2NA2A

Drosha quad mutant double-stranded rna binding competent
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
GPGNDPISQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease 3
publication title Towards understanding Drosha dsRBDs role in Microprocessing
rcsb
source organism Homo sapiens
molecule tags Nuclear protein/rna binding protein
total genus 12
structure length 82
sequence length 82
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2na2A00
2DB2A 2N3GA 1T4LB 1YYOA 4DR5E 4DR3E 4NXNE 1GQEA 1UHZA 4JI3E 3VYXA 4GKKE 4DV7E 1EKZA 4OOGC 4DR2E 1XMQE 1YYWA 3ADIA 5LMNE 4B3TE 1YZ9A 2RS7A 4YY3E 3C4TA 4LFAE 3ADJA 2F4VE 2UXBE 4DR6E 1IBLE 2B3TB 2ZM6E 5CFFE 4DUYE 5LMUE 1IBKE 1STUA 2LRSA 2YT4A 1I94E 1DI2A 2L2KB 2DMYA 1XNQE 2LJHA 2LUPB 2N3HA 2JVAA 1IBME 2B7VA 4LF6E 1XMOE 4DR4E 1HR0E 4DKKA 2LTRA 2KHXA 1N33E 4DV2E 3ADGA 4JYAE 4DR1E 2L3JA 3OTOE 1N34E 2LUQA 4JI4E 1WHNA 4M2ZA 2RSMA 4LF9E 4LF7E 4JI8E 3VYYA 4KHPE 4DV6E 4LF4E 4X62E 1J26A 2CPNA 2LBSB 4JI0E 4M30A 4JI7E 2HHHE 4JI1E 1PKPA 1HNXE 1QU6A 2UXCE 1ZBTA 1YYKA 3ADLA 1HNWE 2VQEE 4NXME 1X49A 2MDRA 2UUCE 1UILA 4X65E 4LFCE 2L2MA 2LTSA 4K0KE 2UUAE 2RS6A 1RQ0A 4WYQB 3C4BA 4DV4E 4GKJE 4X8WA 4JI2E 4JI5E 2UUBE 2NUGA 4DR7E 2EZ6A 2VQFE 1O0WA 1N32E 2L3CA 4LFBE 1J5EE 4DV3E 3J7Yp 4WFTA 1N36E 3T1HE 2UU9E 4AQYE 2IHR1 4LF5E 4YHHE 2JY9A 4LF8E 1WHQA 4JI6E 4DV0E 2L2NA 4DUZE 1FJGE 3HTXA 2E5LE 4B3RE 4OX9E 4JV5E 2NA2A 1RC7A 5IWAE 1X48A 2NUEA 2L33A 1T4NA 2RTXA 2DIXA 1X47A 3P1XA 3LLHA 2NUFA 2B7TA 4X66E 4DV5E 1FKAE 1T4OA 4DV1E 4B3SE 5BR8E 3T1YE 1HNZE 1XNRE 2UXDE 4X64E 4B3ME
chains in the Genus database with same CATH superfamily
2YWQA 2N3GA 4R2RA 5AC5A 5A69A 4O4KA 3C6KA 4WPYA 4OOGC 1XMQE 1ZU1A 2FGGA 4R2PA 2LE2A 2EWLA 1YZ9A 4YY3E 3IWBA 4HTGA 2ADRA 2L6MA 3ADJA 4DR6E 1A1JA 2KOUA 2JXPA 4WSPA 1NEIA 4DUYE 4NHRA 3HPSA 2L2KB 2E72A 2EOQA 3JAMC 2N3HA 1UN6B 4F6NA 1IBME 4LF6E 1XMOE 4GZNC 2KHXA 3VK6A 4DV2E 2EM9A 2YTFA 4O24A 1JK1A 3OTOE 1N34E 2RSIA 1WHNA 1IMUA 4JI8E 2EMGA 1RMDA 2EM7A 4ZYDA 2GLIA 4KHPE 2HJJA 2I9IA 4HEIA 1J26A 2EPCA 1IQOA 4F9BB 4MLVA 4JI7E 4N4RB 1G2FC 2HHHE 4JI1E 3RMPA 3MHHC 2BBGA 2UXCE 2DLKA 1ZBTA 2BB8A 2N8XA 2V8QB 2YTJA 2EOFA 3KWRA 2L92A 1HNWE 2I13A 1GTKA 4TUIA 2M7QA 2YRHA 1X5WA 2ELZA 2JWOA 4I8OA 2LVHA 3ECRA 3AV0A 2RS6A 4IJDA 1Z1BA 1RQ0A 2EOEA 2RPCA 3DJWA 1X6HA 2JP9A 3EPHA 2EN2A 3HPZA 1AH5A 2UUBE 2NUGA 2HC5A 4LFBE 1J5EE 3FIGA 4LU9A 4AQYE 4BC9A 2EPMX 3K6QA 1P47A 2K4VA 2JOBA 2JY9A 2LT7A 4LF8E 3TQMA 4BHCA 4O5GA 2CT1A 2Q8UA 2EL5A 2WBSA 2WBUA 4JI6E 4DV0E 2FTXB 2E1MA 1L4SA 5IWAE 1X48A 2NUEA 2YU8A 2DLQA 2LJUA 3LLHA 4MLQA 2EQ3A 5TSEA 2EPZA 2UXDE 4DMIA 2V85A 1XNRE 4B3ME 5IV8B 3THNA 2EPPA 2EOXA 4JI3E 4ZYGA 2EPKX 2MC6A 2YTOA 1JK2A 2LO3A 2YTGA 1YYWA 3EPJA 1YFHA 1A1KA 2WBTA 2JPAA 3ZOQB 2EL4A 4F54A 2CTDA 3MHSC 5KL4A 4WXDA 5CFFE 2KONA 2EORA 3EPKA 2YT4A 3J80C 1I94E 1DI2A 4NZVA 2YSOA 4BS9A 2JYAA 2EM2A 4R03A 2LTRA 4KWYA 3ADGA 4F2JC 4DR1E 1PJQA 5KL5A 1YUIA 2V83A 2L3JA 4X9JA 4LF7E 2EM3A 1KJKA 2EPOA 4X62E 4R2DA 1A1LA 1YSAC 1X6EA 1B69A 2V86A 1ZAAC 2VF1A 1PKPA 5F3WA 1QU6A 2EMBA 5AE3A 1X6FA 3EQ1A 2R1FA 2EN1A 2YTPA 3ADLA 4L8NA 4NXME 2WZOA 1EH6A 2YTDA 1SFEA 1WXRA 4K0KE 2ENHA 5ADZA 2YZTA 1X3CA 4WYQB 4BBYA 3C4BA 2YU5A 4JI2E 2EN7A 2VQFE 5A6AA 3F6HA 3L00A 4P78A 5LLQA 3J7Yp 5DNYA 3T1HE 4F6MA 1WHQA 2J7JA 3LMLA 3HTXA 4DUZE 4WXCA 1PJTA 4JV5E 2NA2A 1RC7A 2EOYA 2RQLA 1X47A 1QNTA 2VRDA 3DF6A 2B7TA 4WX9A 4X66E 2EMAA 1GZ6A 4B3SE 2M9AA 2YTIA 2DB2A 1KYQA 1BBOA 1T4LB 4DR5E 4DR3E 3VYXA 1T38A 4DV7E 1EKZA 4B3TE 2ENAA 2EPLX 1PJSA 1A1IA 2VE7C 3C4TA 2F4VE 3F6GA 4BHBA 4M0VA 4LTYA 3UK3C 3H09A 2DGCA 2EOJA 2EMWA 1STUA 5LMUE 2LRSA 2EMCA 2H36X 1PDAA 4P7DA 2YRKA 2DMYA 2EN6A 2LJHA 4F9AB 2LUPB 3IWCA 1XNQE 2DSYA 3JTZA 2EMYA 2GPIA 4DKKA 3KZZA 2EN3A 4JYAE 4BCAA 4F9CB 1ZBQA 1WJPA 4IS1C 4M2ZA 4LF9E 3VYYA 2DRPA 2D9HA 1YUJA 1T39A 4R8OA 2LCEA 1TF6A 2HGHA 2V89A 2YSPA 4JI0E 1HNXE 4RHBB 4R2QA 2EE8A 2MKNA 1DQ3A 2EPAA 2F8BA 1X49A 2MDRA 2UUCE 2EJ4A 4X65E 4LFCE 2L8TA 1EH8A 2LTSA 2EQ1A 2LV2A 3HXLA 3BF2A 3OMLA 5AASA 5KL7A 2EPNA 3THOB 2ENCA 4GEQB 1TN9A 2B9DA 2GHFA 2EOHA 2EL6A 1N32E 2L3CA 1IQSA 2MDGA 2DMIA 2JOXA 1N36E 1MGTA 3BGHA 4R2EA 2IHR1 3VHTB 2EOSA 2PRTA 1FJGE 2L2NA 4B3RE 2EM6A 4OX9E 1T4NA 1TF3A 4M9VC 1YPNA 1EH7A 2EPUA 4J8ZA 4DV5E 2YTNA 1FKAE 1T4OA 1HNZE 1G2DC 2ODRD 1A1FA 4RH8A 2YPNA 4LF5E 2EMKA 5LL6R 2WCC3 2R76A 2EP3A 1YYOA 4NXNE 1GQEA 1UHZA 4GKKE 2EPXA 4WSGA 5A6BD 4DR2E 4FK5C 3ADIA 1N3GA 5LMNE 3M99B 2RS7A 2V87A 2M1SA 4LFAE 2UXBE 1IBLE 2B3TB 1LLMC 2ZM6E 1IBKE 1BB8A 1MEYC 5AC4A 4KZSA 2EMHA 2EOOA 5IXMB 4L5NC 2JVAA 4R2CA 2B7VA 4DR4E 1HR0E 2ODRC 2NABA 3BBGA 4O43A 1N33E 5FLXC 2LMZA 4BC7A 4JI4E 2EMXA 2JR1A 2EPRA 2LUQA 5KL3A 1UBDC 2RSMA 4ZYEA 5KL2A 4DV6E 4LF4E 2G7HA 2MKDA 2K7IA 2EQ0A 2CPNA 2LBSB 4M30A 5AE1A 5A6BA 3QG5C 3MSWA 4R2SA 2EM8A 1YYKA 2MC5A 5A6KA 3J7AG 2VQEE 5AE2A 2EOIA 1AAYA 2CSHA 1A1GA 2EN8A 1F2IG 1UILA 3JU0A 1NCSA 2L2MA 4BMJA 3IWDA 2EM5A 2EN4A 2UUAE 1ZR9A 2EM4A 1WRJA 3AUZA 4Q35B 3KZYA 4DV4E 5KL6A 4GKJE 4X8WA 3HQ1A 3BIDA 2EOMA 4JI5E 4DR7E 5A6JA 2EZ6A 1O0WA 2A25A 4TUGA 2EMFA 4DV3E 2YTQA 4Q28A 4WFTA 2EMLA 2V88A 5A2QC 5T6JA 3EPLA 2UU9E 2ELYA 2M4IA 2EMIA 4YHHE 3C6MA 2YRMA 2YTEA 4R2AA 1SR9A 2E5LE 2FV4B 2L33A 2RTXA 2DIXA 1A1HA 2NUFA 3P1XA 1DGCA 5IT9C 2EMZA 4DV1E 2EM0A 5BR8E 1BBGA 2EOZA 3T1YE 4ZYHA 4X64E 3J81C
chains in the Genus database with same CATH topology
5LL6R 2DB2A 2N3GA 1T4LB 1YYOA 4DR5E 4DR3E 4NXNE 1GQEA 1UHZA 4JI3E 2MC6A 3VYXA 4GKKE 4DV7E 1EKZA 4WPYA 4OOGC 4DR2E 1XMQE 2FGGA 1YYWA 3ADIA 5LMNE 4B3RE 2LE2A 2EWLA 4B3TE 1YZ9A 2RS7A 2V87A 2M1SA 3IWBA 4YY3E 3ZOQB 2L6MA 4F54A 2VE7C 3C4TA 3ADJA 4LFAE 2F4VE 4DR6E 2UXBE 1IBLE 2B3TB 2ZM6E 3F6GA 2KOUA 4LTYA 4M0VA 5CFFE 3H09A 2KONA 4WSPA 4DUYE 5LMUE 1IBKE 1STUA 2LRSA 2YT4A 3HPSA 3J80C 1I94E 1DI2A 2H36X 2L2KB 4P7DA 4KZSA 2DMYA 3JAMC 2LJHA 4F9AB 2LUPB 3IWCA 1XNQE 2DSYA 4BS9A 2N3HA 3JTZA 2NUFA 4L5NC 2JVAA 1IBME 2B7VA 4LF6E 1XMOE 4DR4E 4R03A 2ODRC 1HR0E 4DKKA 2LTRA 2KHXA 3VK6A 4DV2E 5FLXC 1N33E 2LMZA 3ADGA 4JYAE 4BCAA 4F9CB 4DR1E 1ZBQA 2V83A 4BC7A 2L3JA 3OTOE 1N34E 2JR1A 2LUQA 4JI4E 1WHNA 4M2ZA 2RSMA 4LF9E 4LF7E 4JI8E 3VYYA 4KHPE 4DV6E 4LF4E 4R8OA 4X62E 2G7HA 1J26A 2V89A 4F9BB 2CPNA 2LBSB 4JI0E 4M30A 4JI7E 2V86A 5AE1A 2VF1A 2HHHE 1PKPA 3RMPA 3MSWA 5F3WA 1HNXE 1QU6A 4JI1E 2UXCE 1ZBTA 5AE3A 1YYKA 2MC5A 1DQ3A 2V8QB 3KWRA 3J7AG 3ADLA 4L8NA 2L92A 2VQEE 5AE2A 1HNWE 4NXME 2F8BA 4TUIA 1X49A 2M7QA 2MDRA 2WZOA 2UUCE 1UILA 4X65E 3JU0A 1WXRA 2JWOA 2L2MA 2L8TA 4I8OA 2LTSA 4BMJA 3IWDA 4LFCE 4K0KE 3HXLA 2UUAE 3AV0A 2RS6A 3OMLA 5AASA 5ADZA 2YZTA 1RQ0A 3AUZA 3DJWA 4WYQB 4BBYA 3C4BA 4DV4E 4GKJE 4GEQB 4X8WA 3HQ1A 4JI2E 3HPZA 2B9DA 4JI5E 2UUBE 2NUGA 4DR7E 2EZ6A 2VQFE 1O0WA 1N32E 3F6HA 2L3CA 4LFBE 1J5EE 4P78A 3FIGA 4TUGA 4DV3E 4Q28A 4WFTA 3J7Yp 2JOXA 2V88A 5DNYA 5A2QC 3T1HE 1N36E 4LU9A 5T6JA 2UU9E 4AQYE 2IHR1 2M4IA 4BC9A 3K6QA 4LF5E 4YHHE 2K4VA 2JOBA 2JY9A 4LF8E 1WHQA 3LMLA 4JI6E 1SR9A 2FTXB 2L2NA 4DUZE 4DV0E 2E1MA 2E5LE 4OX9E 1FJGE 2NA2A 2FV4B 5IWAE 1RC7A 4JV5E 1X48A 2NUEA 2L33A 1T4NA 2RTXA 2DIXA 1X47A 3P1XA 3LLHA 3DF6A 2B7TA 4J8ZA 4X66E 4DV5E 5IT9C 1GZ6A 1FKAE 3HTXA 1T4OA 4DV1E 4DMIA 5BR8E 3T1YE 1HNZE 2V85A 4B3SE 1XNRE 2UXDE 2ODRD 4X64E 4B3ME 3J81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB2 A;  2N3G A;  1T4L B;  1YYO A;  4DR5 E;  4DR3 E;  4NXN E;  1GQE A;  1UHZ A;  4JI3 E;  3VYX A;  4GKK E;  4DV7 E;  1EKZ A;  4OOG C;  4DR2 E;  1XMQ E;  1YYW A;  3ADI A;  5LMN E;  4B3T E;  1YZ9 A;  2RS7 A;  4YY3 E;  3C4T A;  4LFA E;  3ADJ A;  2F4V E;  2UXB E;  4DR6 E;  1IBL E;  2B3T B;  2ZM6 E;  5CFF E;  4DUY E;  5LMU E;  1IBK E;  1STU A;  2LRS A;  2YT4 A;  1I94 E;  1DI2 A;  2L2K B;  2DMY A;  1XNQ E;  2LJH A;  2LUP B;  2N3H A;  2JVA A;  1IBM E;  2B7V A;  4LF6 E;  1XMO E;  4DR4 E;  1HR0 E;  4DKK A;  2LTR A;  2KHX A;  1N33 E;  4DV2 E;  3ADG A;  4JYA E;  4DR1 E;  2L3J A;  3OTO E;  1N34 E;  2LUQ A;  4JI4 E;  1WHN A;  4M2Z A;  2RSM A;  4LF9 E;  4LF7 E;  4JI8 E;  3VYY A;  4KHP E;  4DV6 E;  4LF4 E;  4X62 E;  1J26 A;  2CPN A;  2LBS B;  4JI0 E;  4M30 A;  4JI7 E;  2HHH E;  4JI1 E;  1PKP A;  1HNX E;  1QU6 A;  2UXC E;  1ZBT A;  1YYK A;  3ADL A;  1HNW E;  2VQE E;  4NXM E;  1X49 A;  2MDR A;  2UUC E;  1UIL A;  4X65 E;  4LFC E;  2L2M A;  2LTS A;  4K0K E;  2UUA E;  2RS6 A;  1RQ0 A;  4WYQ B;  3C4B A;  4DV4 E;  4GKJ E;  4X8W A;  4JI2 E;  4JI5 E;  2UUB E;  2NUG A;  4DR7 E;  2EZ6 A;  2VQF E;  1O0W A;  1N32 E;  2L3C A;  4LFB E;  1J5E E;  4DV3 E;  3J7Y p;  4WFT A;  1N36 E;  3T1H E;  2UU9 E;  4AQY E;  2IHR 1;  4LF5 E;  4YHH E;  2JY9 A;  4LF8 E;  1WHQ A;  4JI6 E;  4DV0 E;  2L2N A;  4DUZ E;  1FJG E;  3HTX A;  2E5L E;  4B3R E;  4OX9 E;  4JV5 E;  2NA2 A;  1RC7 A;  5IWA E;  1X48 A;  2NUE A;  2L33 A;  1T4N A;  2RTX A;  2DIX A;  1X47 A;  3P1X A;  3LLH A;  2NUF A;  2B7T A;  4X66 E;  4DV5 E;  1FKA E;  1T4O A;  4DV1 E;  4B3S E;  5BR8 E;  3T1Y E;  1HNZ E;  1XNR E;  2UXD E;  4X64 E;  4B3M E; 
#chains in the Genus database with same CATH topology
 2YWQ A;  2N3G A;  4R2R A;  5AC5 A;  5A69 A;  4O4K A;  3C6K A;  4WPY A;  4OOG C;  1XMQ E;  1ZU1 A;  2FGG A;  4R2P A;  2LE2 A;  2EWL A;  1YZ9 A;  4YY3 E;  3IWB A;  4HTG A;  2ADR A;  2L6M A;  3ADJ A;  4DR6 E;  1A1J A;  2KOU A;  2JXP A;  4WSP A;  1NEI A;  4DUY E;  4NHR A;  3HPS A;  2L2K B;  2E72 A;  2EOQ A;  3JAM C;  2N3H A;  1UN6 B;  4F6N A;  1IBM E;  4LF6 E;  1XMO E;  4GZN C;  2KHX A;  3VK6 A;  4DV2 E;  2EM9 A;  2YTF A;  4O24 A;  1JK1 A;  3OTO E;  1N34 E;  2RSI A;  1WHN A;  1IMU A;  4JI8 E;  2EMG A;  1RMD A;  2EM7 A;  4ZYD A;  2GLI A;  4KHP E;  2HJJ A;  2I9I A;  4HEI A;  1J26 A;  2EPC A;  1IQO A;  4F9B B;  4MLV A;  4JI7 E;  4N4R B;  1G2F C;  2HHH E;  4JI1 E;  3RMP A;  3MHH C;  2BBG A;  2UXC E;  2DLK A;  1ZBT A;  2BB8 A;  2N8X A;  2V8Q B;  2YTJ A;  2EOF A;  3KWR A;  2L92 A;  1HNW E;  2I13 A;  1GTK A;  4TUI A;  2M7Q A;  2YRH A;  1X5W A;  2ELZ A;  2JWO A;  4I8O A;  2LVH A;  3ECR A;  3AV0 A;  2RS6 A;  4IJD A;  1Z1B A;  1RQ0 A;  2EOE A;  2RPC A;  3DJW A;  1X6H A;  2JP9 A;  3EPH A;  2EN2 A;  3HPZ A;  1AH5 A;  2UUB E;  2NUG A;  2HC5 A;  4LFB E;  1J5E E;  3FIG A;  4LU9 A;  4AQY E;  4BC9 A;  2EPM X;  3K6Q A;  1P47 A;  2K4V A;  2JOB A;  2JY9 A;  2LT7 A;  4LF8 E;  3TQM A;  4BHC A;  4O5G A;  2CT1 A;  2Q8U A;  2EL5 A;  2WBS A;  2WBU A;  4JI6 E;  4DV0 E;  2FTX B;  2E1M A;  1L4S A;  5IWA E;  1X48 A;  2NUE A;  2YU8 A;  2DLQ A;  2LJU A;  3LLH A;  4MLQ A;  2EQ3 A;  5TSE A;  2EPZ A;  2UXD E;  4DMI A;  2V85 A;  1XNR E;  4B3M E;  5IV8 B;  3THN A;  2EPP A;  2EOX A;  4JI3 E;  4ZYG A;  2EPK X;  2MC6 A;  2YTO A;  1JK2 A;  2LO3 A;  2YTG A;  1YYW A;  3EPJ A;  1YFH A;  1A1K A;  2WBT A;  2JPA A;  3ZOQ B;  2EL4 A;  4F54 A;  2CTD A;  3MHS C;  5KL4 A;  4WXD A;  5CFF E;  2KON A;  2EOR A;  3EPK A;  2YT4 A;  3J80 C;  1I94 E;  1DI2 A;  4NZV A;  2YSO A;  4BS9 A;  2JYA A;  2EM2 A;  4R03 A;  2LTR A;  4KWY A;  3ADG A;  4F2J C;  4DR1 E;  1PJQ A;  5KL5 A;  1YUI A;  2V83 A;  2L3J A;  4X9J A;  4LF7 E;  2EM3 A;  1KJK A;  2EPO A;  4X62 E;  4R2D A;  1A1L A;  1YSA C;  1X6E A;  1B69 A;  2V86 A;  1ZAA C;  2VF1 A;  1PKP A;  5F3W A;  1QU6 A;  2EMB A;  5AE3 A;  1X6F A;  3EQ1 A;  2R1F A;  2EN1 A;  2YTP A;  3ADL A;  4L8N A;  4NXM E;  2WZO A;  1EH6 A;  2YTD A;  1SFE A;  1WXR A;  4K0K E;  2ENH A;  5ADZ A;  2YZT A;  1X3C A;  4WYQ B;  4BBY A;  3C4B A;  2YU5 A;  4JI2 E;  2EN7 A;  2VQF E;  5A6A A;  3F6H A;  3L00 A;  4P78 A;  5LLQ A;  3J7Y p;  5DNY A;  3T1H E;  4F6M A;  1WHQ A;  2J7J A;  3LML A;  3HTX A;  4DUZ E;  4WXC A;  1PJT A;  4JV5 E;  2NA2 A;  1RC7 A;  2EOY A;  2RQL A;  1X47 A;  1QNT A;  2VRD A;  3DF6 A;  2B7T A;  4WX9 A;  4X66 E;  2EMA A;  1GZ6 A;  4B3S E;  2M9A A;  2YTI A;  2DB2 A;  1KYQ A;  1BBO A;  1T4L B;  4DR5 E;  4DR3 E;  3VYX A;  1T38 A;  4DV7 E;  1EKZ A;  4B3T E;  2ENA A;  2EPL X;  1PJS A;  1A1I A;  2VE7 C;  3C4T A;  2F4V E;  3F6G A;  4BHB A;  4M0V A;  4LTY A;  3UK3 C;  3H09 A;  2DGC A;  2EOJ A;  2EMW A;  1STU A;  5LMU E;  2LRS A;  2EMC A;  2H36 X;  1PDA A;  4P7D A;  2YRK A;  2DMY A;  2EN6 A;  2LJH A;  4F9A B;  2LUP B;  3IWC A;  1XNQ E;  2DSY A;  3JTZ A;  2EMY A;  2GPI A;  4DKK A;  3KZZ A;  2EN3 A;  4JYA E;  4BCA A;  4F9C B;  1ZBQ A;  1WJP A;  4IS1 C;  4M2Z A;  4LF9 E;  3VYY A;  2DRP A;  2D9H A;  1YUJ A;  1T39 A;  4R8O A;  2LCE A;  1TF6 A;  2HGH A;  2V89 A;  2YSP A;  4JI0 E;  1HNX E;  4RHB B;  4R2Q A;  2EE8 A;  2MKN A;  1DQ3 A;  2EPA A;  2F8B A;  1X49 A;  2MDR A;  2UUC E;  2EJ4 A;  4X65 E;  4LFC E;  2L8T A;  1EH8 A;  2LTS A;  2EQ1 A;  2LV2 A;  3HXL A;  3BF2 A;  3OML A;  5AAS A;  5KL7 A;  2EPN A;  3THO B;  2ENC A;  4GEQ B;  1TN9 A;  2B9D A;  2GHF A;  2EOH A;  2EL6 A;  1N32 E;  2L3C A;  1IQS A;  2MDG A;  2DMI A;  2JOX A;  1N36 E;  1MGT A;  3BGH A;  4R2E A;  2IHR 1;  3VHT B;  2EOS A;  2PRT A;  1FJG E;  2L2N A;  4B3R E;  2EM6 A;  4OX9 E;  1T4N A;  1TF3 A;  4M9V C;  1YPN A;  1EH7 A;  2EPU A;  4J8Z A;  4DV5 E;  2YTN A;  1FKA E;  1T4O A;  1HNZ E;  1G2D C;  2ODR D;  1A1F A;  4RH8 A;  2YPN A;  4LF5 E;  2EMK A;  5LL6 R;  2WCC 3;  2R76 A;  2EP3 A;  1YYO A;  4NXN E;  1GQE A;  1UHZ A;  4GKK E;  2EPX A;  4WSG A;  5A6B D;  4DR2 E;  4FK5 C;  3ADI A;  1N3G A;  5LMN E;  3M99 B;  2RS7 A;  2V87 A;  2M1S A;  4LFA E;  2UXB E;  1IBL E;  2B3T B;  1LLM C;  2ZM6 E;  1IBK E;  1BB8 A;  1MEY C;  5AC4 A;  4KZS A;  2EMH A;  2EOO A;  5IXM B;  4L5N C;  2JVA A;  4R2C A;  2B7V A;  4DR4 E;  1HR0 E;  2ODR C;  2NAB A;  3BBG A;  4O43 A;  1N33 E;  5FLX C;  2LMZ A;  4BC7 A;  4JI4 E;  2EMX A;  2JR1 A;  2EPR A;  2LUQ A;  5KL3 A;  1UBD C;  2RSM A;  4ZYE A;  5KL2 A;  4DV6 E;  4LF4 E;  2G7H A;  2MKD A;  2K7I A;  2EQ0 A;  2CPN A;  2LBS B;  4M30 A;  5AE1 A;  5A6B A;  3QG5 C;  3MSW A;  4R2S A;  2EM8 A;  1YYK A;  2MC5 A;  5A6K A;  3J7A G;  2VQE E;  5AE2 A;  2EOI A;  1AAY A;  2CSH A;  1A1G A;  2EN8 A;  1F2I G;  1UIL A;  3JU0 A;  1NCS A;  2L2M A;  4BMJ A;  3IWD A;  2EM5 A;  2EN4 A;  2UUA E;  1ZR9 A;  2EM4 A;  1WRJ A;  3AUZ A;  4Q35 B;  3KZY A;  4DV4 E;  5KL6 A;  4GKJ E;  4X8W A;  3HQ1 A;  3BID A;  2EOM A;  4JI5 E;  4DR7 E;  5A6J A;  2EZ6 A;  1O0W A;  2A25 A;  4TUG A;  2EMF A;  4DV3 E;  2YTQ A;  4Q28 A;  4WFT A;  2EML A;  2V88 A;  5A2Q C;  5T6J A;  3EPL A;  2UU9 E;  2ELY A;  2M4I A;  2EMI A;  4YHH E;  3C6M A;  2YRM A;  2YTE A;  4R2A A;  1SR9 A;  2E5L E;  2FV4 B;  2L33 A;  2RTX A;  2DIX A;  1A1H A;  2NUF A;  3P1X A;  1DGC A;  5IT9 C;  2EMZ A;  4DV1 E;  2EM0 A;  5BR8 E;  1BBG A;  2EOZ A;  3T1Y E;  4ZYH A;  4X64 E;  3J81 C; 
#chains in the Genus database with same CATH homology
 5LL6 R;  2DB2 A;  2N3G A;  1T4L B;  1YYO A;  4DR5 E;  4DR3 E;  4NXN E;  1GQE A;  1UHZ A;  4JI3 E;  2MC6 A;  3VYX A;  4GKK E;  4DV7 E;  1EKZ A;  4WPY A;  4OOG C;  4DR2 E;  1XMQ E;  2FGG A;  1YYW A;  3ADI A;  5LMN E;  4B3R E;  2LE2 A;  2EWL A;  4B3T E;  1YZ9 A;  2RS7 A;  2V87 A;  2M1S A;  3IWB A;  4YY3 E;  3ZOQ B;  2L6M A;  4F54 A;  2VE7 C;  3C4T A;  3ADJ A;  4LFA E;  2F4V E;  4DR6 E;  2UXB E;  1IBL E;  2B3T B;  2ZM6 E;  3F6G A;  2KOU A;  4LTY A;  4M0V A;  5CFF E;  3H09 A;  2KON A;  4WSP A;  4DUY E;  5LMU E;  1IBK E;  1STU A;  2LRS A;  2YT4 A;  3HPS A;  3J80 C;  1I94 E;  1DI2 A;  2H36 X;  2L2K B;  4P7D A;  4KZS A;  2DMY A;  3JAM C;  2LJH A;  4F9A B;  2LUP B;  3IWC A;  1XNQ E;  2DSY A;  4BS9 A;  2N3H A;  3JTZ A;  2NUF A;  4L5N C;  2JVA A;  1IBM E;  2B7V A;  4LF6 E;  1XMO E;  4DR4 E;  4R03 A;  2ODR C;  1HR0 E;  4DKK A;  2LTR A;  2KHX A;  3VK6 A;  4DV2 E;  5FLX C;  1N33 E;  2LMZ A;  3ADG A;  4JYA E;  4BCA A;  4F9C B;  4DR1 E;  1ZBQ A;  2V83 A;  4BC7 A;  2L3J A;  3OTO E;  1N34 E;  2JR1 A;  2LUQ A;  4JI4 E;  1WHN A;  4M2Z A;  2RSM A;  4LF9 E;  4LF7 E;  4JI8 E;  3VYY A;  4KHP E;  4DV6 E;  4LF4 E;  4R8O A;  4X62 E;  2G7H A;  1J26 A;  2V89 A;  4F9B B;  2CPN A;  2LBS B;  4JI0 E;  4M30 A;  4JI7 E;  2V86 A;  5AE1 A;  2VF1 A;  2HHH E;  1PKP A;  3RMP A;  3MSW A;  5F3W A;  1HNX E;  1QU6 A;  4JI1 E;  2UXC E;  1ZBT A;  5AE3 A;  1YYK A;  2MC5 A;  1DQ3 A;  2V8Q B;  3KWR A;  3J7A G;  3ADL A;  4L8N A;  2L92 A;  2VQE E;  5AE2 A;  1HNW E;  4NXM E;  2F8B A;  4TUI A;  1X49 A;  2M7Q A;  2MDR A;  2WZO A;  2UUC E;  1UIL A;  4X65 E;  3JU0 A;  1WXR A;  2JWO A;  2L2M A;  2L8T A;  4I8O A;  2LTS A;  4BMJ A;  3IWD A;  4LFC E;  4K0K E;  3HXL A;  2UUA E;  3AV0 A;  2RS6 A;  3OML A;  5AAS A;  5ADZ A;  2YZT A;  1RQ0 A;  3AUZ A;  3DJW A;  4WYQ B;  4BBY A;  3C4B A;  4DV4 E;  4GKJ E;  4GEQ B;  4X8W A;  3HQ1 A;  4JI2 E;  3HPZ A;  2B9D A;  4JI5 E;  2UUB E;  2NUG A;  4DR7 E;  2EZ6 A;  2VQF E;  1O0W A;  1N32 E;  3F6H A;  2L3C A;  4LFB E;  1J5E E;  4P78 A;  3FIG A;  4TUG A;  4DV3 E;  4Q28 A;  4WFT A;  3J7Y p;  2JOX A;  2V88 A;  5DNY A;  5A2Q C;  3T1H E;  1N36 E;  4LU9 A;  5T6J A;  2UU9 E;  4AQY E;  2IHR 1;  2M4I A;  4BC9 A;  3K6Q A;  4LF5 E;  4YHH E;  2K4V A;  2JOB A;  2JY9 A;  4LF8 E;  1WHQ A;  3LML A;  4JI6 E;  1SR9 A;  2FTX B;  2L2N A;  4DUZ E;  4DV0 E;  2E1M A;  2E5L E;  4OX9 E;  1FJG E;  2NA2 A;  2FV4 B;  5IWA E;  1RC7 A;  4JV5 E;  1X48 A;  2NUE A;  2L33 A;  1T4N A;  2RTX A;  2DIX A;  1X47 A;  3P1X A;  3LLH A;  3DF6 A;  2B7T A;  4J8Z A;  4X66 E;  4DV5 E;  5IT9 C;  1GZ6 A;  1FKA E;  3HTX A;  1T4O A;  4DV1 E;  4DMI A;  5BR8 E;  3T1Y E;  1HNZ E;  2V85 A;  4B3S E;  1XNR E;  2UXD E;  2ODR D;  4X64 E;  4B3M E;  3J81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...