2EMYA

Solution structure of the c2h2 type zinc finger (region 551-583) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGENPYECHECGKAFSRKYQLISHQRTHAGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 551-583) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emyA00
4R2RA 5KL7A 1AAYA 1P47A 2EQ3A 4F6NA 2EM5A 2R1FA 2RSIA 2NABA 1YSAC 2CSHA 1A1JA 3EPLA 5KL3A 2DLQA 4R2QA 2CT1A 1X6FA 5KL2A 2EORA 3EPKA 2I13A 3MHSC 1ZAAC 2EN7A 1A1KA 3MHHC 1TF3A 3EPJA 1JK1A 2YTPA 1DGCA 2DLKA 2LT7A 4F6MA 2EN6A 1TF6A 2JPAA 2EOXA 2GLIA 2EM6A 2EMGA 1X6HA 1X3CA 3M99B 5KL4A 2EPRA 1NCSA 2EN1A 2PRTA 2EE8A 2EMFA 4GZNC 1G2FC 2EOHA 2EQ0A 2EMWA 2VRDA 2EOMA 2EMXA 2EOYA 2YTNA 2ENHA 2M9AA 2EMYA 2EN3A 4IJDA 2EM4A 2WBSA 1A1HA 2YTOA 2EM3A 2RPCA 1RMDA 2EMKA 4R2SA 5KL6A 1X5WA 2YTDA 1UN6B 2ELZA 2ELYA 4R2AA 2HGHA 4R2PA 1WJPA 1A1FA 2EMAA 2EPZA 1ZR9A 2BB8A 1BB8A 1ZU1A 2ADRA 2EP3A 2YRMA 2MKDA 2D9HA 2CTDA 2ENCA 2EOSA 2EOZA 2YU5A 2YTEA 2EPAA 2YU8A 1B69A 1X6EA 1TN9A 1UBDC 1JK2A 2LCEA 1LLMC 2EM8A 2EL6A 4FK5C 2A25A 3VHTB 1YUIA 2EOIA 2YRKA 2YSOA 2DMIA 2EM7A 2YTIA 2DRPA 2MDGA 2EM0A 2DGCA 1BBOA 2EOEA 2EPXA 2GHFA 2YTFA 1KJKA 2ENAA 2EM9A 2WBTA 2EMIA 2YTGA 2YSPA 4R2CA 1G2DC 2EN2A 3EPHA 2EMBA 1Z1BA 1F2IG 2EPPA 2EMLA 1YUJA 4F2JC 2EPUA 2EOJA 4WSGA 2YRHA 2EPCA 2LO3A 2EOFA 2YTJA 4M9VC 4X9JA 2EOOA 2WCC3 4IS1C 1A1IA 1A1LA 2EJ4A 2J7JA 4R2DA 2EN8A 2MKNA 2EN4A 2E72A 4R2EA 2EL4A 2EMHA 5KL5A 2LVHA 2YTQA 2EOQA 2EMZA 2EMCA 2WBUA 2EM2A 2JP9A 2EL5A 2EQ1A 1MEYC 3UK3C 1A1GA 2LV2A
chains in the Genus database with same CATH superfamily
3ECRA 4R2RA 4GKJE 3TQMA 4Q35B 4WFTA 1HNXE 2NA2A 4F6NA 2V8QB 3JU0A 2NABA 1YSAC 2CSHA 1EH6A 2GPIA 2F4VE 4L8NA 4GKKE 2EWLA 3EPJA 2LT7A 2BBGA 1BBGA 2EN6A 1TF6A 2JPAA 2K7IA 3P1XA 2HJJA 3M99B 3F6GA 1NCSA 4DV4E 4GZNC 4LF5E 2EOHA 2EPKX 2V87A 4WXDA 4DV1E 2VRDA 5A6BA 2EOMA 2YTNA 2ENHA 2JVAA 4IJDA 4JI8E 4P78A 2WBSA 5A6KA 2EM3A 3QG5C 1X5WA 2V89A 4DR7E 4R2AA 3VYXA 3C4TA 1WJPA 2JOBA 2EMAA 3JAMC 2BB8A 1A1FA 2L3JA 3F6HA 1ZBQA 4NXNE 4P7DA 2ENCA 2YU5A 3OMLA 4JI3E 2NUGA 1N3GA 4DR4E 4DV2E 4AQYE 3BGHA 1UBDC 2DIXA 1GQEA 2A25A 2DMYA 5IXMB 3VK6A 1T4NA 2L2NA 2MDGA 4M2ZA 3IWBA 4DV6E 2YWQA 3THOB 4DR2E 2EPLX 2EPOA 2LUPB 4JYAE 1KJKA 3C4BA 4ZYHA 4X66E 3J81C 2EMIA 2YTGA 3LMLA 1NEIA 3ADLA 3EPHA 4WPYA 4DR1E 4O43A 2L2KB 1Z1BA 4HTGA 5A69A 1F2IG 4LFBE 1WHNA 4DV5E 2EPUA 4JI7E 4F54A 3HPSA 2YRHA 4LTYA 4WSGA 5LLQA 1SR9A 4KHPE 5F3WA 1PJSA 2KHXA 4KWYA 2EOOA 4JI2E 4ZYDA 3KZYA 2MDRA 4BS9A 5KL5A 4DV3E 2Q8UA 2EM2A 2JP9A 2B9DA 1YYWA 3UK3C 2LJHA 4RHBB 2EPMX 4B3ME 4M0VA 4O5GA 5AE3A 2EM5A 2RSIA 4JI0E 2KONA 2KOUA 1QU6A 4ZYGA 2VE7C 4B3SE 4LFCE 4R2QA 3RMPA 2CT1A 2V86A 1A1KA 4NZVA 1TF3A 4JV5E 1X48A 4F6MA 2DSYA 2EM6A 4BHCA 4LFAE 2YZTA 1QNTA 1J26A 5KL4A 3BIDA 1X49A 2PRTA 2EE8A 2ODRD 1IMUA 1G2FC 2LUQA 2EQ0A 2VQFE 1EKZA 3K6QA 1XNRE 4B3RE 2LTSA 4N4RB 2L3CA 2YTOA 4R2SA 4MLVA 5KL6A 4DR6E 4X64E 2HGHA 2N3GA 2EPZA 1SFEA 2L92A 1ZU1A 2ADRA 2EP3A 2NUFA 2FV4B 2WZOA 2MKDA 2LTRA 2EOSA 2EPAA 4BCAA 4MLQA 1YPNA 2E1MA 1JK2A 2LCEA 1XMOE 2EL6A 4FK5C 1EH8A 1YUIA 2EOIA 1MGTA 4LF8E 3THNA 1EH7A 1BBOA 2JOXA 2EPXA 2WBTA 2JY9A 1T4OA 1DQ3A 2RS7A 1L4SA 2YSPA 5ADZA 4WSPA 5AE2A 1G2DC 4J8ZA 2EN2A 4JI4E 2EMBA 1RC7A 3MSWA 5AC4A 4YY3E 5LMUE 5FLXC 5AC5A 2EOJA 5A2QC 2ODRC 1PJQA 4KZSA 2RS6A 2EPCA 5TSEA 2EPNA 4X9JA 2JR1A 2WCC3 4IS1C 5LMNE 4JI6E 3ADJA 2E72A 2FGGA 4R2EA 1UHZA 2HC5A 2UUCE 3HXLA 2EOQA 2EMZA 2EMCA 2EQ1A 1GZ6A 4X65E 2FTXB 2UXCE 3LLHA 4ZYEA 5KL7A 1AAYA 5A6AA 2UXBE 2EQ3A 2R1FA 2K4VA 4JI1E 1O0WA 3EPLA 3T1YE 2DLQA 2LRSA 5KL2A 2EORA 1ZAAC 2UUAE 3MHHC 2F8BA 4DUYE 2YTPA 1DGCA 2DLKA 3H09A 2EZ6A 1N32E 2YPNA 2EOXA 3DJWA 1X6HA 4O24A 5IWAE 1X3CA 2V88A 4BBYA 2IHR1 4YHHE 2EPRA 3C6KA 1T38A 2B7VA 3J7AG 2YT4A 3AV0A 2EOYA 2EN3A 2EM4A 4BC9A 3IWDA 2RPCA 1RMDA 1N34E 1WXRA 2YTDA 4B3TE 2ELZA 4DR3E 4LU9A 1ZR9A 1J5EE 2D9HA 2CTDA 2EOZA 4DV7E 2UUBE 2YU8A 1B69A 4DR5E 1YYOA 4HEIA 1LLMC 2EM8A 3HPZA 3T1HE 3VHTB 1HR0E 1STUA 2YRKA 2YSOA 2DMIA 2EM7A 2M1SA 2DRPA 2N8XA 2EM0A 1FKAE 1PDAA 2DGCA 2MC6A 5T6JA 2NUEA 2YTFA 2LMZA 2EM9A 2MC5A 2L6MA 1XMQE 1UILA 4R03A 4X8WA 4R2CA 1IBME 3FIGA 1PKPA 1IQSA 1T39A 2DB2A 2EPPA 3BBGA 4F2JC 1XNQE 2VQEE 2VF1A 4O4KA 2EOFA 4LF6E 4R8OA 4M9VC 4GEQB 1HNZE 4DUZE 4WYQB 1I94E 4NHRA 1IBKE 2MKNA 2RQLA 2EN4A 2YTQA 1AH5A 2EL5A 3KWRA 3BF2A 1YFHA 2LV2A 2UU9E 3ADGA 1P47A 2L33A 3J80C 5AE1A 1A1JA 5KL3A 3HQ1A 4BMJA 2H36X 5A6BD 1X6FA 5IV8B 3EPKA 2I13A 3MHSC 3C6MA 2EN7A 3HTXA 2JYAA 5BR8E 1T4LB 1JK1A 5A6JA 2LJUA 4DKKA 4K0KE 1ZBTA 2GLIA 2EMGA 2ZM6E 3ZOQB 2EN1A 1YZ9A 1YYKA 1KYQA 2EMFA 2M4IA 5DNYA 1GTKA 2EMWA 2EMXA 1FJGE 2M9AA 4JI5E 2EMYA 4I8OA 3J7Yp 4BHBA 1A1HA 4F9CB 4TUIA 2EMKA 4RH8A 5LL6R 4NXME 1UN6B 2ELYA 4R2PA 3KZZA 1BB8A 2CPNA 2M7QA 3L00A 2RTXA 4BC7A 4M30A 5AASA 2YRMA 2UXDE 5IT9C 3ADIA 1RQ0A 2YTEA 2JXPA 3VYYA 1X6EA 1TN9A 1HNWE 4TUGA 4X62E 2YTIA 4Q28A 1WHQA 2V83A 2EOEA 2GHFA 2V85A 3DF6A 2JWOA 3EQ1A 2ENAA 2L8TA 2I9IA 2RSMA 2N3HA 1WRJA 3OTOE 4WXCA 1X47A 2E5LE 1N36E 5CFFE 2L2MA 4LF7E 2EMLA 1YUJA 2LBSB 2HHHE 3IWCA 4LF4E 2B7TA 1PJTA 4F9AB 4F9BB 2LO3A 2YTJA 4DV0E 4LF9E 2G7HA 2R76A 4OOGC 1DI2A 1A1IA 1A1LA 2EJ4A 2J7JA 4R2DA 2EN8A 2B3TB 3JTZA 2EL4A 2EMHA 4DMIA 4L5NC 4WX9A 2LVHA 2LE2A 3AUZA 1N33E 2WBUA 4OX9E 1IQOA 1MEYC 1A1GA 1IBLE
chains in the Genus database with same CATH topology
4R2RA 5KL7A 1AAYA 1P47A 2EQ3A 4F6NA 2EM5A 2R1FA 2RSIA 2NABA 1YSAC 2CSHA 1A1JA 3EPLA 5KL3A 2DLQA 4R2QA 2CT1A 1X6FA 5KL2A 2EORA 3EPKA 2I13A 3MHSC 1ZAAC 2EN7A 1A1KA 3MHHC 1TF3A 3EPJA 1JK1A 2YTPA 1DGCA 2DLKA 2LT7A 4F6MA 2EN6A 1TF6A 2JPAA 2EOXA 2GLIA 2EM6A 2EMGA 1X6HA 1X3CA 3M99B 5KL4A 2EPRA 1NCSA 2EN1A 2PRTA 2EE8A 2EMFA 4GZNC 1G2FC 2EOHA 2EQ0A 2EMWA 2VRDA 2EOMA 2EMXA 2EOYA 2YTNA 2ENHA 2M9AA 2EMYA 2EN3A 4IJDA 2EM4A 2WBSA 1A1HA 2YTOA 2EM3A 2RPCA 1RMDA 2EMKA 4R2SA 5KL6A 1X5WA 2YTDA 1UN6B 2ELZA 2ELYA 4R2AA 2HGHA 4R2PA 1WJPA 1A1FA 2EMAA 2EPZA 1ZR9A 2BB8A 1BB8A 1ZU1A 2ADRA 2EP3A 2YRMA 2MKDA 2D9HA 2CTDA 2ENCA 2EOSA 2EOZA 2YU5A 2YTEA 2EPAA 2YU8A 1B69A 1X6EA 1TN9A 1UBDC 1JK2A 2LCEA 1LLMC 2EM8A 2EL6A 4FK5C 2A25A 3VHTB 1YUIA 2EOIA 2YRKA 2YSOA 2DMIA 2EM7A 2YTIA 2DRPA 2MDGA 2EM0A 2DGCA 1BBOA 2EOEA 2EPXA 2GHFA 2YTFA 1KJKA 2ENAA 2EM9A 2WBTA 2EMIA 2YTGA 2YSPA 4R2CA 1G2DC 2EN2A 3EPHA 2EMBA 1Z1BA 1F2IG 2EPPA 2EMLA 1YUJA 4F2JC 2EPUA 2EOJA 4WSGA 2YRHA 2EPCA 2LO3A 2EOFA 2YTJA 4M9VC 4X9JA 2EOOA 2WCC3 4IS1C 1A1IA 1A1LA 2EJ4A 2J7JA 4R2DA 2EN8A 2MKNA 2EN4A 2E72A 4R2EA 2EL4A 2EMHA 5KL5A 2LVHA 2YTQA 2EOQA 2EMZA 2EMCA 2WBUA 2EM2A 2JP9A 2EL5A 2EQ1A 1MEYC 3UK3C 1A1GA 2LV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2R A;  5KL7 A;  1AAY A;  1P47 A;  2EQ3 A;  4F6N A;  2EM5 A;  2R1F A;  2RSI A;  2NAB A;  1YSA C;  2CSH A;  1A1J A;  3EPL A;  5KL3 A;  2DLQ A;  4R2Q A;  2CT1 A;  1X6F A;  5KL2 A;  2EOR A;  3EPK A;  2I13 A;  3MHS C;  1ZAA C;  2EN7 A;  1A1K A;  3MHH C;  1TF3 A;  3EPJ A;  1JK1 A;  2YTP A;  1DGC A;  2DLK A;  2LT7 A;  4F6M A;  2EN6 A;  1TF6 A;  2JPA A;  2EOX A;  2GLI A;  2EM6 A;  2EMG A;  1X6H A;  1X3C A;  3M99 B;  5KL4 A;  2EPR A;  1NCS A;  2EN1 A;  2PRT A;  2EE8 A;  2EMF A;  4GZN C;  1G2F C;  2EOH A;  2EQ0 A;  2EMW A;  2VRD A;  2EOM A;  2EMX A;  2EOY A;  2YTN A;  2ENH A;  2M9A A;  2EMY A;  2EN3 A;  4IJD A;  2EM4 A;  2WBS A;  1A1H A;  2YTO A;  2EM3 A;  2RPC A;  1RMD A;  2EMK A;  4R2S A;  5KL6 A;  1X5W A;  2YTD A;  1UN6 B;  2ELZ A;  2ELY A;  4R2A A;  2HGH A;  4R2P A;  1WJP A;  1A1F A;  2EMA A;  2EPZ A;  1ZR9 A;  2BB8 A;  1BB8 A;  1ZU1 A;  2ADR A;  2EP3 A;  2YRM A;  2MKD A;  2D9H A;  2CTD A;  2ENC A;  2EOS A;  2EOZ A;  2YU5 A;  2YTE A;  2EPA A;  2YU8 A;  1B69 A;  1X6E A;  1TN9 A;  1UBD C;  1JK2 A;  2LCE A;  1LLM C;  2EM8 A;  2EL6 A;  4FK5 C;  2A25 A;  3VHT B;  1YUI A;  2EOI A;  2YRK A;  2YSO A;  2DMI A;  2EM7 A;  2YTI A;  2DRP A;  2MDG A;  2EM0 A;  2DGC A;  1BBO A;  2EOE A;  2EPX A;  2GHF A;  2YTF A;  1KJK A;  2ENA A;  2EM9 A;  2WBT A;  2EMI A;  2YTG A;  2YSP A;  4R2C A;  1G2D C;  2EN2 A;  3EPH A;  2EMB A;  1Z1B A;  1F2I G;  2EPP A;  2EML A;  1YUJ A;  4F2J C;  2EPU A;  2EOJ A;  4WSG A;  2YRH A;  2EPC A;  2LO3 A;  2EOF A;  2YTJ A;  4M9V C;  4X9J A;  2EOO A;  2WCC 3;  4IS1 C;  1A1I A;  1A1L A;  2EJ4 A;  2J7J A;  4R2D A;  2EN8 A;  2MKN A;  2EN4 A;  2E72 A;  4R2E A;  2EL4 A;  2EMH A;  5KL5 A;  2LVH A;  2YTQ A;  2EOQ A;  2EMZ A;  2EMC A;  2WBU A;  2EM2 A;  2JP9 A;  2EL5 A;  2EQ1 A;  1MEY C;  3UK3 C;  1A1G A;  2LV2 A; 
#chains in the Genus database with same CATH topology
 3ECR A;  4R2R A;  4GKJ E;  3TQM A;  4Q35 B;  4WFT A;  1HNX E;  2NA2 A;  4F6N A;  2V8Q B;  3JU0 A;  2NAB A;  1YSA C;  2CSH A;  1EH6 A;  2GPI A;  2F4V E;  4L8N A;  4GKK E;  2EWL A;  3EPJ A;  2LT7 A;  2BBG A;  1BBG A;  2EN6 A;  1TF6 A;  2JPA A;  2K7I A;  3P1X A;  2HJJ A;  3M99 B;  3F6G A;  1NCS A;  4DV4 E;  4GZN C;  4LF5 E;  2EOH A;  2EPK X;  2V87 A;  4WXD A;  4DV1 E;  2VRD A;  5A6B A;  2EOM A;  2YTN A;  2ENH A;  2JVA A;  4IJD A;  4JI8 E;  4P78 A;  2WBS A;  5A6K A;  2EM3 A;  3QG5 C;  1X5W A;  2V89 A;  4DR7 E;  4R2A A;  3VYX A;  3C4T A;  1WJP A;  2JOB A;  2EMA A;  3JAM C;  2BB8 A;  1A1F A;  2L3J A;  3F6H A;  1ZBQ A;  4NXN E;  4P7D A;  2ENC A;  2YU5 A;  3OML A;  4JI3 E;  2NUG A;  1N3G A;  4DR4 E;  4DV2 E;  4AQY E;  3BGH A;  1UBD C;  2DIX A;  1GQE A;  2A25 A;  2DMY A;  5IXM B;  3VK6 A;  1T4N A;  2L2N A;  2MDG A;  4M2Z A;  3IWB A;  4DV6 E;  2YWQ A;  3THO B;  4DR2 E;  2EPL X;  2EPO A;  2LUP B;  4JYA E;  1KJK A;  3C4B A;  4ZYH A;  4X66 E;  3J81 C;  2EMI A;  2YTG A;  3LML A;  1NEI A;  3ADL A;  3EPH A;  4WPY A;  4DR1 E;  4O43 A;  2L2K B;  1Z1B A;  4HTG A;  5A69 A;  1F2I G;  4LFB E;  1WHN A;  4DV5 E;  2EPU A;  4JI7 E;  4F54 A;  3HPS A;  2YRH A;  4LTY A;  4WSG A;  5LLQ A;  1SR9 A;  4KHP E;  5F3W A;  1PJS A;  2KHX A;  4KWY A;  2EOO A;  4JI2 E;  4ZYD A;  3KZY A;  2MDR A;  4BS9 A;  5KL5 A;  4DV3 E;  2Q8U A;  2EM2 A;  2JP9 A;  2B9D A;  1YYW A;  3UK3 C;  2LJH A;  4RHB B;  2EPM X;  4B3M E;  4M0V A;  4O5G A;  5AE3 A;  2EM5 A;  2RSI A;  4JI0 E;  2KON A;  2KOU A;  1QU6 A;  4ZYG A;  2VE7 C;  4B3S E;  4LFC E;  4R2Q A;  3RMP A;  2CT1 A;  2V86 A;  1A1K A;  4NZV A;  1TF3 A;  4JV5 E;  1X48 A;  4F6M A;  2DSY A;  2EM6 A;  4BHC A;  4LFA E;  2YZT A;  1QNT A;  1J26 A;  5KL4 A;  3BID A;  1X49 A;  2PRT A;  2EE8 A;  2ODR D;  1IMU A;  1G2F C;  2LUQ A;  2EQ0 A;  2VQF E;  1EKZ A;  3K6Q A;  1XNR E;  4B3R E;  2LTS A;  4N4R B;  2L3C A;  2YTO A;  4R2S A;  4MLV A;  5KL6 A;  4DR6 E;  4X64 E;  2HGH A;  2N3G A;  2EPZ A;  1SFE A;  2L92 A;  1ZU1 A;  2ADR A;  2EP3 A;  2NUF A;  2FV4 B;  2WZO A;  2MKD A;  2LTR A;  2EOS A;  2EPA A;  4BCA A;  4MLQ A;  1YPN A;  2E1M A;  1JK2 A;  2LCE A;  1XMO E;  2EL6 A;  4FK5 C;  1EH8 A;  1YUI A;  2EOI A;  1MGT A;  4LF8 E;  3THN A;  1EH7 A;  1BBO A;  2JOX A;  2EPX A;  2WBT A;  2JY9 A;  1T4O A;  1DQ3 A;  2RS7 A;  1L4S A;  2YSP A;  5ADZ A;  4WSP A;  5AE2 A;  1G2D C;  4J8Z A;  2EN2 A;  4JI4 E;  2EMB A;  1RC7 A;  3MSW A;  5AC4 A;  4YY3 E;  5LMU E;  5FLX C;  5AC5 A;  2EOJ A;  5A2Q C;  2ODR C;  1PJQ A;  4KZS A;  2RS6 A;  2EPC A;  5TSE A;  2EPN A;  4X9J A;  2JR1 A;  2WCC 3;  4IS1 C;  5LMN E;  4JI6 E;  3ADJ A;  2E72 A;  2FGG A;  4R2E A;  1UHZ A;  2HC5 A;  2UUC E;  3HXL A;  2EOQ A;  2EMZ A;  2EMC A;  2EQ1 A;  1GZ6 A;  4X65 E;  2FTX B;  2UXC E;  3LLH A;  4ZYE A;  5KL7 A;  1AAY A;  5A6A A;  2UXB E;  2EQ3 A;  2R1F A;  2K4V A;  4JI1 E;  1O0W A;  3EPL A;  3T1Y E;  2DLQ A;  2LRS A;  5KL2 A;  2EOR A;  1ZAA C;  2UUA E;  3MHH C;  2F8B A;  4DUY E;  2YTP A;  1DGC A;  2DLK A;  3H09 A;  2EZ6 A;  1N32 E;  2YPN A;  2EOX A;  3DJW A;  1X6H A;  4O24 A;  5IWA E;  1X3C A;  2V88 A;  4BBY A;  2IHR 1;  4YHH E;  2EPR A;  3C6K A;  1T38 A;  2B7V A;  3J7A G;  2YT4 A;  3AV0 A;  2EOY A;  2EN3 A;  2EM4 A;  4BC9 A;  3IWD A;  2RPC A;  1RMD A;  1N34 E;  1WXR A;  2YTD A;  4B3T E;  2ELZ A;  4DR3 E;  4LU9 A;  1ZR9 A;  1J5E E;  2D9H A;  2CTD A;  2EOZ A;  4DV7 E;  2UUB E;  2YU8 A;  1B69 A;  4DR5 E;  1YYO A;  4HEI A;  1LLM C;  2EM8 A;  3HPZ A;  3T1H E;  3VHT B;  1HR0 E;  1STU A;  2YRK A;  2YSO A;  2DMI A;  2EM7 A;  2M1S A;  2DRP A;  2N8X A;  2EM0 A;  1FKA E;  1PDA A;  2DGC A;  2MC6 A;  5T6J A;  2NUE A;  2YTF A;  2LMZ A;  2EM9 A;  2MC5 A;  2L6M A;  1XMQ E;  1UIL A;  4R03 A;  4X8W A;  4R2C A;  1IBM E;  3FIG A;  1PKP A;  1IQS A;  1T39 A;  2DB2 A;  2EPP A;  3BBG A;  4F2J C;  1XNQ E;  2VQE E;  2VF1 A;  4O4K A;  2EOF A;  4LF6 E;  4R8O A;  4M9V C;  4GEQ B;  1HNZ E;  4DUZ E;  4WYQ B;  1I94 E;  4NHR A;  1IBK E;  2MKN A;  2RQL A;  2EN4 A;  2YTQ A;  1AH5 A;  2EL5 A;  3KWR A;  3BF2 A;  1YFH A;  2LV2 A;  2UU9 E;  3ADG A;  1P47 A;  2L33 A;  3J80 C;  5AE1 A;  1A1J A;  5KL3 A;  3HQ1 A;  4BMJ A;  2H36 X;  5A6B D;  1X6F A;  5IV8 B;  3EPK A;  2I13 A;  3MHS C;  3C6M A;  2EN7 A;  3HTX A;  2JYA A;  5BR8 E;  1T4L B;  1JK1 A;  5A6J A;  2LJU A;  4DKK A;  4K0K E;  1ZBT A;  2GLI A;  2EMG A;  2ZM6 E;  3ZOQ B;  2EN1 A;  1YZ9 A;  1YYK A;  1KYQ A;  2EMF A;  2M4I A;  5DNY A;  1GTK A;  2EMW A;  2EMX A;  1FJG E;  2M9A A;  4JI5 E;  2EMY A;  4I8O A;  3J7Y p;  4BHB A;  1A1H A;  4F9C B;  4TUI A;  2EMK A;  4RH8 A;  5LL6 R;  4NXM E;  1UN6 B;  2ELY A;  4R2P A;  3KZZ A;  1BB8 A;  2CPN A;  2M7Q A;  3L00 A;  2RTX A;  4BC7 A;  4M30 A;  5AAS A;  2YRM A;  2UXD E;  5IT9 C;  3ADI A;  1RQ0 A;  2YTE A;  2JXP A;  3VYY A;  1X6E A;  1TN9 A;  1HNW E;  4TUG A;  4X62 E;  2YTI A;  4Q28 A;  1WHQ A;  2V83 A;  2EOE A;  2GHF A;  2V85 A;  3DF6 A;  2JWO A;  3EQ1 A;  2ENA A;  2L8T A;  2I9I A;  2RSM A;  2N3H A;  1WRJ A;  3OTO E;  4WXC A;  1X47 A;  2E5L E;  1N36 E;  5CFF E;  2L2M A;  4LF7 E;  2EML A;  1YUJ A;  2LBS B;  2HHH E;  3IWC A;  4LF4 E;  2B7T A;  1PJT A;  4F9A B;  4F9B B;  2LO3 A;  2YTJ A;  4DV0 E;  4LF9 E;  2G7H A;  2R76 A;  4OOG C;  1DI2 A;  1A1I A;  1A1L A;  2EJ4 A;  2J7J A;  4R2D A;  2EN8 A;  2B3T B;  3JTZ A;  2EL4 A;  2EMH A;  4DMI A;  4L5N C;  4WX9 A;  2LVH A;  2LE2 A;  3AUZ A;  1N33 E;  2WBU A;  4OX9 E;  1IQO A;  1MEY C;  1A1G A;  1IBL E; 
#chains in the Genus database with same CATH homology
 4R2R A;  5KL7 A;  1AAY A;  1P47 A;  2EQ3 A;  4F6N A;  2EM5 A;  2R1F A;  2RSI A;  2NAB A;  1YSA C;  2CSH A;  1A1J A;  3EPL A;  5KL3 A;  2DLQ A;  4R2Q A;  2CT1 A;  1X6F A;  5KL2 A;  2EOR A;  3EPK A;  2I13 A;  3MHS C;  1ZAA C;  2EN7 A;  1A1K A;  3MHH C;  1TF3 A;  3EPJ A;  1JK1 A;  2YTP A;  1DGC A;  2DLK A;  2LT7 A;  4F6M A;  2EN6 A;  1TF6 A;  2JPA A;  2EOX A;  2GLI A;  2EM6 A;  2EMG A;  1X6H A;  1X3C A;  3M99 B;  5KL4 A;  2EPR A;  1NCS A;  2EN1 A;  2PRT A;  2EE8 A;  2EMF A;  4GZN C;  1G2F C;  2EOH A;  2EQ0 A;  2EMW A;  2VRD A;  2EOM A;  2EMX A;  2EOY A;  2YTN A;  2ENH A;  2M9A A;  2EMY A;  2EN3 A;  4IJD A;  2EM4 A;  2WBS A;  1A1H A;  2YTO A;  2EM3 A;  2RPC A;  1RMD A;  2EMK A;  4R2S A;  5KL6 A;  1X5W A;  2YTD A;  1UN6 B;  2ELZ A;  2ELY A;  4R2A A;  2HGH A;  4R2P A;  1WJP A;  1A1F A;  2EMA A;  2EPZ A;  1ZR9 A;  2BB8 A;  1BB8 A;  1ZU1 A;  2ADR A;  2EP3 A;  2YRM A;  2MKD A;  2D9H A;  2CTD A;  2ENC A;  2EOS A;  2EOZ A;  2YU5 A;  2YTE A;  2EPA A;  2YU8 A;  1B69 A;  1X6E A;  1TN9 A;  1UBD C;  1JK2 A;  2LCE A;  1LLM C;  2EM8 A;  2EL6 A;  4FK5 C;  2A25 A;  3VHT B;  1YUI A;  2EOI A;  2YRK A;  2YSO A;  2DMI A;  2EM7 A;  2YTI A;  2DRP A;  2MDG A;  2EM0 A;  2DGC A;  1BBO A;  2EOE A;  2EPX A;  2GHF A;  2YTF A;  1KJK A;  2ENA A;  2EM9 A;  2WBT A;  2EMI A;  2YTG A;  2YSP A;  4R2C A;  1G2D C;  2EN2 A;  3EPH A;  2EMB A;  1Z1B A;  1F2I G;  2EPP A;  2EML A;  1YUJ A;  4F2J C;  2EPU A;  2EOJ A;  4WSG A;  2YRH A;  2EPC A;  2LO3 A;  2EOF A;  2YTJ A;  4M9V C;  4X9J A;  2EOO A;  2WCC 3;  4IS1 C;  1A1I A;  1A1L A;  2EJ4 A;  2J7J A;  4R2D A;  2EN8 A;  2MKN A;  2EN4 A;  2E72 A;  4R2E A;  2EL4 A;  2EMH A;  5KL5 A;  2LVH A;  2YTQ A;  2EOQ A;  2EMZ A;  2EMC A;  2WBU A;  2EM2 A;  2JP9 A;  2EL5 A;  2EQ1 A;  1MEY C;  3UK3 C;  1A1G A;  2LV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...