2EMYA

Solution structure of the c2h2 type zinc finger (region 551-583) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGENPYECHECGKAFSRKYQLISHQRTHAGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 551-583) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emyA00
2EN4A 2EN3A 1A1JA 1AAYA 1KJKA 2EL5A 2LO3A 4R2CA 2EN1A 3MHHC 1A1KA 1NCSA 2EPXA 1BBOA 2CTDA 4R2DA 2DGCA 2EQ1A 2EOZA 3VHTB 2EOSA 2EN8A 1LLMC 2NABA 2YTQA 1ZR9A 4FK5C 2VRDA 1ZAAC 2ADRA 2ENCA 2EM3A 2WBUA 1P47A 2EN7A 1X6HA 3MHSC 2YRKA 2WBSA 4F6MA 4WSGA 2EOFA 2EPZA 4GZNC 2E72A 2LV2A 2I13A 2EN6A 2YU8A 5KL5A 2EQ3A 2WCC3 1RMDA 2MDGA 2EM9A 2PRTA 3EPLA 2EORA 2MKNA 2EJ4A 2YSPA 2BB8A 2EPPA 3UK3C 1Z1BA 3EPHA 1B69A 2EOEA 2EM5A 1UN6B 2YTOA 2HGHA 2GHFA 1JK1A 1A1HA 2A25A 2EMZA 1YUJA 2YTGA 4R2AA 2J7JA 2EMWA 2EPUA 2EOQA 1ZU1A 1X5WA 2RPCA 2EL6A 2EQ0A 2DLKA 2YTEA 2YU5A 2EMFA 2YTNA 2JP9A 1A1GA 2EOOA 4IJDA 4M9VC 2DLQA 4IS1C 5KL2A 2EMHA 2EOXA 1X6FA 2EM7A 2EM2A 2M9AA 4R2PA 4F6NA 2CT1A 2EM8A 2EMIA 1A1LA 2EOYA 2JPAA 1X6EA 4R2QA 2ENHA 2YTIA 2DRPA 2EMCA 2YTPA 1TF6A 1YUIA 1A1FA 2EMYA 2LCEA 2DMIA 2YSOA 2EM6A 2EMAA 2EMKA 4R2SA 2RSIA 1G2FC 2EPAA 1BB8A 2EPCA 1WJPA 2EOIA 1X3CA 2EOMA 2EP3A 1TN9A 2EM0A 4F2JC 1UBDC 2EL4A 4R2RA 1JK2A 4R2EA 5KL7A 4X9JA 1F2IG 2EMBA 3EPJA 2YRHA 2LVHA 5KL4A 2WBTA 1TF3A 1A1IA 2EM4A 2YTJA 2YTFA 2EMGA 1DGCA 2EN2A 2EOJA 2R1FA 5KL6A 2LT7A 2ELZA 2YRMA 1MEYC 2ELYA 3M99B 2EPRA 5KL3A 2D9HA 2MKDA 2EE8A 2EOHA 2YTDA 2ENAA 1G2DC 1YSAC 2EMLA 2EMXA 3EPKA 2GLIA 2CSHA
chains in the Genus database with same CATH superfamily
2VQEE 1KJKA 3HQ1A 3LMLA 2EPKX 2EPXA 4WXDA 1BBOA 3ADIA 2V88A 4YY3E 2CPNA 3VHTB 4X65E 4JI2E 3P1XA 5F3WA 5IXMB 2MC5A 2WBUA 4B3SE 5FLXC 3MHSC 2HC5A 2WBSA 2RTXA 5A69A 3AV0A 4WSGA 2KHXA 4WXCA 1ZBQA 4MLVA 1RMDA 2LBSB 1PDAA 2EPPA 2LRSA 5IT9C 4B3RE 2HGHA 2WZOA 2EMZA 2V89A 1WRJA 3VYYA 4BHBA 2E5LE 2RPCA 2YTEA 3QG5C 2EZ6A 2B7TA 4M9VC 1YYKA 2N3HA 2DLQA 4IS1C 4DV4E 3K6QA 4AQYE 5KL2A 2EMHA 2GPIA 1N34E 2YT4A 4X62E 4DV5E 2EM8A 2Q8UA 1A1LA 1IQOA 3FIGA 4L5NC 3VYXA 2ENHA 4BHCA 4O5GA 2YTIA 1KYQA 2L8TA 2DRPA 1TF6A 1YUIA 3MSWA 1A1FA 4JI3E 2DMIA 2EM6A 4DR4E 4WYQB 4LF8E 4JV5E 1BB8A 2K7IA 1QNTA 3EQ1A 1ZBTA 2L3CA 1T4OA 4BCAA 1AH5A 3IWBA 4JI7E 2EOMA 1FJGE 4LFBE 3OTOE 1HR0E 2B9DA 4OOGC 2KOUA 4F54A 1GQEA 5KL7A 2LVHA 4F9CB 3L00A 2WBTA 4O4KA 2L2NA 2YTJA 5IV8B 3J80C 2EMGA 1DGCA 1N3GA 2L6MA 1O0WA 1J26A 4ZYHA 2ELYA 2UXDE 3M99B 2RQLA 5KL3A 2EE8A 4I8OA 2EOHA 1MGTA 2ENAA 2EN4A 4DR5E 2BBGA 4M30A 3THOB 1IMUA 1EH6A 2EPLX 4GEQB 2YPNA 4JI8E 4NHRA 2CTDA 1SR9A 2NUEA 2DGCA 2EQ1A 2EOZA 4KWYA 2EOSA 2YTQA 2HHHE 1ZAAC 2ENCA 1J5EE 2M1SA 2JYAA 1EH7A 4NXME 4LF4E 2UXCE 1NEIA 2I9IA 3BGHA 4LU9A 4DR2E 2JOXA 2JR1A 2E72A 1XNRE 2LV2A 4JI1E 2MDRA 4LF9E 2UUBE 2LJHA 2WCC3 3DJWA 2NUGA 2ZM6E 2MDGA 3C4TA 2L33A 2BB8A 1IBME 3UK3C 3EPHA 2EM5A 2KONA 2GHFA 1JK1A 1A1HA 3T1YE 2YTGA 2J7JA 4M0VA 1YPNA 4JI0E 4OX9E 1ZU1A 2YU5A 3KZZA 2YTNA 2JOBA 2JP9A 2EOOA 4YHHE 1DI2A 3H09A 1N33E 1X49A 1T38A 1XNQE 1X6FA 3J81C 4DV0E 5LL6R 2UXBE 4WFTA 4F6NA 4DV1E 2M4IA 2CT1A 1X6EA 2B7VA 4R2QA 3LLHA 4WSPA 4LFCE 3BBGA 1IBKE 2EMAA 2EMKA 4R2SA 4JI6E 2RSIA 1G2FC 4DV7E 3HTXA 2EOIA 5ADZA 2VQFE 3JTZA 4R2RA 1JK2A 2RSMA 2HJJA 4R2EA 5IWAE 4DKKA 2UU9E 2M7QA 2FTXB 2YRHA 3AUZA 5KL4A 1T4NA 1TF3A 4DR7E 2LTSA 2YTFA 3JAMC 1DQ3A 2EN2A 2RS6A 1GZ6A 2LT7A 2ELZA 5T6JA 4M2ZA 1MEYC 3VK6A 4BC7A 2EPRA 1YZ9A 2JY9A 2YTDA 4Q35B 1XMQE 1HNXE 1YSAC 2GLIA 3EPKA 1HNWE 2CSHA 3C6MA 2DIXA 2EN3A 1A1JA 1AAYA 2EL5A 2LO3A 2UUCE 2EN1A 3MHHC 1PJQA 4LF6E 1PKPA 4F9AB 5LLQA 2L3JA 4DR6E 3F6GA 2F8BA 3KZYA 2EN8A 1LLMC 2NABA 4GKJE 1ZR9A 4FK5C 3C4BA 3J7Yp 1WXRA 2EN7A 2RS7A 5LMUE 5BR8E 4DR3E 1X47A 5AE1A 4ZYGA 2EPZA 5LMNE 2I13A 2EN6A 3KWRA 1I94E 4R8OA 1FKAE 5KL5A 2EQ3A 2G7HA 2EM9A 2JWOA 3EPLA 4ZYEA 4KZSA 4WX9A 2EORA 2YSPA 1Z1BA 3DF6A 4DV2E 1UN6B 2F4VE 2YTOA 3ADGA 3C6KA 4O43A 5AC5A 2L92A 2N8XA 4LF7E 3ADJA 2V83A 2EPUA 5A6BA 2K4VA 2DMYA 1X5WA 2LMZA 2FV4B 2DLKA 5A6KA 4TUGA 2EMFA 1N32E 1A1GA 2FGGA 2IHR1 2EOXA 2EM2A 3ECRA 5A6AA 4BMJA 3T1HE 2EOYA 2YWQA 1UHZA 1XMOE 1QU6A 1IBLE 1HNZE 2V85A 4HTGA 2V86A 2EMCA 2YTPA 3JU0A 4P78A 2LCEA 5A2QC 2H36X 4B3ME 4K0KE 4GKKE 2EPAA 2ODRC 1YFHA 4P7DA 2L2MA 2N3GA 3IWCA 4KHPE 4BS9A 4Q28A 3HPZA 2EP3A 2VF1A 3BF2A 2EM0A 1SFEA 1EH8A 4F2JC 1UBDC 5DNYA 4DUYE 4DV6E 2YZTA 1T39A 1T4LB 2EMBA 1UILA 2VE7C 4X8WA 4BC9A 5A6JA 5AC4A 1A1IA 2EM4A 3TQMA 1RC7A 4NZVA 1EKZA 2EOJA 1STUA 2R1FA 4X64E 5CFFE 3RMPA 1BBGA 5AE3A 2MKDA 4DR1E 2LJUA 1G2DC 4DV3E 4F6MA 3F6HA 5A6BD 2EPOA 3ZOQB 4LF5E 2MC6A 4R2CA 4DMIA 5TSEA 1A1KA 1NCSA 2JVAA 1PJSA 4R2DA 2JXPA 4BBYA 1L4SA 3J7AG 2VRDA 2EPMX 2ADRA 2EM3A 1P47A 4TUIA 2LUQA 4LFAE 3ADLA 1X6HA 2YRKA 2EOFA 4GZNC 4DUZE 2YU8A 2LUPB 2PRTA 3BIDA 5AE2A 2MKNA 2EJ4A 5AASA 4LTYA 4RHBB 1B69A 2EOEA 1YUJA 2A25A 4R2AA 4JYAE 4HEIA 2EMWA 2EOQA 1YYOA 2EL6A 2EQ0A 1PJTA 4JI5E 1RQ0A 4X66E 2V8QB 4ZYDA 1YYWA 4IJDA 2L2KB 1X48A 2R76A 3HPSA 4J8ZA 2EM7A 2M9AA 4R2PA 2EMIA 2JPAA 2NUFA 4WPYA 2V87A 2LE2A 4NXNE 3HXLA 2EMYA 2YSOA 4O24A 4B3TE 2DB2A 4MLQA 4F9BB 2NA2A 2DSYA 2EPCA 1WJPA 4JI4E 4L8NA 2EWLA 1X3CA 2UUAE 2EPNA 3IWDA 3THNA 1TN9A 2EL4A 4RH8A 3OMLA 1WHQA 2B3TB 4X9JA 1F2IG 3EPJA 5KL6A 2E1MA 1N36E 2ODRD 2YRMA 2D9HA 1GTKA 1WHNA 4R03A 2EMLA 2EMXA 2LTRA 4N4RB 1IQSA
chains in the Genus database with same CATH topology
2EN4A 2EN3A 1A1JA 1AAYA 1KJKA 2EL5A 2LO3A 4R2CA 2EN1A 3MHHC 1A1KA 1NCSA 2EPXA 1BBOA 2CTDA 4R2DA 2DGCA 2EQ1A 2EOZA 3VHTB 2EOSA 2EN8A 1LLMC 2NABA 2YTQA 1ZR9A 4FK5C 2VRDA 1ZAAC 2ADRA 2ENCA 2EM3A 2WBUA 1P47A 2EN7A 1X6HA 3MHSC 2YRKA 2WBSA 4F6MA 4WSGA 2EOFA 2EPZA 4GZNC 2E72A 2LV2A 2I13A 2EN6A 2YU8A 5KL5A 2EQ3A 2WCC3 1RMDA 2MDGA 2EM9A 2PRTA 3EPLA 2EORA 2MKNA 2EJ4A 2YSPA 2BB8A 2EPPA 3UK3C 1Z1BA 3EPHA 1B69A 2EOEA 2EM5A 1UN6B 2YTOA 2HGHA 2GHFA 1JK1A 1A1HA 2A25A 2EMZA 1YUJA 2YTGA 4R2AA 2J7JA 2EMWA 2EPUA 2EOQA 1ZU1A 1X5WA 2RPCA 2EL6A 2EQ0A 2DLKA 2YTEA 2YU5A 2EMFA 2YTNA 2JP9A 1A1GA 2EOOA 4IJDA 4M9VC 2DLQA 4IS1C 5KL2A 2EMHA 2EOXA 1X6FA 2EM7A 2EM2A 2M9AA 4R2PA 4F6NA 2CT1A 2EM8A 2EMIA 1A1LA 2EOYA 2JPAA 1X6EA 4R2QA 2ENHA 2YTIA 2DRPA 2EMCA 2YTPA 1TF6A 1YUIA 1A1FA 2EMYA 2LCEA 2DMIA 2YSOA 2EM6A 2EMAA 2EMKA 4R2SA 2RSIA 1G2FC 2EPAA 1BB8A 2EPCA 1WJPA 2EOIA 1X3CA 2EOMA 2EP3A 1TN9A 2EM0A 4F2JC 1UBDC 2EL4A 4R2RA 1JK2A 4R2EA 5KL7A 4X9JA 1F2IG 2EMBA 3EPJA 2YRHA 2LVHA 5KL4A 2WBTA 1TF3A 1A1IA 2EM4A 2YTJA 2YTFA 2EMGA 1DGCA 2EN2A 2EOJA 2R1FA 5KL6A 2LT7A 2ELZA 2YRMA 1MEYC 2ELYA 3M99B 2EPRA 5KL3A 2D9HA 2MKDA 2EE8A 2EOHA 2YTDA 2ENAA 1G2DC 1YSAC 2EMLA 2EMXA 3EPKA 2GLIA 2CSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN4 A;  2EN3 A;  1A1J A;  1AAY A;  1KJK A;  2EL5 A;  2LO3 A;  4R2C A;  2EN1 A;  3MHH C;  1A1K A;  1NCS A;  2EPX A;  1BBO A;  2CTD A;  4R2D A;  2DGC A;  2EQ1 A;  2EOZ A;  3VHT B;  2EOS A;  2EN8 A;  1LLM C;  2NAB A;  2YTQ A;  1ZR9 A;  4FK5 C;  2VRD A;  1ZAA C;  2ADR A;  2ENC A;  2EM3 A;  2WBU A;  1P47 A;  2EN7 A;  1X6H A;  3MHS C;  2YRK A;  2WBS A;  4F6M A;  4WSG A;  2EOF A;  2EPZ A;  4GZN C;  2E72 A;  2LV2 A;  2I13 A;  2EN6 A;  2YU8 A;  5KL5 A;  2EQ3 A;  2WCC 3;  1RMD A;  2MDG A;  2EM9 A;  2PRT A;  3EPL A;  2EOR A;  2MKN A;  2EJ4 A;  2YSP A;  2BB8 A;  2EPP A;  3UK3 C;  1Z1B A;  3EPH A;  1B69 A;  2EOE A;  2EM5 A;  1UN6 B;  2YTO A;  2HGH A;  2GHF A;  1JK1 A;  1A1H A;  2A25 A;  2EMZ A;  1YUJ A;  2YTG A;  4R2A A;  2J7J A;  2EMW A;  2EPU A;  2EOQ A;  1ZU1 A;  1X5W A;  2RPC A;  2EL6 A;  2EQ0 A;  2DLK A;  2YTE A;  2YU5 A;  2EMF A;  2YTN A;  2JP9 A;  1A1G A;  2EOO A;  4IJD A;  4M9V C;  2DLQ A;  4IS1 C;  5KL2 A;  2EMH A;  2EOX A;  1X6F A;  2EM7 A;  2EM2 A;  2M9A A;  4R2P A;  4F6N A;  2CT1 A;  2EM8 A;  2EMI A;  1A1L A;  2EOY A;  2JPA A;  1X6E A;  4R2Q A;  2ENH A;  2YTI A;  2DRP A;  2EMC A;  2YTP A;  1TF6 A;  1YUI A;  1A1F A;  2EMY A;  2LCE A;  2DMI A;  2YSO A;  2EM6 A;  2EMA A;  2EMK A;  4R2S A;  2RSI A;  1G2F C;  2EPA A;  1BB8 A;  2EPC A;  1WJP A;  2EOI A;  1X3C A;  2EOM A;  2EP3 A;  1TN9 A;  2EM0 A;  4F2J C;  1UBD C;  2EL4 A;  4R2R A;  1JK2 A;  4R2E A;  5KL7 A;  4X9J A;  1F2I G;  2EMB A;  3EPJ A;  2YRH A;  2LVH A;  5KL4 A;  2WBT A;  1TF3 A;  1A1I A;  2EM4 A;  2YTJ A;  2YTF A;  2EMG A;  1DGC A;  2EN2 A;  2EOJ A;  2R1F A;  5KL6 A;  2LT7 A;  2ELZ A;  2YRM A;  1MEY C;  2ELY A;  3M99 B;  2EPR A;  5KL3 A;  2D9H A;  2MKD A;  2EE8 A;  2EOH A;  2YTD A;  2ENA A;  1G2D C;  1YSA C;  2EML A;  2EMX A;  3EPK A;  2GLI A;  2CSH A; 
#chains in the Genus database with same CATH topology
 2VQE E;  1KJK A;  3HQ1 A;  3LML A;  2EPK X;  2EPX A;  4WXD A;  1BBO A;  3ADI A;  2V88 A;  4YY3 E;  2CPN A;  3VHT B;  4X65 E;  4JI2 E;  3P1X A;  5F3W A;  5IXM B;  2MC5 A;  2WBU A;  4B3S E;  5FLX C;  3MHS C;  2HC5 A;  2WBS A;  2RTX A;  5A69 A;  3AV0 A;  4WSG A;  2KHX A;  4WXC A;  1ZBQ A;  4MLV A;  1RMD A;  2LBS B;  1PDA A;  2EPP A;  2LRS A;  5IT9 C;  4B3R E;  2HGH A;  2WZO A;  2EMZ A;  2V89 A;  1WRJ A;  3VYY A;  4BHB A;  2E5L E;  2RPC A;  2YTE A;  3QG5 C;  2EZ6 A;  2B7T A;  4M9V C;  1YYK A;  2N3H A;  2DLQ A;  4IS1 C;  4DV4 E;  3K6Q A;  4AQY E;  5KL2 A;  2EMH A;  2GPI A;  1N34 E;  2YT4 A;  4X62 E;  4DV5 E;  2EM8 A;  2Q8U A;  1A1L A;  1IQO A;  3FIG A;  4L5N C;  3VYX A;  2ENH A;  4BHC A;  4O5G A;  2YTI A;  1KYQ A;  2L8T A;  2DRP A;  1TF6 A;  1YUI A;  3MSW A;  1A1F A;  4JI3 E;  2DMI A;  2EM6 A;  4DR4 E;  4WYQ B;  4LF8 E;  4JV5 E;  1BB8 A;  2K7I A;  1QNT A;  3EQ1 A;  1ZBT A;  2L3C A;  1T4O A;  4BCA A;  1AH5 A;  3IWB A;  4JI7 E;  2EOM A;  1FJG E;  4LFB E;  3OTO E;  1HR0 E;  2B9D A;  4OOG C;  2KOU A;  4F54 A;  1GQE A;  5KL7 A;  2LVH A;  4F9C B;  3L00 A;  2WBT A;  4O4K A;  2L2N A;  2YTJ A;  5IV8 B;  3J80 C;  2EMG A;  1DGC A;  1N3G A;  2L6M A;  1O0W A;  1J26 A;  4ZYH A;  2ELY A;  2UXD E;  3M99 B;  2RQL A;  5KL3 A;  2EE8 A;  4I8O A;  2EOH A;  1MGT A;  2ENA A;  2EN4 A;  4DR5 E;  2BBG A;  4M30 A;  3THO B;  1IMU A;  1EH6 A;  2EPL X;  4GEQ B;  2YPN A;  4JI8 E;  4NHR A;  2CTD A;  1SR9 A;  2NUE A;  2DGC A;  2EQ1 A;  2EOZ A;  4KWY A;  2EOS A;  2YTQ A;  2HHH E;  1ZAA C;  2ENC A;  1J5E E;  2M1S A;  2JYA A;  1EH7 A;  4NXM E;  4LF4 E;  2UXC E;  1NEI A;  2I9I A;  3BGH A;  4LU9 A;  4DR2 E;  2JOX A;  2JR1 A;  2E72 A;  1XNR E;  2LV2 A;  4JI1 E;  2MDR A;  4LF9 E;  2UUB E;  2LJH A;  2WCC 3;  3DJW A;  2NUG A;  2ZM6 E;  2MDG A;  3C4T A;  2L33 A;  2BB8 A;  1IBM E;  3UK3 C;  3EPH A;  2EM5 A;  2KON A;  2GHF A;  1JK1 A;  1A1H A;  3T1Y E;  2YTG A;  2J7J A;  4M0V A;  1YPN A;  4JI0 E;  4OX9 E;  1ZU1 A;  2YU5 A;  3KZZ A;  2YTN A;  2JOB A;  2JP9 A;  2EOO A;  4YHH E;  1DI2 A;  3H09 A;  1N33 E;  1X49 A;  1T38 A;  1XNQ E;  1X6F A;  3J81 C;  4DV0 E;  5LL6 R;  2UXB E;  4WFT A;  4F6N A;  4DV1 E;  2M4I A;  2CT1 A;  1X6E A;  2B7V A;  4R2Q A;  3LLH A;  4WSP A;  4LFC E;  3BBG A;  1IBK E;  2EMA A;  2EMK A;  4R2S A;  4JI6 E;  2RSI A;  1G2F C;  4DV7 E;  3HTX A;  2EOI A;  5ADZ A;  2VQF E;  3JTZ A;  4R2R A;  1JK2 A;  2RSM A;  2HJJ A;  4R2E A;  5IWA E;  4DKK A;  2UU9 E;  2M7Q A;  2FTX B;  2YRH A;  3AUZ A;  5KL4 A;  1T4N A;  1TF3 A;  4DR7 E;  2LTS A;  2YTF A;  3JAM C;  1DQ3 A;  2EN2 A;  2RS6 A;  1GZ6 A;  2LT7 A;  2ELZ A;  5T6J A;  4M2Z A;  1MEY C;  3VK6 A;  4BC7 A;  2EPR A;  1YZ9 A;  2JY9 A;  2YTD A;  4Q35 B;  1XMQ E;  1HNX E;  1YSA C;  2GLI A;  3EPK A;  1HNW E;  2CSH A;  3C6M A;  2DIX A;  2EN3 A;  1A1J A;  1AAY A;  2EL5 A;  2LO3 A;  2UUC E;  2EN1 A;  3MHH C;  1PJQ A;  4LF6 E;  1PKP A;  4F9A B;  5LLQ A;  2L3J A;  4DR6 E;  3F6G A;  2F8B A;  3KZY A;  2EN8 A;  1LLM C;  2NAB A;  4GKJ E;  1ZR9 A;  4FK5 C;  3C4B A;  3J7Y p;  1WXR A;  2EN7 A;  2RS7 A;  5LMU E;  5BR8 E;  4DR3 E;  1X47 A;  5AE1 A;  4ZYG A;  2EPZ A;  5LMN E;  2I13 A;  2EN6 A;  3KWR A;  1I94 E;  4R8O A;  1FKA E;  5KL5 A;  2EQ3 A;  2G7H A;  2EM9 A;  2JWO A;  3EPL A;  4ZYE A;  4KZS A;  4WX9 A;  2EOR A;  2YSP A;  1Z1B A;  3DF6 A;  4DV2 E;  1UN6 B;  2F4V E;  2YTO A;  3ADG A;  3C6K A;  4O43 A;  5AC5 A;  2L92 A;  2N8X A;  4LF7 E;  3ADJ A;  2V83 A;  2EPU A;  5A6B A;  2K4V A;  2DMY A;  1X5W A;  2LMZ A;  2FV4 B;  2DLK A;  5A6K A;  4TUG A;  2EMF A;  1N32 E;  1A1G A;  2FGG A;  2IHR 1;  2EOX A;  2EM2 A;  3ECR A;  5A6A A;  4BMJ A;  3T1H E;  2EOY A;  2YWQ A;  1UHZ A;  1XMO E;  1QU6 A;  1IBL E;  1HNZ E;  2V85 A;  4HTG A;  2V86 A;  2EMC A;  2YTP A;  3JU0 A;  4P78 A;  2LCE A;  5A2Q C;  2H36 X;  4B3M E;  4K0K E;  4GKK E;  2EPA A;  2ODR C;  1YFH A;  4P7D A;  2L2M A;  2N3G A;  3IWC A;  4KHP E;  4BS9 A;  4Q28 A;  3HPZ A;  2EP3 A;  2VF1 A;  3BF2 A;  2EM0 A;  1SFE A;  1EH8 A;  4F2J C;  1UBD C;  5DNY A;  4DUY E;  4DV6 E;  2YZT A;  1T39 A;  1T4L B;  2EMB A;  1UIL A;  2VE7 C;  4X8W A;  4BC9 A;  5A6J A;  5AC4 A;  1A1I A;  2EM4 A;  3TQM A;  1RC7 A;  4NZV A;  1EKZ A;  2EOJ A;  1STU A;  2R1F A;  4X64 E;  5CFF E;  3RMP A;  1BBG A;  5AE3 A;  2MKD A;  4DR1 E;  2LJU A;  1G2D C;  4DV3 E;  4F6M A;  3F6H A;  5A6B D;  2EPO A;  3ZOQ B;  4LF5 E;  2MC6 A;  4R2C A;  4DMI A;  5TSE A;  1A1K A;  1NCS A;  2JVA A;  1PJS A;  4R2D A;  2JXP A;  4BBY A;  1L4S A;  3J7A G;  2VRD A;  2EPM X;  2ADR A;  2EM3 A;  1P47 A;  4TUI A;  2LUQ A;  4LFA E;  3ADL A;  1X6H A;  2YRK A;  2EOF A;  4GZN C;  4DUZ E;  2YU8 A;  2LUP B;  2PRT A;  3BID A;  5AE2 A;  2MKN A;  2EJ4 A;  5AAS A;  4LTY A;  4RHB B;  1B69 A;  2EOE A;  1YUJ A;  2A25 A;  4R2A A;  4JYA E;  4HEI A;  2EMW A;  2EOQ A;  1YYO A;  2EL6 A;  2EQ0 A;  1PJT A;  4JI5 E;  1RQ0 A;  4X66 E;  2V8Q B;  4ZYD A;  1YYW A;  4IJD A;  2L2K B;  1X48 A;  2R76 A;  3HPS A;  4J8Z A;  2EM7 A;  2M9A A;  4R2P A;  2EMI A;  2JPA A;  2NUF A;  4WPY A;  2V87 A;  2LE2 A;  4NXN E;  3HXL A;  2EMY A;  2YSO A;  4O24 A;  4B3T E;  2DB2 A;  4MLQ A;  4F9B B;  2NA2 A;  2DSY A;  2EPC A;  1WJP A;  4JI4 E;  4L8N A;  2EWL A;  1X3C A;  2UUA E;  2EPN A;  3IWD A;  3THN A;  1TN9 A;  2EL4 A;  4RH8 A;  3OML A;  1WHQ A;  2B3T B;  4X9J A;  1F2I G;  3EPJ A;  5KL6 A;  2E1M A;  1N36 E;  2ODR D;  2YRM A;  2D9H A;  1GTK A;  1WHN A;  4R03 A;  2EML A;  2EMX A;  2LTR A;  4N4R B;  1IQS A; 
#chains in the Genus database with same CATH homology
 2EN4 A;  2EN3 A;  1A1J A;  1AAY A;  1KJK A;  2EL5 A;  2LO3 A;  4R2C A;  2EN1 A;  3MHH C;  1A1K A;  1NCS A;  2EPX A;  1BBO A;  2CTD A;  4R2D A;  2DGC A;  2EQ1 A;  2EOZ A;  3VHT B;  2EOS A;  2EN8 A;  1LLM C;  2NAB A;  2YTQ A;  1ZR9 A;  4FK5 C;  2VRD A;  1ZAA C;  2ADR A;  2ENC A;  2EM3 A;  2WBU A;  1P47 A;  2EN7 A;  1X6H A;  3MHS C;  2YRK A;  2WBS A;  4F6M A;  4WSG A;  2EOF A;  2EPZ A;  4GZN C;  2E72 A;  2LV2 A;  2I13 A;  2EN6 A;  2YU8 A;  5KL5 A;  2EQ3 A;  2WCC 3;  1RMD A;  2MDG A;  2EM9 A;  2PRT A;  3EPL A;  2EOR A;  2MKN A;  2EJ4 A;  2YSP A;  2BB8 A;  2EPP A;  3UK3 C;  1Z1B A;  3EPH A;  1B69 A;  2EOE A;  2EM5 A;  1UN6 B;  2YTO A;  2HGH A;  2GHF A;  1JK1 A;  1A1H A;  2A25 A;  2EMZ A;  1YUJ A;  2YTG A;  4R2A A;  2J7J A;  2EMW A;  2EPU A;  2EOQ A;  1ZU1 A;  1X5W A;  2RPC A;  2EL6 A;  2EQ0 A;  2DLK A;  2YTE A;  2YU5 A;  2EMF A;  2YTN A;  2JP9 A;  1A1G A;  2EOO A;  4IJD A;  4M9V C;  2DLQ A;  4IS1 C;  5KL2 A;  2EMH A;  2EOX A;  1X6F A;  2EM7 A;  2EM2 A;  2M9A A;  4R2P A;  4F6N A;  2CT1 A;  2EM8 A;  2EMI A;  1A1L A;  2EOY A;  2JPA A;  1X6E A;  4R2Q A;  2ENH A;  2YTI A;  2DRP A;  2EMC A;  2YTP A;  1TF6 A;  1YUI A;  1A1F A;  2EMY A;  2LCE A;  2DMI A;  2YSO A;  2EM6 A;  2EMA A;  2EMK A;  4R2S A;  2RSI A;  1G2F C;  2EPA A;  1BB8 A;  2EPC A;  1WJP A;  2EOI A;  1X3C A;  2EOM A;  2EP3 A;  1TN9 A;  2EM0 A;  4F2J C;  1UBD C;  2EL4 A;  4R2R A;  1JK2 A;  4R2E A;  5KL7 A;  4X9J A;  1F2I G;  2EMB A;  3EPJ A;  2YRH A;  2LVH A;  5KL4 A;  2WBT A;  1TF3 A;  1A1I A;  2EM4 A;  2YTJ A;  2YTF A;  2EMG A;  1DGC A;  2EN2 A;  2EOJ A;  2R1F A;  5KL6 A;  2LT7 A;  2ELZ A;  2YRM A;  1MEY C;  2ELY A;  3M99 B;  2EPR A;  5KL3 A;  2D9H A;  2MKD A;  2EE8 A;  2EOH A;  2YTD A;  2ENA A;  1G2D C;  1YSA C;  2EML A;  2EMX A;  3EPK A;  2GLI A;  2CSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...