E;  4DR6 E;  3VYY A;  2EPZ A;  2ODR D;  2EOZ A;  1QU6 A;  3FIG A;  1J5E E;  2EM4 A;  2I9I A;  2JP9 A;  2UXB E;  1T39 A;  3F6G A;  1TF3 A;  5A6J A;  3EPJ A;  2EPU A;  2L3J A;  2L2K B;  2EL6 A;  2EP3 A;  4RHB B;  1A1H A;  1X49 A;  4LTY A;  2MKN A;  1X48 A;  2EPO A;  1HNX E;  2GHF A;  2EOS A;  3LML A;  2IHR 1;  3ADL A;  1T38 A;  1P47 A;  2DGC A;  1N36 E;  2EMG A;  3L00 A;  2KOU A;  4F9C B;  1QNT A;  1STU A;  1UBD C;  2R1F A;  3VHT B;  4HTG A;  3DF6 A;  3IWC A;  4AQY E;  4Q35 B;  5DNY A;  4X65 E;  4L5N C;  2VQF E;  2YTJ A;  4O4K A;  3ADI A;  2LJH A;  3VK6 A;  3C6K A;  1A1F A;  2RTX A;  2FV4 B;  2UUB E;  3MHS C;  4LF6 E;  2ODR C;  2RS6 A;  3EQ1 A;  2LMZ A;  4DKK A;  4BBY A;  3LLH A;  2EM5 A;  3J7A G;  1YYO A;  3K6Q A;  2RPC A;  1BBO A;  1O0W A;  5IWA E;  2E1M A;  5IT9 C;  4X66 E;  1N33 E;  2EM3 A;  4JI4 E;  2YSP A;  2EPA A;  2LTR A;  3AUZ A;  3EPL A;  3H09 A;  2CT1 A;  4F54 A;  2L92 A;  2YU5 A;  1WJP A;  2EPC A;  2B7T A;  4N4R B;  2M9A A;  5F3W A;  1T4O A;  4NZV A;  4LF8 E;  4DR3 E;  4NXM E;  3HTX A;  4R8O A;  2NUF A;  3KZY A;  1ZAA C;  1PDA A;  2HHH E;  4DV5 E;  2DRP A;  3C4T A;  1EH8 A;  2G7H A;  2EQ1 A;  5A6A A;  1YZ9 A;  4LFC E;  2MC5 A;  2YRM A;  5KL4 A;  2EMX A;  5A6B D;  4F2J C;  1IQO A;  1GTK A;  3BGH A;  4BMJ A;  5KL5 A;  2UUC E;  1KYQ A;  5KL3 A;  5AE3 A;  1I94 E;  2EOY A;  2YWQ A;  1XNR E;  3KZZ A;  1ZU1 A;  4M2Z A;  2YZT A;  2DMI A;  2MDG A;  2YSO A;  2WCC 3;  1B69 A;  2UU9 E;  2YTO A;  2LJU A;  4ZYG A;  5AC4 A;  3T1Y E;  2VE7 C;  2EMI A;  2EOF A;  3BID A;  2BBG A;  4BHB A;  1IBM E;  4R2E A;  4WXD A;  4L8N A;  4TUG A;  5A69 A;  2EMF A;  4YHH E;  1A1G A;  1DI2 A;  4WFT A;  3JTZ A;  2F4V E;  2L2M A;  4DR7 E;  1TN9 A;  2EJ4 A;  3UK3 C;  2YT4 A;  2V86 A;  4B3R E;  2B7V A;  4M0V A;  2EMW A;  1WHQ A;  3OML A;  5ADZ A;  3HPS A;  4F6N A;  5IXM B;  4LF4 E;  2EMY A;  3C4B A;  2ZM6 E;  4M9V C;  2ENH A;  5TSE A;  5AE1 A;  1FKA E;  1HNZ E;  4GKK E;  1XMQ E;  1EH6 A;  4JI6 E;  2NAB A;  2JOX A;  5AC5 A;  2EN7 A;  4LU9 A;  4DV2 E;  4DR4 E;  2LBS B;  2EN8 A;  4R2D A;  2I13 A;  2EZ6 A;  1GQE A;  4R03 A;  2EOE A;  2PRT A;  2EQ0 A;  4DV1 E;  1LLM C;  2EOR A;  2YRH A;  4X8W A;  5T6J A;  2MKD A;  1F2I G;  2YPN A;  4DV6 E;  2JPA A;  4KHP E;  5A6B A;  1YUI A;  2E72 A;  1UHZ A;  5AE2 A;  2BB8 A;  3HXL A;  4P7D A;  2EM7 A;  4O24 A;  4DV4 E;  4LF9 E;  4BC9 A;  2LCE A;  2EN2 A;  1T4N A;  2EMK A;  2L2N A;  3RMP A;  1A1K A;  2EQ3 A;  4R2P A;  2ENA A;  2NA2 A;  3KWR A;  2HC5 A;  2EM6 A;  2EM0 A;  2HJJ A;  3DJW A;  3HPZ A;  4HEI A;  3OTO E;  2V87 A;  4DV3 E;  2DMY A;  2EN4 A;  2V89 A;  1PJQ A;  1WHN A;  3THN A;  2WBU A;  2EPK X;  3QG5 C;  2EPP A;  3ADG A;  1GZ6 A;  4DR1 E;  2JXP A;  2EMA A;  4LFA E;  4J8Z A;  3THO B;  2YTF A;  2M7Q A;  5FLX C;  4JI2 E;  4DV0 E;  1N3G A;  2L33 A;  2VRD A;  2EPM X;  2D9H A;  2N3H A;  1PKP A;  4LFB E;  4LF5 E;  2EE8 A;  2LVH A;  1DQ3 A;  4B3S E;  4R2S A;  4F9B B;  2ADR A;  2RQL A;  2WZO A;  2EPL X;  2EMH A;  4R2C A;  5KL6 A;  1X6H A;  4Q28 A;  2YTQ A;  2CSH A;  3EPK A;  4X62 E;  1X3C A;  2ELZ A;  5CFF E;  5LMU E;  4LF7 E;  2CTD A;  2EN6 A;  1X5W A;  2LTS A;  1SFE A;  2DIX A;  2EPX A;  2LO3 A;  4BS9 A;  2E5L E;  3TQM A;  1RMD A;  4GKJ E;  2JOB A;  2FTX B;  3J7Y p;  2WBS A;  1A1J A;  2EWL A;  4F6M A;  2NUG A;  5LLQ A;  4WSG A;  2DSY A;  2LUQ A;  1EH7 A;  1YSA C;  4WXC A;  1A1I A;  2EN1 A;  5LL6 R;  2L3C A;  4DUZ E;  1RQ0 A;  1WXR A;  5AAS A;  2YTN A;  4MLV A;  3JAM C;  1IQS A;  4B3T E;  1IBL E;  1MGT A;  1AH5 A;  4FK5 C;  3IWB A;  4WSP A;  4P78 A;  2FGG A;  2H36 X;  2EML A;  1HNW E;  5BR8 E;  4I8O A;  4WPY A; 
#chains in the Genus database with same CATH homology
 3K6Q A;  2F8B A;  4KZS A;  1HR0 E;  4JI0 E;  1ZBQ A;  1O0W A;  5IWA E;  4DUY E;  2E1M A;  5IT9 C;  4X66 E;  1N34 E;  1FJG E;  2EZ6 A;  1GQE A;  4R03 A;  1N33 E;  4DV1 E;  3VYX A;  4YY3 E;  1XNQ E;  4JI4 E;  2KON A;  2K4V A;  2LTR A;  3AUZ A;  4X8W A;  5T6J A;  5LMN E;  3H09 A;  2M4I A;  4F54 A;  4JI3 E;  2L92 A;  2L8T A;  4DV6 E;  2LE2 A;  4DR5 E;  4KHP E;  4OOG C;  3P1X A;  4JI7 E;  2V88 A;  1UHZ A;  2B7T A;  2V83 A;  4WYQ B;  5AE2 A;  3HXL A;  4P7D A;  4TUI A;  1UIL A;  1YYW A;  2JY9 A;  1N32 E;  5F3W A;  2RS7 A;  4DV4 E;  1T4O A;  4BC9 A;  4F9A B;  4LF9 E;  4GEQ B;  1YYK A;  4LF8 E;  4DR3 E;  1J26 A;  1EKZ A;  4NXM E;  3HTX A;  3IWD A;  3J81 C;  2L2N A;  1T4N A;  3J80 C;  4R8O A;  4JI8 E;  3RMP A;  2NUF A;  2HHH E;  4DV5 E;  2NA2 A;  3KWR A;  3C4T A;  2RSM A;  1X47 A;  2V8Q B;  2G7H A;  2N3G A;  3DJW A;  3HPZ A;  2B9D A;  4BC7 A;  3AV0 A;  3JU0 A;  3OTO E;  1YZ9 A;  2V87 A;  2LRS A;  4DV3 E;  2DMY A;  2MC5 A;  5A2Q C;  4JI1 E;  4LFC E;  4JYA E;  2V89 A;  1WHN A;  4OX9 E;  1XMO E;  1T4L B;  1RC7 A;  4M30 A;  2JWO A;  4BMJ A;  2CPN A;  2KHX A;  2UUC E;  3ADG A;  1IBK E;  4NXN E;  2UUA E;  3VYY A;  4DR6 E;  2UXD E;  1GZ6 A;  2V85 A;  2ODR D;  2MDR A;  5AE3 A;  4DR1 E;  1I94 E;  4GKK E;  1QU6 A;  3FIG A;  1J5E E;  4LFA E;  3MSW A;  1XNR E;  4J8Z A;  4JI5 E;  2UXB E;  3F6G A;  2M7Q A;  5FLX C;  4M2Z A;  3ADJ A;  2YZT A;  2L3J A;  1YYO A;  2L2K B;  4DV0 E;  4JI2 E;  2UU9 E;  2NUE A;  2L33 A;  1ZBT A;  1X49 A;  2N3H A;  1PKP A;  2VE7 C;  4LTY A;  3T1Y E;  4LF5 E;  4LFB E;  1X48 A;  1HNX E;  2UXC E;  1DQ3 A;  1IBM E;  4B3S E;  4F9B B;  2VF1 A;  2WZO A;  3LML A;  2DB2 A;  3ZOQ B;  2IHR 1;  4L8N A;  4TUG A;  3ADL A;  4K0K E;  4YHH E;  4Q28 A;  1DI2 A;  4WFT A;  3JTZ A;  4X64 E;  1N36 E;  2JVA A;  4X62 E;  2LUP B;  2KOU A;  4F9C B;  2F4V E;  2B3T B;  5CFF E;  2L2M A;  5LMU E;  4LF7 E;  4DR2 E;  4BCA A;  1STU A;  4DR7 E;  2VQE E;  2LTS A;  2YT4 A;  2V86 A;  2DIX A;  4BS9 A;  4B3M E;  4B3R E;  2B7V A;  4JV5 E;  2E5L E;  4M0V A;  1WHQ A;  3DF6 A;  3OML A;  4GKJ E;  3IWC A;  2JOB A;  2FTX B;  5ADZ A;  3HPS A;  3J7Y p;  4AQY E;  3ADI A;  2M1S A;  2EWL A;  4LF4 E;  2NUG A;  1HNW E;  3C4B A;  5DNY A;  2DSY A;  2LUQ A;  4X65 E;  4L5N C;  2ZM6 E;  3HQ1 A;  2VQF E;  3F6H A;  4DMI A;  4DUZ E;  5LL6 R;  5AE1 A;  2L3C A;  1RQ0 A;  1FKA E;  2L6M A;  4DV7 E;  1HNZ E;  2LJH A;  5AAS A;  3VK6 A;  1WXR A;  1XMQ E;  4JI6 E;  2RTX A;  3JAM C;  2FV4 B;  2UUB E;  4LF6 E;  2ODR C;  4B3T E;  2RS6 A;  1SR9 A;  1IBL E;  2JOX A;  2LMZ A;  4LU9 A;  4DKK A;  3T1H E;  4BBY A;  3IWB A;  4WSP A;  4P78 A;  2MC6 A;  4DV2 E;  4DR4 E;  3LLH A;  2FGG A;  2H36 X;  2LBS B;  3J7A G;  5BR8 E;  2JR1 A;  4I8O A;  4WPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...