2NA2A

Drosha quad mutant double-stranded rna binding competent
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
GPGNDPISQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSKKQAKMGAAMDALEKYNFPQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/rna binding protein
molecule keywords Ribonuclease 3
publication title Towards understanding Drosha dsRBDs role in Microprocessing
rcsb
source organism Homo sapiens
total genus 12
structure length 82
sequence length 82
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2na2A00
1T4NA 1O0WA 4DV5E 4B3ME 4JYAE 4YHHE 4DR5E 4JI7E 2RSMA 2UU9E 1HNWE 4DV7E 2NUFA 1DI2A 1ZBTA 1EKZA 1YYWA 2LTSA 4LF6E 4DR6E 1N32E 4X62E 5LMUE 4B3TE 2LBSB 3VYYA 1FJGE 4B3RE 3ADLA 1RQ0A 2RS6A 2UXCE 4LF5E 1XNQE 2L3JA 4DV0E 4DV1E 1GQEA 1UHZA 4AQYE 1T4LB 2KHXA 1YYOA 1STUA 1XNRE 1X49A 1HNXE 4GKKE 2DMYA 4X8WA 4DR7E 4JI1E 4OX9E 2LJHA 1QU6A 4WFTA 4WYQB 4DKKA 4X66E 1RC7A 2HHHE 4JI5E 4M2ZA 5BR8E 4NXME 2UXBE 1XMOE 4JI3E 4K0KE 1X48A 4JI2E 2L33A 2VQEE 3C4BA 2UUCE 2EZ6A 2JY9A 1WHQA 2MDRA 2LTRA 3ADGA 2LUPB 3HTXA 2F4VE 4KHPE 2DB2A 2NA2A 1YYKA 4OOGC 2L2NA 2L2MA 4M30A 2RTXA 2LRSA 4GKJE 5CFFE 4DUYE 4DR2E 4X65E 5LMNE 4YY3E 2UUBE 3VYXA 2B7TA 1T4OA 2IHR1 2UXDE 4DV6E 1YZ9A 2B7VA 1I94E 3T1HE 1IBME 2YT4A 2NUEA 4LF4E 1UILA 4JI6E 1N34E 4DV3E 4DR4E 3LLHA 2RS7A 1WHNA 2N3GA 4LF9E 5IWAE 4DR3E 2UUAE 4JI8E 2L3CA 4LFCE 2NUGA 2ZM6E 4DR1E 1J26A 4DUZE 3J7Yp 1IBLE 1J5EE 4LF7E 1PKPA 3ADIA 4LF8E 1XMQE 1N36E 1FKAE 3P1XA 2CPNA 4DV4E 4JI4E 2B3TB 4JI0E 2LUQA 3ADJA 3T1YE 4JV5E 2L2KB 2VQFE 4DV2E 1HNZE 1HR0E 4X64E 1X47A 4LFBE 1IBKE 2JVAA 3C4TA 4NXNE 2DIXA 2E5LE 3OTOE 2N3HA 4B3SE 1N33E 4LFAE
chains in the Genus database with same CATH superfamily
4O43A 3RMPA 3UK3C 1A1KA 4HEIA 3C6MA 2GHFA 4BHBA 2WBTA 4BMJA 4R2SA 2YTNA 1DGCA 2DLQA 2EP3A 2EPUA 1NEIA 1A1JA 2FTXB 4DR6E 4X62E 2FGGA 2LBSB 3VYYA 1FJGE 2LO3A 1RQ0A 3J81C 1XNQE 4F9BB 4O24A 2V89A 2ENAA 2EOXA 2MDGA 2JPAA 2LV2A 1T4LB 2EOJA 2ADRA 2JXPA 2EM4A 1STUA 2LMZA 1XNRE 5FLXC 1X49A 1X3CA 1BBOA 2YTOA 4JI1E 5IT9C 4F2JC 2EPMX 4F9CB 5A6KA 2LJHA 4JI5E 3KZYA 1DQ3A 2EOZA 3K6QA 3EQ1A 2CT1A 1YFHA 2EMIA 4R03A 4K0KE 1X48A 1WJPA 2N8XA 3DJWA 2UUCE 2EZ6A 2EMCA 1B69A 3ADGA 2NA2A 4R2DA 5AE3A 1YYKA 2EL6A 1BB8A 2EN1A 2RTXA 4R2CA 1WRJA 4NHRA 2MC6A 3ECRA 3L00A 5DNYA 2NABA 4DUYE 2EMGA 5LMNE 1UBDC 2YTQA 4O4KA 4R2PA 2LJUA 2B7VA 3MHHC 4R2RA 2V87A 1ZBQA 1A1HA 4RH8A 4DV3E 2DSYA 2YRHA 4LF9E 4DR3E 2UUAE 2V88A 1NCSA 4DR1E 2ODRC 4DUZE 3J7Yp 1J5EE 2ENCA 4LF7E 1A1IA 1N36E 2L6MA 1FKAE 2EMFA 1ZR9A 2DLKA 2YWQA 4JI0E 2EL5A 2LUQA 3ADJA 4I8OA 1JK1A 2Q8UA 4P78A 2E72A 5KL3A 5ADZA 1WXRA 1X6HA 4LFBE 3C4TA 2YU5A 2YTEA 2EOYA 4N4RB 3OMLA 2YZTA 2N3HA 3J7AG 1O0WA 4DV5E 4JYAE 4DR5E 4JI7E 1AAYA 2YPNA 2RSMA 3KWRA 4BCAA 1HNWE 2EM2A 3HPSA 4Q28A 2EQ0A 4HTGA 2YTFA 3QG5C 2EM6A 2KOUA 2UXCE 4LF5E 2YTIA 5LL6R 2EOHA 3TQMA 4DV0E 2MKNA 4Q35B 4AQYE 3BF2A 2M9AA 2JP9A 2EPNA 1YYOA 4ZYEA 2EQ1A 4GKKE 1QNTA 1RC7A 4GZNC 1RMDA 4NXME 2UXBE 4J8ZA 4WPYA 2L33A 2VQEE 4BC7A 1GZ6A 2EMZA 2E1MA 2LUPB 2EN6A 2LTRA 1X6FA 2DRPA 4OOGC 1PDAA 4M30A 2M4IA 2EMKA 3C6KA 2RSIA 3MSWA 4GKJE 2LCEA 4IS1C 4TUIA 1EH7A 1PJTA 1T4OA 3EPLA 1LLMC 1YZ9A 2EMAA 1TF6A 2YSPA 1YSAC 3VHTB 4DR4E 2JOXA 2EOFA 1WHNA 2N3GA 2RS7A 5IXMB 2NUGA 2YTGA 2K7IA 2KONA 4FK5C 2BB8A 5AASA 1G2FC 1YUIA 2RQLA 2EMYA 5KL7A 1PKPA 2WZOA 1IQSA 3FIGA 1X6EA 1XMQE 4BBYA 2CPNA 1KJKA 1A1FA 3H09A 2RPCA 1KYQA 4ZYHA 2WBSA 2EMWA 1T38A 3T1YE 4DMIA 2VQFE 3EPKA 1HR0E 4X64E 3BBGA 2EOIA 1IBKE 2JVAA 4BS9A 5A6BA 1F2IG 1TN9A 2E5LE 2LE2A 1N33E 4L5NC 4R2AA 1T4NA 4B3ME 2EPCA 2EM0A 2DGCA 1MGTA 4DV7E 2NUFA 1PJQA 1ZBTA 2VRDA 4LF6E 2D9HA 2ELZA 3F6HA 3IWDA 4WXCA 4B3TE 3BIDA 4LTYA 2GLIA 4M9VC 2B9DA 3ADLA 2RS6A 2HJJA 4WXDA 2YRKA 2YRMA 2EQ3A 1GQEA 5A69A 1TF3A 2CSHA 5KL5A 2EN3A 3JU0A 2KHXA 4LU9A 2DMIA 4P7DA 1A1GA 2ENHA 3BGHA 2EOEA 4DR7E 3JTZA 2EMLA 2EOQA 4OX9E 4WFTA 4DKKA 4WYQB 4X66E 2EWLA 4O5GA 2YTPA 5BR8E 2EN2A 4JI3E 3DF6A 2LVHA 2EPPA 3C4BA 2H36X 3KZZA 2YTDA 2JY9A 4MLQA 1WHQA 1GTKA 2MDRA 4ZYDA 2F4VE 4F6NA 2M1SA 5CFFE 1ZAAC 2ELYA 4X65E 1Z1BA 3VYXA 2B7TA 2V85A 1YPNA 2IHR1 1L4SA 1EH8A 1IBME 3THNA 2EORA 2EN8A 2YT4A 4LF4E 3JAMC 1UILA 2EM5A 5AC5A 2PRTA 4JI6E 2GPIA 3AUZA 5F3WA 1PJSA 2JR1A 3LLHA 1SR9A 4JI8E 2L3CA 2WBUA 2EE8A 1IMUA 2ZM6E 1J26A 5A6JA 3MHSC 1IBLE 2HGHA 2YTJA 3ADIA 3EPJA 3THOB 2G7HA 3P1XA 4NZVA 2EM3A 4JI4E 3M99B 2B3TB 1UN6B 2L92A 2EPLX 2A25A 2EMHA 2R1FA 2HC5A 2EPXA 4DV2E 1N3GA 4R8OA 2M7QA 1HNZE 1X47A 2EPKX 2L8TA 4R2EA 4L8NA 5A2QC 3J80C 5LLQA 2DIXA 3OTOE 2EOOA 2V8QB 4B3SE 5AE1A 5KL6A 4KZSA 2EPRA 2EMBA 4YHHE 1SFEA 1YUJA 5TSEA 2F8BA 4WSPA 2I13A 2UU9E 1DI2A 2I9IA 1EKZA 1YYWA 2LTSA 2EPOA 1N32E 3LMLA 5LMUE 4R2QA 2EM8A 2MC5A 5A6AA 2EOMA 4B3RE 1MEYC 1X5WA 2EN4A 3HXLA 2FV4B 2L3JA 3EPHA 4DV1E 4WSGA 1UHZA 2CTDA 3HPZA 1BBGA 2LT7A 4GEQB 1HNXE 2DMYA 4X8WA 4ZYGA 4F54A 3HQ1A 1EH6A 1QU6A 4RHBB 2HHHE 2V86A 4M2ZA 1XMOE 4JI2E 4BC9A 2J7JA 3ZOQB 1P47A 4F6MA 3HTXA 5KL4A 4KHPE 2DB2A 5T6JA 3AV0A 1JK2A 2L2NA 2L2MA 2EM7A 3IWBA 4BHCA 2LRSA 4WX9A 5AE2A 4DR2E 3IWCA 4YY3E 2UUBE 1G2DC 4MLVA 2UXDE 2BBGA 3VK6A 4DV6E 1I94E 3F6GA 4F9AB 3T1HE 4M0VA 2NUEA 1N34E 1AH5A 2JOBA 5AC4A 2JYAA 4IJDA 5IWAE 4LFCE 2YSOA 1A1LA 4TUGA 2K4VA 2EL4A 2JWOA 1ZU1A 5A6BD 5IV8B 2EN7A 2R76A 2VE7C 2EM9A 4LF8E 4DV4E 2V83A 2MKDA 4X9JA 4JV5E 2L2KB 2EPAA 2EMXA 2EOSA 1T39A 2EJ4A 2WCC3 4KWYA 2EPZA 4NXNE 2VF1A 2YU8A 4LFAE 5KL2A 1IQOA 2ODRD
chains in the Genus database with same CATH topology
1T4NA 1O0WA 4DV5E 3RMPA 4B3ME 4JYAE 4YHHE 4DR5E 4JI7E 2F8BA 4WSPA 4BMJA 2RSMA 3KWRA 4BCAA 2UU9E 2NUGA 1HNWE 4DV7E 3HPSA 2NUFA 4Q28A 1DI2A 1ZBTA 1EKZA 1YYWA 2LTSA 4LF6E 2FTXB 4DR6E 1N32E 3LMLA 3F6HA 4X62E 5LMUE 3IWDA 2FGGA 2MC5A 4B3TE 2LBSB 3VYYA 1FJGE 4LTYA 4B3RE 2B9DA 3ADLA 1RQ0A 2KOUA 2RS6A 2UXCE 3J81C 4LF5E 4F9BB 1XNQE 5LL6R 2V89A 3HXLA 2FV4B 2L3JA 4DV0E 4DV1E 1GQEA 1UHZA 4AQYE 3JU0A 3HPZA 1T4LB 2KHXA 4LU9A 1YYOA 1STUA 2LMZA 4GEQB 5FLXC 1X49A 1XNRE 1HNXE 4P7DA 2DMYA 4X8WA 4GKKE 4DR7E 4JI1E 3JTZA 5IT9C 4F54A 3HQ1A 4F9CB 4OX9E 2LJHA 1QU6A 4WFTA 4WYQB 4DKKA 4X66E 2EWLA 1RC7A 2HHHE 4JI5E 2V86A 4M2ZA 1DQ3A 5BR8E 4NXME 2UXBE 3K6QA 4J8ZA 1XMOE 3DF6A 4JI3E 4K0KE 4R03A 1X48A 4BC9A 4WPYA 2L33A 4JI2E 2VQEE 4BC7A 3C4BA 1GZ6A 3DJWA 2H36X 3ZOQB 2E1MA 2UUCE 2EZ6A 2JY9A 1J26A 1WHQA 2MDRA 2LTRA 3ADGA 2LUPB 3HTXA 2F4VE 4KHPE 2DB2A 2NA2A 5T6JA 3AV0A 5AE3A 1YYKA 4OOGC 2L2NA 2L2MA 4M30A 2M4IA 3IWBA 2RTXA 2LRSA 3MSWA 2M1SA 4GKJE 2MC6A 5DNYA 5CFFE 5AE2A 4DUYE 4DR2E 4TUIA 3IWCA 4X65E 5LMNE 4YY3E 2UUBE 3VYXA 2B7TA 2V85A 1T4OA 2IHR1 2UXDE 4DV6E 3VK6A 1YZ9A 2B7VA 1I94E 3F6GA 4F9AB 3T1HE 1IBME 4M0VA 2YT4A 2NUEA 4LF4E 3JAMC 1UILA 4JI6E 1N34E 3AUZA 2V87A 1ZBQA 5F3WA 2JOBA 4DV3E 4DR4E 2JR1A 2JOXA 3LLHA 2RS7A 2DSYA 1WHNA 2N3GA 1SR9A 5IWAE 4DR3E 2UUAE 4JI8E 2L3CA 4LF9E 2V88A 2KONA 4LFCE 4TUGA 2K4VA 2JWOA 5AASA 2ZM6E 4DR1E 2ODRC 4DUZE 3J7Yp 1IBLE 2VE7C 1J5EE 4LF7E 1PKPA 3ADIA 2WZOA 4LF8E 3FIGA 1XMQE 2L6MA 1N36E 2G7HA 4BBYA 3P1XA 2CPNA 4DV4E 1FKAE 2V83A 4JI4E 3J7AG 2B3TB 3H09A 4JI0E 2LUQA 2L92A 3ADJA 4I8OA 3T1YE 4DMIA 4JV5E 2L2KB 2VQFE 4P78A 4DV2E 4R8OA 2M7QA 1HNZE 5ADZA 1HR0E 4X64E 1X47A 1WXRA 2L8TA 1IBKE 2JVAA 4LFBE 3C4TA 4BS9A 4L8NA 5A2QC 3J80C 4NXNE 2DIXA 2E5LE 3OTOE 3OMLA 2YZTA 2N3HA 2LE2A 2VF1A 2V8QB 4B3SE 1N33E 5AE1A 4LFAE 4L5NC 2ODRD 4KZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4N A;  1O0W A;  4DV5 E;  4B3M E;  4JYA E;  4YHH E;  4DR5 E;  4JI7 E;  2RSM A;  2UU9 E;  1HNW E;  4DV7 E;  2NUF A;  1DI2 A;  1ZBT A;  1EKZ A;  1YYW A;  2LTS A;  4LF6 E;  4DR6 E;  1N32 E;  4X62 E;  5LMU E;  4B3T E;  2LBS B;  3VYY A;  1FJG E;  4B3R E;  3ADL A;  1RQ0 A;  2RS6 A;  2UXC E;  4LF5 E;  1XNQ E;  2L3J A;  4DV0 E;  4DV1 E;  1GQE A;  1UHZ A;  4AQY E;  1T4L B;  2KHX A;  1YYO A;  1STU A;  1XNR E;  1X49 A;  1HNX E;  4GKK E;  2DMY A;  4X8W A;  4DR7 E;  4JI1 E;  4OX9 E;  2LJH A;  1QU6 A;  4WFT A;  4WYQ B;  4DKK A;  4X66 E;  1RC7 A;  2HHH E;  4JI5 E;  4M2Z A;  5BR8 E;  4NXM E;  2UXB E;  1XMO E;  4JI3 E;  4K0K E;  1X48 A;  4JI2 E;  2L33 A;  2VQE E;  3C4B A;  2UUC E;  2EZ6 A;  2JY9 A;  1WHQ A;  2MDR A;  2LTR A;  3ADG A;  2LUP B;  3HTX A;  2F4V E;  4KHP E;  2DB2 A;  2NA2 A;  1YYK A;  4OOG C;  2L2N A;  2L2M A;  4M30 A;  2RTX A;  2LRS A;  4GKJ E;  5CFF E;  4DUY E;  4DR2 E;  4X65 E;  5LMN E;  4YY3 E;  2UUB E;  3VYX A;  2B7T A;  1T4O A;  2IHR 1;  2UXD E;  4DV6 E;  1YZ9 A;  2B7V A;  1I94 E;  3T1H E;  1IBM E;  2YT4 A;  2NUE A;  4LF4 E;  1UIL A;  4JI6 E;  1N34 E;  4DV3 E;  4DR4 E;  3LLH A;  2RS7 A;  1WHN A;  2N3G A;  4LF9 E;  5IWA E;  4DR3 E;  2UUA E;  4JI8 E;  2L3C A;  4LFC E;  2NUG A;  2ZM6 E;  4DR1 E;  1J26 A;  4DUZ E;  3J7Y p;  1IBL E;  1J5E E;  4LF7 E;  1PKP A;  3ADI A;  4LF8 E;  1XMQ E;  1N36 E;  1FKA E;  3P1X A;  2CPN A;  4DV4 E;  4JI4 E;  2B3T B;  4JI0 E;  2LUQ A;  3ADJ A;  3T1Y E;  4JV5 E;  2L2K B;  2VQF E;  4DV2 E;  1HNZ E;  1HR0 E;  4X64 E;  1X47 A;  4LFB E;  1IBK E;  2JVA A;  3C4T A;  4NXN E;  2DIX A;  2E5L E;  3OTO E;  2N3H A;  4B3S E;  1N33 E;  4LFA E; 
#chains in the Genus database with same CATH topology
 4O43 A;  3RMP A;  3UK3 C;  1A1K A;  4HEI A;  3C6M A;  2GHF A;  4BHB A;  2WBT A;  4BMJ A;  4R2S A;  2YTN A;  1DGC A;  2DLQ A;  2EP3 A;  2EPU A;  1NEI A;  1A1J A;  2FTX B;  4DR6 E;  4X62 E;  2FGG A;  2LBS B;  3VYY A;  1FJG E;  2LO3 A;  1RQ0 A;  3J81 C;  1XNQ E;  4F9B B;  4O24 A;  2V89 A;  2ENA A;  2EOX A;  2MDG A;  2JPA A;  2LV2 A;  1T4L B;  2EOJ A;  2ADR A;  2JXP A;  2EM4 A;  1STU A;  2LMZ A;  1XNR E;  5FLX C;  1X49 A;  1X3C A;  1BBO A;  2YTO A;  4JI1 E;  5IT9 C;  4F2J C;  2EPM X;  4F9C B;  5A6K A;  2LJH A;  4JI5 E;  3KZY A;  1DQ3 A;  2EOZ A;  3K6Q A;  3EQ1 A;  2CT1 A;  1YFH A;  2EMI A;  4R03 A;  4K0K E;  1X48 A;  1WJP A;  2N8X A;  3DJW A;  2UUC E;  2EZ6 A;  2EMC A;  1B69 A;  3ADG A;  2NA2 A;  4R2D A;  5AE3 A;  1YYK A;  2EL6 A;  1BB8 A;  2EN1 A;  2RTX A;  4R2C A;  1WRJ A;  4NHR A;  2MC6 A;  3ECR A;  3L00 A;  5DNY A;  2NAB A;  4DUY E;  2EMG A;  5LMN E;  1UBD C;  2YTQ A;  4O4K A;  4R2P A;  2LJU A;  2B7V A;  3MHH C;  4R2R A;  2V87 A;  1ZBQ A;  1A1H A;  4RH8 A;  4DV3 E;  2DSY A;  2YRH A;  4LF9 E;  4DR3 E;  2UUA E;  2V88 A;  1NCS A;  4DR1 E;  2ODR C;  4DUZ E;  3J7Y p;  1J5E E;  2ENC A;  4LF7 E;  1A1I A;  1N36 E;  2L6M A;  1FKA E;  2EMF A;  1ZR9 A;  2DLK A;  2YWQ A;  4JI0 E;  2EL5 A;  2LUQ A;  3ADJ A;  4I8O A;  1JK1 A;  2Q8U A;  4P78 A;  2E72 A;  5KL3 A;  5ADZ A;  1WXR A;  1X6H A;  4LFB E;  3C4T A;  2YU5 A;  2YTE A;  2EOY A;  4N4R B;  3OML A;  2YZT A;  2N3H A;  3J7A G;  1O0W A;  4DV5 E;  4JYA E;  4DR5 E;  4JI7 E;  1AAY A;  2YPN A;  2RSM A;  3KWR A;  4BCA A;  1HNW E;  2EM2 A;  3HPS A;  4Q28 A;  2EQ0 A;  4HTG A;  2YTF A;  3QG5 C;  2EM6 A;  2KOU A;  2UXC E;  4LF5 E;  2YTI A;  5LL6 R;  2EOH A;  3TQM A;  4DV0 E;  2MKN A;  4Q35 B;  4AQY E;  3BF2 A;  2M9A A;  2JP9 A;  2EPN A;  1YYO A;  4ZYE A;  2EQ1 A;  4GKK E;  1QNT A;  1RC7 A;  4GZN C;  1RMD A;  4NXM E;  2UXB E;  4J8Z A;  4WPY A;  2L33 A;  2VQE E;  4BC7 A;  1GZ6 A;  2EMZ A;  2E1M A;  2LUP B;  2EN6 A;  2LTR A;  1X6F A;  2DRP A;  4OOG C;  1PDA A;  4M30 A;  2M4I A;  2EMK A;  3C6K A;  2RSI A;  3MSW A;  4GKJ E;  2LCE A;  4IS1 C;  4TUI A;  1EH7 A;  1PJT A;  1T4O A;  3EPL A;  1LLM C;  1YZ9 A;  2EMA A;  1TF6 A;  2YSP A;  1YSA C;  3VHT B;  4DR4 E;  2JOX A;  2EOF A;  1WHN A;  2N3G A;  2RS7 A;  5IXM B;  2NUG A;  2YTG A;  2K7I A;  2KON A;  4FK5 C;  2BB8 A;  5AAS A;  1G2F C;  1YUI A;  2RQL A;  2EMY A;  5KL7 A;  1PKP A;  2WZO A;  1IQS A;  3FIG A;  1X6E A;  1XMQ E;  4BBY A;  2CPN A;  1KJK A;  1A1F A;  3H09 A;  2RPC A;  1KYQ A;  4ZYH A;  2WBS A;  2EMW A;  1T38 A;  3T1Y E;  4DMI A;  2VQF E;  3EPK A;  1HR0 E;  4X64 E;  3BBG A;  2EOI A;  1IBK E;  2JVA A;  4BS9 A;  5A6B A;  1F2I G;  1TN9 A;  2E5L E;  2LE2 A;  1N33 E;  4L5N C;  4R2A A;  1T4N A;  4B3M E;  2EPC A;  2EM0 A;  2DGC A;  1MGT A;  4DV7 E;  2NUF A;  1PJQ A;  1ZBT A;  2VRD A;  4LF6 E;  2D9H A;  2ELZ A;  3F6H A;  3IWD A;  4WXC A;  4B3T E;  3BID A;  4LTY A;  2GLI A;  4M9V C;  2B9D A;  3ADL A;  2RS6 A;  2HJJ A;  4WXD A;  2YRK A;  2YRM A;  2EQ3 A;  1GQE A;  5A69 A;  1TF3 A;  2CSH A;  5KL5 A;  2EN3 A;  3JU0 A;  2KHX A;  4LU9 A;  2DMI A;  4P7D A;  1A1G A;  2ENH A;  3BGH A;  2EOE A;  4DR7 E;  3JTZ A;  2EML A;  2EOQ A;  4OX9 E;  4WFT A;  4DKK A;  4WYQ B;  4X66 E;  2EWL A;  4O5G A;  2YTP A;  5BR8 E;  2EN2 A;  4JI3 E;  3DF6 A;  2LVH A;  2EPP A;  3C4B A;  2H36 X;  3KZZ A;  2YTD A;  2JY9 A;  4MLQ A;  1WHQ A;  1GTK A;  2MDR A;  4ZYD A;  2F4V E;  4F6N A;  2M1S A;  5CFF E;  1ZAA C;  2ELY A;  4X65 E;  1Z1B A;  3VYX A;  2B7T A;  2V85 A;  1YPN A;  2IHR 1;  1L4S A;  1EH8 A;  1IBM E;  3THN A;  2EOR A;  2EN8 A;  2YT4 A;  4LF4 E;  3JAM C;  1UIL A;  2EM5 A;  5AC5 A;  2PRT A;  4JI6 E;  2GPI A;  3AUZ A;  5F3W A;  1PJS A;  2JR1 A;  3LLH A;  1SR9 A;  4JI8 E;  2L3C A;  2WBU A;  2EE8 A;  1IMU A;  2ZM6 E;  1J26 A;  5A6J A;  3MHS C;  1IBL E;  2HGH A;  2YTJ A;  3ADI A;  3EPJ A;  3THO B;  2G7H A;  3P1X A;  4NZV A;  2EM3 A;  4JI4 E;  3M99 B;  2B3T B;  1UN6 B;  2L92 A;  2EPL X;  2A25 A;  2EMH A;  2R1F A;  2HC5 A;  2EPX A;  4DV2 E;  1N3G A;  4R8O A;  2M7Q A;  1HNZ E;  1X47 A;  2EPK X;  2L8T A;  4R2E A;  4L8N A;  5A2Q C;  3J80 C;  5LLQ A;  2DIX A;  3OTO E;  2EOO A;  2V8Q B;  4B3S E;  5AE1 A;  5KL6 A;  4KZS A;  2EPR A;  2EMB A;  4YHH E;  1SFE A;  1YUJ A;  5TSE A;  2F8B A;  4WSP A;  2I13 A;  2UU9 E;  1DI2 A;  2I9I A;  1EKZ A;  1YYW A;  2LTS A;  2EPO A;  1N32 E;  3LML A;  5LMU E;  4R2Q A;  2EM8 A;  2MC5 A;  5A6A A;  2EOM A;  4B3R E;  1MEY C;  1X5W A;  2EN4 A;  3HXL A;  2FV4 B;  2L3J A;  3EPH A;  4DV1 E;  4WSG A;  1UHZ A;  2CTD A;  3HPZ A;  1BBG A;  2LT7 A;  4GEQ B;  1HNX E;  2DMY A;  4X8W A;  4ZYG A;  4F54 A;  3HQ1 A;  1EH6 A;  1QU6 A;  4RHB B;  2HHH E;  2V86 A;  4M2Z A;  1XMO E;  4JI2 E;  4BC9 A;  2J7J A;  3ZOQ B;  1P47 A;  4F6M A;  3HTX A;  5KL4 A;  4KHP E;  2DB2 A;  5T6J A;  3AV0 A;  1JK2 A;  2L2N A;  2L2M A;  2EM7 A;  3IWB A;  4BHC A;  2LRS A;  4WX9 A;  5AE2 A;  4DR2 E;  3IWC A;  4YY3 E;  2UUB E;  1G2D C;  4MLV A;  2UXD E;  2BBG A;  3VK6 A;  4DV6 E;  1I94 E;  3F6G A;  4F9A B;  3T1H E;  4M0V A;  2NUE A;  1N34 E;  1AH5 A;  2JOB A;  5AC4 A;  2JYA A;  4IJD A;  5IWA E;  4LFC E;  2YSO A;  1A1L A;  4TUG A;  2K4V A;  2EL4 A;  2JWO A;  1ZU1 A;  5A6B D;  5IV8 B;  2EN7 A;  2R76 A;  2VE7 C;  2EM9 A;  4LF8 E;  4DV4 E;  2V83 A;  2MKD A;  4X9J A;  4JV5 E;  2L2K B;  2EPA A;  2EMX A;  2EOS A;  1T39 A;  2EJ4 A;  2WCC 3;  4KWY A;  2EPZ A;  4NXN E;  2VF1 A;  2YU8 A;  4LFA E;  5KL2 A;  1IQO A;  2ODR D; 
#chains in the Genus database with same CATH homology
 1T4N A;  1O0W A;  4DV5 E;  3RMP A;  4B3M E;  4JYA E;  4YHH E;  4DR5 E;  4JI7 E;  2F8B A;  4WSP A;  4BMJ A;  2RSM A;  3KWR A;  4BCA A;  2UU9 E;  2NUG A;  1HNW E;  4DV7 E;  3HPS A;  2NUF A;  4Q28 A;  1DI2 A;  1ZBT A;  1EKZ A;  1YYW A;  2LTS A;  4LF6 E;  2FTX B;  4DR6 E;  1N32 E;  3LML A;  3F6H A;  4X62 E;  5LMU E;  3IWD A;  2FGG A;  2MC5 A;  4B3T E;  2LBS B;  3VYY A;  1FJG E;  4LTY A;  4B3R E;  2B9D A;  3ADL A;  1RQ0 A;  2KOU A;  2RS6 A;  2UXC E;  3J81 C;  4LF5 E;  4F9B B;  1XNQ E;  5LL6 R;  2V89 A;  3HXL A;  2FV4 B;  2L3J A;  4DV0 E;  4DV1 E;  1GQE A;  1UHZ A;  4AQY E;  3JU0 A;  3HPZ A;  1T4L B;  2KHX A;  4LU9 A;  1YYO A;  1STU A;  2LMZ A;  4GEQ B;  5FLX C;  1X49 A;  1XNR E;  1HNX E;  4P7D A;  2DMY A;  4X8W A;  4GKK E;  4DR7 E;  4JI1 E;  3JTZ A;  5IT9 C;  4F54 A;  3HQ1 A;  4F9C B;  4OX9 E;  2LJH A;  1QU6 A;  4WFT A;  4WYQ B;  4DKK A;  4X66 E;  2EWL A;  1RC7 A;  2HHH E;  4JI5 E;  2V86 A;  4M2Z A;  1DQ3 A;  5BR8 E;  4NXM E;  2UXB E;  3K6Q A;  4J8Z A;  1XMO E;  3DF6 A;  4JI3 E;  4K0K E;  4R03 A;  1X48 A;  4BC9 A;  4WPY A;  2L33 A;  4JI2 E;  2VQE E;  4BC7 A;  3C4B A;  1GZ6 A;  3DJW A;  2H36 X;  3ZOQ B;  2E1M A;  2UUC E;  2EZ6 A;  2JY9 A;  1J26 A;  1WHQ A;  2MDR A;  2LTR A;  3ADG A;  2LUP B;  3HTX A;  2F4V E;  4KHP E;  2DB2 A;  2NA2 A;  5T6J A;  3AV0 A;  5AE3 A;  1YYK A;  4OOG C;  2L2N A;  2L2M A;  4M30 A;  2M4I A;  3IWB A;  2RTX A;  2LRS A;  3MSW A;  2M1S A;  4GKJ E;  2MC6 A;  5DNY A;  5CFF E;  5AE2 A;  4DUY E;  4DR2 E;  4TUI A;  3IWC A;  4X65 E;  5LMN E;  4YY3 E;  2UUB E;  3VYX A;  2B7T A;  2V85 A;  1T4O A;  2IHR 1;  2UXD E;  4DV6 E;  3VK6 A;  1YZ9 A;  2B7V A;  1I94 E;  3F6G A;  4F9A B;  3T1H E;  1IBM E;  4M0V A;  2YT4 A;  2NUE A;  4LF4 E;  3JAM C;  1UIL A;  4JI6 E;  1N34 E;  3AUZ A;  2V87 A;  1ZBQ A;  5F3W A;  2JOB A;  4DV3 E;  4DR4 E;  2JR1 A;  2JOX A;  3LLH A;  2RS7 A;  2DSY A;  1WHN A;  2N3G A;  1SR9 A;  5IWA E;  4DR3 E;  2UUA E;  4JI8 E;  2L3C A;  4LF9 E;  2V88 A;  2KON A;  4LFC E;  4TUG A;  2K4V A;  2JWO A;  5AAS A;  2ZM6 E;  4DR1 E;  2ODR C;  4DUZ E;  3J7Y p;  1IBL E;  2VE7 C;  1J5E E;  4LF7 E;  1PKP A;  3ADI A;  2WZO A;  4LF8 E;  3FIG A;  1XMQ E;  2L6M A;  1N36 E;  2G7H A;  4BBY A;  3P1X A;  2CPN A;  4DV4 E;  1FKA E;  2V83 A;  4JI4 E;  3J7A G;  2B3T B;  3H09 A;  4JI0 E;  2LUQ A;  2L92 A;  3ADJ A;  4I8O A;  3T1Y E;  4DMI A;  4JV5 E;  2L2K B;  2VQF E;  4P78 A;  4DV2 E;  4R8O A;  2M7Q A;  1HNZ E;  5ADZ A;  1HR0 E;  4X64 E;  1X47 A;  1WXR A;  2L8T A;  1IBK E;  2JVA A;  4LFB E;  3C4T A;  4BS9 A;  4L8N A;  5A2Q C;  3J80 C;  4NXN E;  2DIX A;  2E5L E;  3OTO E;  3OML A;  2YZT A;  2N3H A;  2LE2 A;  2VF1 A;  2V8Q B;  4B3S E;  1N33 E;  5AE1 A;  4LFA E;  4L5N C;  2ODR D;  4KZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...