2EMYA

Solution structure of the c2h2 type zinc finger (region 551-583) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGENPYECHECGKAFSRKYQLISHQRTHAGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 551-583) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emyA00
2ENHA 1F2IG 2GLIA 1P47A 2DGCA 2I13A 1BB8A 4GZNC 2JP9A 2EMCA 2YSPA 2EOIA 2EL5A 2ENAA 2YTJA 2YU8A 4F2JC 2J7JA 1A1IA 4F6NA 2EOSA 2EPRA 2EPAA 1DGCA 1ZR9A 2LO3A 1A1JA 2HGHA 2MKNA 5KL3A 4R2QA 1G2FC 2EMYA 2DRPA 1AAYA 2EOZA 4FK5C 2A25A 2RSIA 2DLQA 3EPLA 2EQ3A 2ELYA 2EL4A 2E72A 4R2AA 1TN9A 2WBTA 2EM2A 4M9VC 2EN4A 2EOMA 5KL7A 2EOJA 4R2RA 2EPXA 2EQ1A 1A1FA 2EM5A 3UK3C 1X6FA 2EM7A 2EMKA 2EQ0A 4WSGA 5KL6A 1YUJA 2LV2A 3VHTB 2PRTA 2EMWA 2YTQA 2EPUA 1A1GA 1A1LA 2EE8A 2ELZA 2YTOA 1ZAAC 2EN6A 2EM0A 2EOXA 2EOFA 4IS1C 2EN8A 1G2DC 5KL2A 2EN1A 2EN7A 2CSHA 4IJDA 1X6HA 2WCC3 4R2EA 2DLKA 2EOQA 2YTNA 5KL5A 1A1KA 4R2CA 2NABA 2EMIA 1KJKA 2EMHA 1MEYC 2EMZA 1X5WA 2YTDA 2WBUA 2EL6A 2EM4A 3M99B 1B69A 2EN2A 2DMIA 2EP3A 2VRDA 1WJPA 2CTDA 2EM6A 4R2SA 2LVHA 1LLMC 2EMGA 2D9HA 2R1FA 2BB8A 2YRMA 2YRKA 2YSOA 5KL4A 2YU5A 2ENCA 2JPAA 1X6EA 1Z1BA 1RMDA 2EMAA 2M9AA 2EN3A 1BBOA 2MDGA 2LCEA 2EOHA 1YUIA 4F6MA 1TF6A 1ZU1A 1YSAC 3MHSC 2LT7A 1NCSA 2EM8A 2EPCA 2YTGA 4X9JA 2CT1A 2EMXA 2YTEA 2YTPA 2EPPA 4R2PA 2YTIA 1UN6B 1TF3A 2EMBA 2RPCA 4R2DA 2EM9A 2EPZA 2EJ4A 2YTFA 2WBSA 2GHFA 2MKDA 2EMLA 2EOYA 2EORA 3EPHA 1JK2A 2ADRA 3EPJA 2EOEA 3MHHC 1A1HA 1X3CA 2EMFA 2EM3A 2EOOA 1UBDC 3EPKA 2YRHA 1JK1A
chains in the Genus database with same CATH superfamily
1WHQA 2ENHA 1F2IG 3AV0A 2I13A 2RSMA 4BHCA 2JP9A 1T39A 2EL5A 2ENAA 2L8TA 2EOSA 1ZR9A 5A2QC 1A1JA 2MKNA 4LTYA 3J7Yp 4ZYEA 2M7QA 1EH6A 3HXLA 2EOZA 4B3SE 1WHNA 2DLQA 2JR1A 4R2AA 2E72A 2EPLX 3ADIA 2UU9E 2EM2A 3BF2A 2B3TB 4R2RA 2MDRA 2NA2A 4WFTA 2K4VA 2EM7A 2EMKA 3VYYA 4F9BB 1YFHA 1T4NA 2LMZA 1PDAA 2EMWA 2B7TA 5AE3A 2ELZA 4DV2E 1ZAAC 2LJHA 5AC4A 2EM0A 2JVAA 5KL2A 5AE1A 2CSHA 2RTXA 3HPZA 4LFBE 1X6HA 2WCC3 1HNXE 1KJKA 5A6KA 1MEYC 2L2KB 1X5WA 2WBUA 2JXPA 2L3CA 2EM4A 2EN2A 2DMIA 1IQSA 3MSWA 1YPNA 2VRDA 1WJPA 5A6BD 2CTDA 2LVHA 5TSEA 4RH8A 4JI3E 5KL4A 2YRMA 2JPAA 4LF6E 3FIGA 4BBYA 4OX9E 2EMAA 2M9AA 3DF6A 3AUZA 2V8QB 4WXDA 2Q8UA 2MDGA 4O5GA 4BMJA 2NUEA 3KWRA 4L5NC 3HPSA 2L3JA 3ECRA 4DV0E 4GEQB 1NCSA 2EM8A 2LE2A 2YTPA 4DR2E 4I8OA 5A6BA 1L4SA 3JU0A 4N4RB 4P7DA 1TF3A 4X64E 1XMQE 2JYAA 2ODRD 2EJ4A 2V85A 1I94E 4KWYA 1DI2A 3IWDA 5LMUE 3EPHA 4GKKE 4JI1E 3DJWA 1QU6A 1A1HA 2EM3A 2EOOA 4LF7E 2YRHA 1JK1A 1P47A 4B3TE 4GZNC 4L8NA 1N36E 1XNRE 2YSPA 2J7JA 2DB2A 4WPYA 2JOBA 2IHR1 4WXCA 2LO3A 2EPNA 2EMYA 3RMPA 3BBGA 3OMLA 3EQ1A 4FK5C 2L6MA 4TUGA 2EQ3A 2LUQA 5F3WA 3ADJA 1IBKE 4DV7E 4M30A 2E5LE 1YUJA 3VHTB 4BCAA 2YTOA 2EOFA 1N3GA 2EN8A 1EH7A 3HTXA 2MC5A 2UXDE 3TQMA 2EN7A 4ZYGA 2B9DA 4B3ME 2DLKA 2KOUA 5FLXC 2YTNA 2UUCE 1ZBTA 5LLQA 4JYAE 3T1HE 2JWOA 2EMZA 2YTDA 4JI4E 5BR8E 4X65E 1B69A 2V87A 4LF5E 1T4OA 4O4KA 1KYQA 1YZ9A 4DR3E 1LLMC 2V86A 1UHZA 2D9HA 1EH8A 2YRKA 4DUZE 2ENCA 1X6EA 1RMDA 3VK6A 2I9IA 2EN3A 3J7AG 2LCEA 2EOHA 2YZTA 4F6MA 1TF6A 3OTOE 3MHSC 4WX9A 2L92A 1SR9A 5ADZA 2HHHE 5IXMB 4RHBB 2EPCA 4K0KE 2YTGA 1PKPA 2CT1A 1IBLE 5AASA 4DR4E 3F6HA 1EKZA 3THNA 4R2PA 2YTIA 2N3HA 1UN6B 2FV4B 3VYXA 4DV5E 2VQFE 2YTFA 4X66E 2EMLA 2EOYA 1GQEA 2V89A 3BIDA 2FGGA 2EPKX 5LL6R 1JK2A 1MGTA 4LF8E 2ADRA 1X3CA 1X48A 3EPKA 2GLIA 4NZVA 4MLQA 2M1SA 2EMCA 1IQOA 4DV3E 1BBGA 2LTSA 4F6NA 2EPRA 1HR0E 2EPAA 1HNZE 3LMLA 4OOGC 5KL3A 4WSPA 1G2FC 1XNQE 4J8ZA 1FJGE 1PJTA 4MLVA 2CPNA 4WYQB 4YHHE 4R03A 2A25A 1IMUA 2RSIA 3EPLA 2ELYA 2EL4A 4GKJE 2MC6A 1WXRA 4M9VC 2EN4A 4O24A 2EOMA 5KL7A 4X62E 1AH5A 2EOJA 2EPXA 3L00A 4M2ZA 4DUYE 1X6FA 2KHXA 5KL6A 2E1MA 4LFAE 2LJUA 2PRTA 4LFCE 2EPUA 1A1GA 4KHPE 1N32E 4JI5E 2F8BA 3C4TA 3J80C 5AE2A 4LF4E 4LF9E 3F6GA 1XMOE 1STUA 2N8XA 2EN1A 5CFFE 4IJDA 2HC5A 3C6KA 1NEIA 4R2EA 5KL5A 4Q35B 4P78A 4R2CA 2NABA 3H09A 2KONA 2M4IA 4X8WA 1FKAE 1WRJA 1T38A 2EL6A 5DNYA 2YPNA 4JI6E 1PJSA 2EM6A 5IWAE 2EMGA 1RQ0A 1YYWA 2R1FA 2ZM6E 2YSOA 2YU5A 1J5EE 1Z1BA 1BBOA 1ZBQA 2DIXA 4JI8E 4DKKA 1ZU1A 4F9AB 4Q28A 1UILA 5A69A 2EWLA 3IWCA 5IV8B 5AC5A 2B7VA 3C6MA 2YTEA 3ADGA 1GTKA 4B3RE 2DMYA 3ADLA 2RPCA 3JAMC 4R2DA 2MKDA 2HJJA 4DV4E 4NXME 1RC7A 3MHHC 2EMFA 4F9CB 2LUPB 2EPMX 2DGCA 1BB8A 2LBSB 2GPIA 5A6AA 3JTZA 2EOIA 2YTJA 2YU8A 4F2JC 1A1IA 1QNTA 4BC7A 2V88A 3QG5C 1DGCA 3KZYA 2R76A 2F4VE 4LU9A 5LMNE 1GZ6A 3ZOQB 4R2QA 2DRPA 1AAYA 1O0WA 4M0VA 2NUFA 3HQ1A 4F54A 2ODRC 4JI2E 2YT4A 2UUAE 1TN9A 2WBTA 4HEIA 1YYKA 2RS6A 2UXCE 3J81C 2EQ1A 1A1FA 2EM5A 3UK3C 2YWQA 4BHBA 2EQ0A 4BS9A 4WSGA 3BGHA 2LV2A 3KZZA 5T6JA 2H36X 2NUGA 2YTQA 2N3GA 2LRSA 4R8OA 4AQYE 4DR6E 1A1LA 2EE8A 2EN6A 4ZYHA 4DR5E 2EOXA 4IS1C 1G2DC 5A6JA 3C4BA 2VF1A 3T1YE 2UXBE 4KZSA 2EOQA 1A1KA 2EMIA 5IT9C 2EMHA 1YYOA 2FTXB 4JI0E 2RS7A 2V83A 2BBGA 4DR7E 1DQ3A 2JOXA 4DMIA 4YY3E 4HTGA 3M99B 1J26A 2EP3A 4JV5E 2UUBE 2L2MA 2G7HA 2DSYA 4R2SA 2BB8A 1T4LB 2EPOA 3P1XA 4DR1E 1HNWE 1SFEA 2LTRA 4DV1E 2K7IA 4JI7E 3THOB 1YUIA 1YSAC 1X49A 4NXNE 2L2NA 2VE7C 2WZOA 2LT7A 4X9JA 4TUIA 2EMXA 2EPPA 4BC9A 1N33E 4ZYDA 1PJQA 4DV6E 2EMBA 3LLHA 2EZ6A 2EM9A 2EPZA 2WBSA 2GHFA 2L33A 2JY9A 2EORA 2RQLA 2VQEE 1N34E 1X47A 3K6QA 1IBME 3EPJA 3IWBA 2EOEA 4O43A 1UBDC 4NHRA 2HGHA
chains in the Genus database with same CATH topology
2ENHA 1F2IG 2GLIA 1P47A 2DGCA 2I13A 1BB8A 4GZNC 2JP9A 2EMCA 2YSPA 2EOIA 2EL5A 2ENAA 2YTJA 2YU8A 4F2JC 2J7JA 1A1IA 4F6NA 2EOSA 2EPRA 2EPAA 1DGCA 1ZR9A 2LO3A 1A1JA 2HGHA 2MKNA 5KL3A 4R2QA 1G2FC 2EMYA 2DRPA 1AAYA 2EOZA 4FK5C 2A25A 2RSIA 2DLQA 3EPLA 2EQ3A 2ELYA 2EL4A 2E72A 4R2AA 1TN9A 2WBTA 2EM2A 4M9VC 2EN4A 2EOMA 5KL7A 2EOJA 4R2RA 2EPXA 2EQ1A 1A1FA 2EM5A 3UK3C 1X6FA 2EM7A 2EMKA 2EQ0A 4WSGA 5KL6A 1YUJA 2LV2A 3VHTB 2PRTA 2EMWA 2YTQA 2EPUA 1A1GA 1A1LA 2EE8A 2ELZA 2YTOA 1ZAAC 2EN6A 2EM0A 2EOXA 2EOFA 4IS1C 2EN8A 1G2DC 5KL2A 2EN1A 2EN7A 2CSHA 4IJDA 1X6HA 2WCC3 4R2EA 2DLKA 2EOQA 2YTNA 5KL5A 1A1KA 4R2CA 2NABA 2EMIA 1KJKA 2EMHA 1MEYC 2EMZA 1X5WA 2YTDA 2WBUA 2EL6A 2EM4A 3M99B 1B69A 2EN2A 2DMIA 2EP3A 2VRDA 1WJPA 2CTDA 2EM6A 4R2SA 2LVHA 1LLMC 2EMGA 2D9HA 2R1FA 2BB8A 2YRMA 2YRKA 2YSOA 5KL4A 2YU5A 2ENCA 2JPAA 1X6EA 1Z1BA 1RMDA 2EMAA 2M9AA 2EN3A 1BBOA 2MDGA 2LCEA 2EOHA 1YUIA 4F6MA 1TF6A 1ZU1A 1YSAC 3MHSC 2LT7A 1NCSA 2EM8A 2EPCA 2YTGA 4X9JA 2CT1A 2EMXA 2YTEA 2YTPA 2EPPA 4R2PA 2YTIA 1UN6B 1TF3A 2EMBA 2RPCA 4R2DA 2EM9A 2EPZA 2EJ4A 2YTFA 2WBSA 2GHFA 2MKDA 2EMLA 2EOYA 2EORA 3EPHA 1JK2A 2ADRA 3EPJA 2EOEA 3MHHC 1A1HA 1X3CA 2EMFA 2EM3A 2EOOA 1UBDC 3EPKA 2YRHA 1JK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENH A;  1F2I G;  2GLI A;  1P47 A;  2DGC A;  2I13 A;  1BB8 A;  4GZN C;  2JP9 A;  2EMC A;  2YSP A;  2EOI A;  2EL5 A;  2ENA A;  2YTJ A;  2YU8 A;  4F2J C;  2J7J A;  1A1I A;  4F6N A;  2EOS A;  2EPR A;  2EPA A;  1DGC A;  1ZR9 A;  2LO3 A;  1A1J A;  2HGH A;  2MKN A;  5KL3 A;  4R2Q A;  1G2F C;  2EMY A;  2DRP A;  1AAY A;  2EOZ A;  4FK5 C;  2A25 A;  2RSI A;  2DLQ A;  3EPL A;  2EQ3 A;  2ELY A;  2EL4 A;  2E72 A;  4R2A A;  1TN9 A;  2WBT A;  2EM2 A;  4M9V C;  2EN4 A;  2EOM A;  5KL7 A;  2EOJ A;  4R2R A;  2EPX A;  2EQ1 A;  1A1F A;  2EM5 A;  3UK3 C;  1X6F A;  2EM7 A;  2EMK A;  2EQ0 A;  4WSG A;  5KL6 A;  1YUJ A;  2LV2 A;  3VHT B;  2PRT A;  2EMW A;  2YTQ A;  2EPU A;  1A1G A;  1A1L A;  2EE8 A;  2ELZ A;  2YTO A;  1ZAA C;  2EN6 A;  2EM0 A;  2EOX A;  2EOF A;  4IS1 C;  2EN8 A;  1G2D C;  5KL2 A;  2EN1 A;  2EN7 A;  2CSH A;  4IJD A;  1X6H A;  2WCC 3;  4R2E A;  2DLK A;  2EOQ A;  2YTN A;  5KL5 A;  1A1K A;  4R2C A;  2NAB A;  2EMI A;  1KJK A;  2EMH A;  1MEY C;  2EMZ A;  1X5W A;  2YTD A;  2WBU A;  2EL6 A;  2EM4 A;  3M99 B;  1B69 A;  2EN2 A;  2DMI A;  2EP3 A;  2VRD A;  1WJP A;  2CTD A;  2EM6 A;  4R2S A;  2LVH A;  1LLM C;  2EMG A;  2D9H A;  2R1F A;  2BB8 A;  2YRM A;  2YRK A;  2YSO A;  5KL4 A;  2YU5 A;  2ENC A;  2JPA A;  1X6E A;  1Z1B A;  1RMD A;  2EMA A;  2M9A A;  2EN3 A;  1BBO A;  2MDG A;  2LCE A;  2EOH A;  1YUI A;  4F6M A;  1TF6 A;  1ZU1 A;  1YSA C;  3MHS C;  2LT7 A;  1NCS A;  2EM8 A;  2EPC A;  2YTG A;  4X9J A;  2CT1 A;  2EMX A;  2YTE A;  2YTP A;  2EPP A;  4R2P A;  2YTI A;  1UN6 B;  1TF3 A;  2EMB A;  2RPC A;  4R2D A;  2EM9 A;  2EPZ A;  2EJ4 A;  2YTF A;  2WBS A;  2GHF A;  2MKD A;  2EML A;  2EOY A;  2EOR A;  3EPH A;  1JK2 A;  2ADR A;  3EPJ A;  2EOE A;  3MHH C;  1A1H A;  1X3C A;  2EMF A;  2EM3 A;  2EOO A;  1UBD C;  3EPK A;  2YRH A;  1JK1 A; 
#chains in the Genus database with same CATH topology
 1WHQ A;  2ENH A;  1F2I G;  3AV0 A;  2I13 A;  2RSM A;  4BHC A;  2JP9 A;  1T39 A;  2EL5 A;  2ENA A;  2L8T A;  2EOS A;  1ZR9 A;  5A2Q C;  1A1J A;  2MKN A;  4LTY A;  3J7Y p;  4ZYE A;  2M7Q A;  1EH6 A;  3HXL A;  2EOZ A;  4B3S E;  1WHN A;  2DLQ A;  2JR1 A;  4R2A A;  2E72 A;  2EPL X;  3ADI A;  2UU9 E;  2EM2 A;  3BF2 A;  2B3T B;  4R2R A;  2MDR A;  2NA2 A;  4WFT A;  2K4V A;  2EM7 A;  2EMK A;  3VYY A;  4F9B B;  1YFH A;  1T4N A;  2LMZ A;  1PDA A;  2EMW A;  2B7T A;  5AE3 A;  2ELZ A;  4DV2 E;  1ZAA C;  2LJH A;  5AC4 A;  2EM0 A;  2JVA A;  5KL2 A;  5AE1 A;  2CSH A;  2RTX A;  3HPZ A;  4LFB E;  1X6H A;  2WCC 3;  1HNX E;  1KJK A;  5A6K A;  1MEY C;  2L2K B;  1X5W A;  2WBU A;  2JXP A;  2L3C A;  2EM4 A;  2EN2 A;  2DMI A;  1IQS A;  3MSW A;  1YPN A;  2VRD A;  1WJP A;  5A6B D;  2CTD A;  2LVH A;  5TSE A;  4RH8 A;  4JI3 E;  5KL4 A;  2YRM A;  2JPA A;  4LF6 E;  3FIG A;  4BBY A;  4OX9 E;  2EMA A;  2M9A A;  3DF6 A;  3AUZ A;  2V8Q B;  4WXD A;  2Q8U A;  2MDG A;  4O5G A;  4BMJ A;  2NUE A;  3KWR A;  4L5N C;  3HPS A;  2L3J A;  3ECR A;  4DV0 E;  4GEQ B;  1NCS A;  2EM8 A;  2LE2 A;  2YTP A;  4DR2 E;  4I8O A;  5A6B A;  1L4S A;  3JU0 A;  4N4R B;  4P7D A;  1TF3 A;  4X64 E;  1XMQ E;  2JYA A;  2ODR D;  2EJ4 A;  2V85 A;  1I94 E;  4KWY A;  1DI2 A;  3IWD A;  5LMU E;  3EPH A;  4GKK E;  4JI1 E;  3DJW A;  1QU6 A;  1A1H A;  2EM3 A;  2EOO A;  4LF7 E;  2YRH A;  1JK1 A;  1P47 A;  4B3T E;  4GZN C;  4L8N A;  1N36 E;  1XNR E;  2YSP A;  2J7J A;  2DB2 A;  4WPY A;  2JOB A;  2IHR 1;  4WXC A;  2LO3 A;  2EPN A;  2EMY A;  3RMP A;  3BBG A;  3OML A;  3EQ1 A;  4FK5 C;  2L6M A;  4TUG A;  2EQ3 A;  2LUQ A;  5F3W A;  3ADJ A;  1IBK E;  4DV7 E;  4M30 A;  2E5L E;  1YUJ A;  3VHT B;  4BCA A;  2YTO A;  2EOF A;  1N3G A;  2EN8 A;  1EH7 A;  3HTX A;  2MC5 A;  2UXD E;  3TQM A;  2EN7 A;  4ZYG A;  2B9D A;  4B3M E;  2DLK A;  2KOU A;  5FLX C;  2YTN A;  2UUC E;  1ZBT A;  5LLQ A;  4JYA E;  3T1H E;  2JWO A;  2EMZ A;  2YTD A;  4JI4 E;  5BR8 E;  4X65 E;  1B69 A;  2V87 A;  4LF5 E;  1T4O A;  4O4K A;  1KYQ A;  1YZ9 A;  4DR3 E;  1LLM C;  2V86 A;  1UHZ A;  2D9H A;  1EH8 A;  2YRK A;  4DUZ E;  2ENC A;  1X6E A;  1RMD A;  3VK6 A;  2I9I A;  2EN3 A;  3J7A G;  2LCE A;  2EOH A;  2YZT A;  4F6M A;  1TF6 A;  3OTO E;  3MHS C;  4WX9 A;  2L92 A;  1SR9 A;  5ADZ A;  2HHH E;  5IXM B;  4RHB B;  2EPC A;  4K0K E;  2YTG A;  1PKP A;  2CT1 A;  1IBL E;  5AAS A;  4DR4 E;  3F6H A;  1EKZ A;  3THN A;  4R2P A;  2YTI A;  2N3H A;  1UN6 B;  2FV4 B;  3VYX A;  4DV5 E;  2VQF E;  2YTF A;  4X66 E;  2EML A;  2EOY A;  1GQE A;  2V89 A;  3BID A;  2FGG A;  2EPK X;  5LL6 R;  1JK2 A;  1MGT A;  4LF8 E;  2ADR A;  1X3C A;  1X48 A;  3EPK A;  2GLI A;  4NZV A;  4MLQ A;  2M1S A;  2EMC A;  1IQO A;  4DV3 E;  1BBG A;  2LTS A;  4F6N A;  2EPR A;  1HR0 E;  2EPA A;  1HNZ E;  3LML A;  4OOG C;  5KL3 A;  4WSP A;  1G2F C;  1XNQ E;  4J8Z A;  1FJG E;  1PJT A;  4MLV A;  2CPN A;  4WYQ B;  4YHH E;  4R03 A;  2A25 A;  1IMU A;  2RSI A;  3EPL A;  2ELY A;  2EL4 A;  4GKJ E;  2MC6 A;  1WXR A;  4M9V C;  2EN4 A;  4O24 A;  2EOM A;  5KL7 A;  4X62 E;  1AH5 A;  2EOJ A;  2EPX A;  3L00 A;  4M2Z A;  4DUY E;  1X6F A;  2KHX A;  5KL6 A;  2E1M A;  4LFA E;  2LJU A;  2PRT A;  4LFC E;  2EPU A;  1A1G A;  4KHP E;  1N32 E;  4JI5 E;  2F8B A;  3C4T A;  3J80 C;  5AE2 A;  4LF4 E;  4LF9 E;  3F6G A;  1XMO E;  1STU A;  2N8X A;  2EN1 A;  5CFF E;  4IJD A;  2HC5 A;  3C6K A;  1NEI A;  4R2E A;  5KL5 A;  4Q35 B;  4P78 A;  4R2C A;  2NAB A;  3H09 A;  2KON A;  2M4I A;  4X8W A;  1FKA E;  1WRJ A;  1T38 A;  2EL6 A;  5DNY A;  2YPN A;  4JI6 E;  1PJS A;  2EM6 A;  5IWA E;  2EMG A;  1RQ0 A;  1YYW A;  2R1F A;  2ZM6 E;  2YSO A;  2YU5 A;  1J5E E;  1Z1B A;  1BBO A;  1ZBQ A;  2DIX A;  4JI8 E;  4DKK A;  1ZU1 A;  4F9A B;  4Q28 A;  1UIL A;  5A69 A;  2EWL A;  3IWC A;  5IV8 B;  5AC5 A;  2B7V A;  3C6M A;  2YTE A;  3ADG A;  1GTK A;  4B3R E;  2DMY A;  3ADL A;  2RPC A;  3JAM C;  4R2D A;  2MKD A;  2HJJ A;  4DV4 E;  4NXM E;  1RC7 A;  3MHH C;  2EMF A;  4F9C B;  2LUP B;  2EPM X;  2DGC A;  1BB8 A;  2LBS B;  2GPI A;  5A6A A;  3JTZ A;  2EOI A;  2YTJ A;  2YU8 A;  4F2J C;  1A1I A;  1QNT A;  4BC7 A;  2V88 A;  3QG5 C;  1DGC A;  3KZY A;  2R76 A;  2F4V E;  4LU9 A;  5LMN E;  1GZ6 A;  3ZOQ B;  4R2Q A;  2DRP A;  1AAY A;  1O0W A;  4M0V A;  2NUF A;  3HQ1 A;  4F54 A;  2ODR C;  4JI2 E;  2YT4 A;  2UUA E;  1TN9 A;  2WBT A;  4HEI A;  1YYK A;  2RS6 A;  2UXC E;  3J81 C;  2EQ1 A;  1A1F A;  2EM5 A;  3UK3 C;  2YWQ A;  4BHB A;  2EQ0 A;  4BS9 A;  4WSG A;  3BGH A;  2LV2 A;  3KZZ A;  5T6J A;  2H36 X;  2NUG A;  2YTQ A;  2N3G A;  2LRS A;  4R8O A;  4AQY E;  4DR6 E;  1A1L A;  2EE8 A;  2EN6 A;  4ZYH A;  4DR5 E;  2EOX A;  4IS1 C;  1G2D C;  5A6J A;  3C4B A;  2VF1 A;  3T1Y E;  2UXB E;  4KZS A;  2EOQ A;  1A1K A;  2EMI A;  5IT9 C;  2EMH A;  1YYO A;  2FTX B;  4JI0 E;  2RS7 A;  2V83 A;  2BBG A;  4DR7 E;  1DQ3 A;  2JOX A;  4DMI A;  4YY3 E;  4HTG A;  3M99 B;  1J26 A;  2EP3 A;  4JV5 E;  2UUB E;  2L2M A;  2G7H A;  2DSY A;  4R2S A;  2BB8 A;  1T4L B;  2EPO A;  3P1X A;  4DR1 E;  1HNW E;  1SFE A;  2LTR A;  4DV1 E;  2K7I A;  4JI7 E;  3THO B;  1YUI A;  1YSA C;  1X49 A;  4NXN E;  2L2N A;  2VE7 C;  2WZO A;  2LT7 A;  4X9J A;  4TUI A;  2EMX A;  2EPP A;  4BC9 A;  1N33 E;  4ZYD A;  1PJQ A;  4DV6 E;  2EMB A;  3LLH A;  2EZ6 A;  2EM9 A;  2EPZ A;  2WBS A;  2GHF A;  2L33 A;  2JY9 A;  2EOR A;  2RQL A;  2VQE E;  1N34 E;  1X47 A;  3K6Q A;  1IBM E;  3EPJ A;  3IWB A;  2EOE A;  4O43 A;  1UBD C;  4NHR A;  2HGH A; 
#chains in the Genus database with same CATH homology
 2ENH A;  1F2I G;  2GLI A;  1P47 A;  2DGC A;  2I13 A;  1BB8 A;  4GZN C;  2JP9 A;  2EMC A;  2YSP A;  2EOI A;  2EL5 A;  2ENA A;  2YTJ A;  2YU8 A;  4F2J C;  2J7J A;  1A1I A;  4F6N A;  2EOS A;  2EPR A;  2EPA A;  1DGC A;  1ZR9 A;  2LO3 A;  1A1J A;  2HGH A;  2MKN A;  5KL3 A;  4R2Q A;  1G2F C;  2EMY A;  2DRP A;  1AAY A;  2EOZ A;  4FK5 C;  2A25 A;  2RSI A;  2DLQ A;  3EPL A;  2EQ3 A;  2ELY A;  2EL4 A;  2E72 A;  4R2A A;  1TN9 A;  2WBT A;  2EM2 A;  4M9V C;  2EN4 A;  2EOM A;  5KL7 A;  2EOJ A;  4R2R A;  2EPX A;  2EQ1 A;  1A1F A;  2EM5 A;  3UK3 C;  1X6F A;  2EM7 A;  2EMK A;  2EQ0 A;  4WSG A;  5KL6 A;  1YUJ A;  2LV2 A;  3VHT B;  2PRT A;  2EMW A;  2YTQ A;  2EPU A;  1A1G A;  1A1L A;  2EE8 A;  2ELZ A;  2YTO A;  1ZAA C;  2EN6 A;  2EM0 A;  2EOX A;  2EOF A;  4IS1 C;  2EN8 A;  1G2D C;  5KL2 A;  2EN1 A;  2EN7 A;  2CSH A;  4IJD A;  1X6H A;  2WCC 3;  4R2E A;  2DLK A;  2EOQ A;  2YTN A;  5KL5 A;  1A1K A;  4R2C A;  2NAB A;  2EMI A;  1KJK A;  2EMH A;  1MEY C;  2EMZ A;  1X5W A;  2YTD A;  2WBU A;  2EL6 A;  2EM4 A;  3M99 B;  1B69 A;  2EN2 A;  2DMI A;  2EP3 A;  2VRD A;  1WJP A;  2CTD A;  2EM6 A;  4R2S A;  2LVH A;  1LLM C;  2EMG A;  2D9H A;  2R1F A;  2BB8 A;  2YRM A;  2YRK A;  2YSO A;  5KL4 A;  2YU5 A;  2ENC A;  2JPA A;  1X6E A;  1Z1B A;  1RMD A;  2EMA A;  2M9A A;  2EN3 A;  1BBO A;  2MDG A;  2LCE A;  2EOH A;  1YUI A;  4F6M A;  1TF6 A;  1ZU1 A;  1YSA C;  3MHS C;  2LT7 A;  1NCS A;  2EM8 A;  2EPC A;  2YTG A;  4X9J A;  2CT1 A;  2EMX A;  2YTE A;  2YTP A;  2EPP A;  4R2P A;  2YTI A;  1UN6 B;  1TF3 A;  2EMB A;  2RPC A;  4R2D A;  2EM9 A;  2EPZ A;  2EJ4 A;  2YTF A;  2WBS A;  2GHF A;  2MKD A;  2EML A;  2EOY A;  2EOR A;  3EPH A;  1JK2 A;  2ADR A;  3EPJ A;  2EOE A;  3MHH C;  1A1H A;  1X3C A;  2EMF A;  2EM3 A;  2EOO A;  1UBD C;  3EPK A;  2YRH A;  1JK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...