2EMYA

Solution structure of the c2h2 type zinc finger (region 551-583) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGENPYECHECGKAFSRKYQLISHQRTHAGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 551-583) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emyA00
2YTGA 1WJPA 2EOZA 2DLKA 2EMXA 2EN2A 4F6NA 2EOXA 1UN6B 2R1FA 2EMCA 1YUIA 3MHHC 2YTFA 2CTDA 2YU5A 1A1GA 4GZNC 1F2IG 2EMHA 2EOMA 2YTEA 2DGCA 2EJ4A 2ELZA 2MDGA 2EMGA 2EMZA 2EOEA 1G2FC 3EPLA 2LCEA 2YTNA 2WBSA 4IJDA 2YRMA 2EOJA 2CT1A 2DMIA 2BB8A 2LO3A 1X6EA 4R2RA 1X6HA 2JPAA 2EL6A 4FK5C 2RSIA 1G2DC 3EPHA 2EL4A 1DGCA 2D9HA 2ELYA 1NCSA 2YTIA 2ENCA 2YTQA 2GHFA 1UBDC 2VRDA 1X5WA 2EMAA 2M9AA 2EMBA 2E72A 2YU8A 1TN9A 2EQ3A 4R2SA 2EM3A 2YTJA 2LV2A 5KL2A 2EL5A 1ZAAC 1RMDA 2LVHA 3M99B 5KL3A 3EPKA 1KJKA 2EPUA 2EPCA 1B69A 1AAYA 4R2AA 2WCC3 2EORA 1TF6A 1ZR9A 2YTDA 2EN4A 4F2JC 2DLQA 1YUJA 2EMKA 1A1HA 4R2DA 3MHSC 1LLMC 1A1LA 4M9VC 2EM5A 2EP3A 5KL4A 2WBUA 2EN1A 1TF3A 4R2PA 1A1JA 1BB8A 4WSGA 1Z1BA 2EM6A 2EM0A 1P47A 2EMYA 1X6FA 2EPXA 3EPJA 1A1IA 3VHTB 5KL5A 2EPZA 2J7JA 3UK3C 2EM8A 1X3CA 4X9JA 1BBOA 2EOHA 2EM9A 2EPAA 2ENHA 2JP9A 2EM7A 2ENAA 2LT7A 2MKDA 2EQ0A 4F6MA 2ADRA 2GLIA 2EE8A 2YRHA 4IS1C 1JK2A 4R2QA 2CSHA 2RPCA 1MEYC 1A1KA 2I13A 4R2CA 2YSPA 2EQ1A 2HGHA 2EOSA 2WBTA 2EPPA 2EM2A 2EOQA 2EN3A 2EOOA 1A1FA 2EMWA 2MKNA 4R2EA 2EOIA 1YSAC 2DRPA 2PRTA 2EOFA 2EN8A 1ZU1A 2EN6A 2EOYA 2EMFA 2YTPA 5KL7A 2A25A 2EM4A 2YSOA 2YTOA 2EMIA 2NABA 1JK1A 2YRKA 2EPRA 2EN7A 2EMLA 5KL6A
chains in the Genus database with same CATH superfamily
2EOZA 2EMXA 2L6MA 4MLVA 4F6NA 2EOXA 1UN6B 1EH6A 2CTDA 1WXRA 3BF2A 2YU5A 2N3HA 1DI2A 1HNZE 2B3TB 2ELZA 1NEIA 4B3ME 1N3GA 1XNQE 2LCEA 2YTNA 2WBSA 3AV0A 4WXDA 2DMIA 3C4BA 1X6HA 5DNYA 4FK5C 2RSIA 2HHHE 3JTZA 2NUEA 4HEIA 2LTSA 3EQ1A 4Q28A 2VRDA 1X5WA 2M9AA 1TN9A 2EQ3A 2L3JA 1MGTA 4RH8A 3EPKA 1KJKA 4BHCA 1RQ0A 1TF6A 4JI1E 1XMOE 3IWBA 3LMLA 2EMKA 1A1HA 3HTXA 3MHSC 3THNA 2L33A 5IT9C 2VF1A 4LF4E 2RS7A 4B3RE 4TUGA 1BB8A 2JOBA 2EM6A 1P47A 4B3SE 2JXPA 2K4VA 5ADZA 3F6HA 3H09A 2M1SA 2N3GA 2EPZA 2J7JA 3UK3C 3IWCA 1T38A 5A6BD 1GTKA 2EOHA 1HNWE 4LU9A 2EPMX 2DB2A 2L2MA 2MKDA 4ZYGA 3L00A 2EE8A 1IQSA 2YRHA 3LLHA 4DKKA 4LF9E 3P1XA 2CSHA 3J81C 1BBGA 2IHR1 4DR3E 2VQEE 1MEYC 4NHRA 1IBLE 4R2CA 3J80C 1GZ6A 3QG5C 2YSPA 4GKJE 4JI2E 5LL6R 3JU0A 2DRPA 4BCAA 3KZYA 1ZU1A 1UILA 2EN6A 2EOYA 4K0KE 2EPLX 2A25A 3HPSA 4KWYA 2EM4A 4ZYHA 4NZVA 2UXCE 1SFEA 2VE7C 2JYAA 5LMUE 2LE2A 2ODRD 4BHBA 2EPRA 1J5EE 2YTGA 3DF6A 2EN2A 1AH5A 2FV4B 5LMNE 1ZBQA 1A1GA 5LLQA 2YTEA 4DV2E 2EJ4A 2MDGA 2EMGA 2EMZA 1G2FC 3EPLA 4WPYA 3C6KA 2CT1A 2EPOA 2LO3A 4OX9E 4DR7E 2RS6A 1PJTA 3C4TA 2D9HA 1T4LB 2ELYA 2YTIA 2NA2A 4DMIA 2LUPB 2HC5A 4WSPA 1T4NA 2LVHA 2L8TA 5KL3A 4JI5E 3FIGA 4DR1E 1IBKE 1ZR9A 3ECRA 2L2NA 2YTDA 1X48A 2EN4A 4F2JC 4TUIA 1YUJA 4R2DA 1A1LA 2EM5A 3BGHA 2EN1A 1TF3A 1PJQA 2EM0A 5F3WA 3C6MA 1QU6A 3EPJA 2E5LE 1IBME 5KL5A 2RSMA 2EM8A 4Q35B 2ZM6E 1YYKA 2ENHA 2DSYA 3JAMC 2EM7A 2ENAA 4JI3E 2EQ0A 4F6MA 1GQEA 1XNRE 4MLQA 2YZTA 1JK2A 1X49A 4LF6E 2RPCA 1A1KA 5IV8B 4L5NC 1EH7A 3VK6A 4JYAE 2NUGA 4O5GA 2HGHA 2EOSA 4JI4E 2EPPA 2BBGA 2G7HA 4JI0E 2EOIA 4P78A 4DR4E 2EN8A 2YT4A 4RHBB 4HTGA 4P7DA 3VYYA 4DV7E 4LFAE 4M0VA 2VQFE 4DR2E 1WRJA 2V89A 1T39A 1EKZA 1WHQA 2JY9A 2LJUA 5KL6A 2DLKA 4LTYA 3IWDA 1UHZA 1I94E 5A6AA 2EMHA 2DGCA 1PDAA 2KONA 4LFBE 1N33E 2V85A 4WFTA 2M7QA 2EOJA 4JI6E 1ZBTA 4J8ZA 3ADJA 2JPAA 1IMUA 2L3CA 1HR0E 1STUA 1DGCA 4GKKE 1NCSA 2DMYA 2Q8UA 4JI8E 2ENCA 2GHFA 2KHXA 5AASA 4R03A 2EMAA 2MC6A 2EMBA 2E72A 1XMQE 2V88A 2K7IA 2EM3A 2YTJA 2LV2A 4O4KA 1ZAAC 1FJGE 1RMDA 3M99B 5A6BA 2V87A 1RC7A 4BC9A 2JR1A 2WCC3 2M4IA 2EORA 3T1HE 2B7VA 4KHPE 1YFHA 4F9AB 4DR5E 4BC7A 2EP3A 4X8WA 1A1JA 3AUZA 4WSGA 2LJHA 2UUCE 2N8XA 5AC4A 4DUZE 4BS9A 2JOXA 3J7Yp 4F9BB 4YHHE 2L2KB 1EH8A 4DV3E 1X3CA 4DV4E 3THOB 2F8BA 2EM9A 2HJJA 2EPAA 2LMZA 5AE3A 2LTRA 5FLXC 2LT7A 1J26A 4O43A 2ADRA 1DQ3A 4JV5E 3KWRA 3T1YE 4R2QA 1PJSA 1HNXE 4DUYE 4DV0E 1IQOA 2I13A 4F9CB 3BBGA 1T4OA 2F4VE 2I9IA 1A1FA 4I8OA 2EM2A 2EOOA 2EPNA 4X62E 4WYQB 4DV1E 1SR9A 4M2ZA 4B3TE 4DV6E 2LUQA 2EMFA 2V83A 2YTPA 1WHNA 1N32E 2EMIA 2NABA 4YY3E 4GEQB 3RMPA 1YZ9A 1JK1A 2YRKA 4NXME 2EN7A 3VYXA 1WJPA 1PKPA 3ZOQB 3KZZA 5A6KA 4ZYEA 2R1FA 2EMCA 1YUIA 3MHHC 1N34E 4ZYDA 2YTFA 4GZNC 4M30A 1F2IG 2EOMA 5AE2A 3HPZA 2UUAE 5A69A 4R8OA 1L4SA 5A6JA 2EOEA 4NXNE 4IJDA 2YRMA 2B7TA 2JWOA 2BB8A 2V86A 1X6EA 4R2RA 5AC5A 3ADLA 2EL6A 2ODRC 3EPHA 1G2DC 2EL4A 4N4RB 4WX9A 4BBYA 3MSWA 2YTQA 4BMJA 1UBDC 2RTXA 2RQLA 3F6GA 2YU8A 3OTOE 2E1MA 4JI7E 2LBSB 5A2QC 4R2SA 5KL2A 2EL5A 3K6QA 1KYQA 2GPIA 2DIXA 5IXMB 1YYWA 2EPUA 2EPCA 1B69A 1AAYA 4F54A 4R2AA 4AQYE 3OMLA 4OOGC 2FTXB 2DLQA 2L92A 5CFFE 3DJWA 1LLMC 4M9VC 3HXLA 5KL4A 2WBUA 4X65E 4R2PA 2EPKX 2YWQA 1QNTA 1Z1BA 3HQ1A 3ADGA 2EMYA 2JVAA 4DV5E 1X6FA 4LF5E 2WZOA 2H36X 2EWLA 4KZSA 2EZ6A 2EPXA 1A1IA 3VHTB 2KOUA 2MC5A 5TSEA 1BBOA 4X9JA 3ADIA 4LF8E 1YYOA 1YPNA 5IWAE 4X64E 4X66E 2JP9A 5AE1A 2GLIA 2YPNA 4IS1C 2UUBE 1X47A 3BIDA 4O24A 2UXBE 2UXDE 4DR6E 2EQ1A 2V8QB 2WBTA 4L8NA 2EOQA 2EN3A 2CPNA 2EMWA 2MKNA 4R2EA 1YSAC 2UU9E 2PRTA 2EOFA 2MDRA 1O0WA 2LRSA 5KL7A 2FGGA 4LF7E 2YSOA 2R76A 5BR8E 1FKAE 2YTOA 3J7AG 4LFCE 4WXCA 3TQMA 2NUFA 2B9DA 5T6JA 2EMLA 1N36E
chains in the Genus database with same CATH topology
2YTGA 1WJPA 2EOZA 2DLKA 2EMXA 2EN2A 4F6NA 2EOXA 1UN6B 2R1FA 2EMCA 1YUIA 3MHHC 2YTFA 2CTDA 2YU5A 1A1GA 4GZNC 1F2IG 2EMHA 2EOMA 2YTEA 2DGCA 2EJ4A 2ELZA 2MDGA 2EMGA 2EMZA 2EOEA 1G2FC 3EPLA 2LCEA 2YTNA 2WBSA 4IJDA 2YRMA 2EOJA 2CT1A 2DMIA 2BB8A 2LO3A 1X6EA 4R2RA 1X6HA 2JPAA 2EL6A 4FK5C 2RSIA 1G2DC 3EPHA 2EL4A 1DGCA 2D9HA 2ELYA 1NCSA 2YTIA 2ENCA 2YTQA 2GHFA 1UBDC 2VRDA 1X5WA 2EMAA 2M9AA 2EMBA 2E72A 2YU8A 1TN9A 2EQ3A 4R2SA 2EM3A 2YTJA 2LV2A 5KL2A 2EL5A 1ZAAC 1RMDA 2LVHA 3M99B 5KL3A 3EPKA 1KJKA 2EPUA 2EPCA 1B69A 1AAYA 4R2AA 2WCC3 2EORA 1TF6A 1ZR9A 2YTDA 2EN4A 4F2JC 2DLQA 1YUJA 2EMKA 1A1HA 4R2DA 3MHSC 1LLMC 1A1LA 4M9VC 2EM5A 2EP3A 5KL4A 2WBUA 2EN1A 1TF3A 4R2PA 1A1JA 1BB8A 4WSGA 1Z1BA 2EM6A 2EM0A 1P47A 2EMYA 1X6FA 2EPXA 3EPJA 1A1IA 3VHTB 5KL5A 2EPZA 2J7JA 3UK3C 2EM8A 1X3CA 4X9JA 1BBOA 2EOHA 2EM9A 2EPAA 2ENHA 2JP9A 2EM7A 2ENAA 2LT7A 2MKDA 2EQ0A 4F6MA 2ADRA 2GLIA 2EE8A 2YRHA 4IS1C 1JK2A 4R2QA 2CSHA 2RPCA 1MEYC 1A1KA 2I13A 4R2CA 2YSPA 2EQ1A 2HGHA 2EOSA 2WBTA 2EPPA 2EM2A 2EOQA 2EN3A 2EOOA 1A1FA 2EMWA 2MKNA 4R2EA 2EOIA 1YSAC 2DRPA 2PRTA 2EOFA 2EN8A 1ZU1A 2EN6A 2EOYA 2EMFA 2YTPA 5KL7A 2A25A 2EM4A 2YSOA 2YTOA 2EMIA 2NABA 1JK1A 2YRKA 2EPRA 2EN7A 2EMLA 5KL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTG A;  1WJP A;  2EOZ A;  2DLK A;  2EMX A;  2EN2 A;  4F6N A;  2EOX A;  1UN6 B;  2R1F A;  2EMC A;  1YUI A;  3MHH C;  2YTF A;  2CTD A;  2YU5 A;  1A1G A;  4GZN C;  1F2I G;  2EMH A;  2EOM A;  2YTE A;  2DGC A;  2EJ4 A;  2ELZ A;  2MDG A;  2EMG A;  2EMZ A;  2EOE A;  1G2F C;  3EPL A;  2LCE A;  2YTN A;  2WBS A;  4IJD A;  2YRM A;  2EOJ A;  2CT1 A;  2DMI A;  2BB8 A;  2LO3 A;  1X6E A;  4R2R A;  1X6H A;  2JPA A;  2EL6 A;  4FK5 C;  2RSI A;  1G2D C;  3EPH A;  2EL4 A;  1DGC A;  2D9H A;  2ELY A;  1NCS A;  2YTI A;  2ENC A;  2YTQ A;  2GHF A;  1UBD C;  2VRD A;  1X5W A;  2EMA A;  2M9A A;  2EMB A;  2E72 A;  2YU8 A;  1TN9 A;  2EQ3 A;  4R2S A;  2EM3 A;  2YTJ A;  2LV2 A;  5KL2 A;  2EL5 A;  1ZAA C;  1RMD A;  2LVH A;  3M99 B;  5KL3 A;  3EPK A;  1KJK A;  2EPU A;  2EPC A;  1B69 A;  1AAY A;  4R2A A;  2WCC 3;  2EOR A;  1TF6 A;  1ZR9 A;  2YTD A;  2EN4 A;  4F2J C;  2DLQ A;  1YUJ A;  2EMK A;  1A1H A;  4R2D A;  3MHS C;  1LLM C;  1A1L A;  4M9V C;  2EM5 A;  2EP3 A;  5KL4 A;  2WBU A;  2EN1 A;  1TF3 A;  4R2P A;  1A1J A;  1BB8 A;  4WSG A;  1Z1B A;  2EM6 A;  2EM0 A;  1P47 A;  2EMY A;  1X6F A;  2EPX A;  3EPJ A;  1A1I A;  3VHT B;  5KL5 A;  2EPZ A;  2J7J A;  3UK3 C;  2EM8 A;  1X3C A;  4X9J A;  1BBO A;  2EOH A;  2EM9 A;  2EPA A;  2ENH A;  2JP9 A;  2EM7 A;  2ENA A;  2LT7 A;  2MKD A;  2EQ0 A;  4F6M A;  2ADR A;  2GLI A;  2EE8 A;  2YRH A;  4IS1 C;  1JK2 A;  4R2Q A;  2CSH A;  2RPC A;  1MEY C;  1A1K A;  2I13 A;  4R2C A;  2YSP A;  2EQ1 A;  2HGH A;  2EOS A;  2WBT A;  2EPP A;  2EM2 A;  2EOQ A;  2EN3 A;  2EOO A;  1A1F A;  2EMW A;  2MKN A;  4R2E A;  2EOI A;  1YSA C;  2DRP A;  2PRT A;  2EOF A;  2EN8 A;  1ZU1 A;  2EN6 A;  2EOY A;  2EMF A;  2YTP A;  5KL7 A;  2A25 A;  2EM4 A;  2YSO A;  2YTO A;  2EMI A;  2NAB A;  1JK1 A;  2YRK A;  2EPR A;  2EN7 A;  2EML A;  5KL6 A; 
#chains in the Genus database with same CATH topology
 2EOZ A;  2EMX A;  2L6M A;  4MLV A;  4F6N A;  2EOX A;  1UN6 B;  1EH6 A;  2CTD A;  1WXR A;  3BF2 A;  2YU5 A;  2N3H A;  1DI2 A;  1HNZ E;  2B3T B;  2ELZ A;  1NEI A;  4B3M E;  1N3G A;  1XNQ E;  2LCE A;  2YTN A;  2WBS A;  3AV0 A;  4WXD A;  2DMI A;  3C4B A;  1X6H A;  5DNY A;  4FK5 C;  2RSI A;  2HHH E;  3JTZ A;  2NUE A;  4HEI A;  2LTS A;  3EQ1 A;  4Q28 A;  2VRD A;  1X5W A;  2M9A A;  1TN9 A;  2EQ3 A;  2L3J A;  1MGT A;  4RH8 A;  3EPK A;  1KJK A;  4BHC A;  1RQ0 A;  1TF6 A;  4JI1 E;  1XMO E;  3IWB A;  3LML A;  2EMK A;  1A1H A;  3HTX A;  3MHS C;  3THN A;  2L33 A;  5IT9 C;  2VF1 A;  4LF4 E;  2RS7 A;  4B3R E;  4TUG A;  1BB8 A;  2JOB A;  2EM6 A;  1P47 A;  4B3S E;  2JXP A;  2K4V A;  5ADZ A;  3F6H A;  3H09 A;  2M1S A;  2N3G A;  2EPZ A;  2J7J A;  3UK3 C;  3IWC A;  1T38 A;  5A6B D;  1GTK A;  2EOH A;  1HNW E;  4LU9 A;  2EPM X;  2DB2 A;  2L2M A;  2MKD A;  4ZYG A;  3L00 A;  2EE8 A;  1IQS A;  2YRH A;  3LLH A;  4DKK A;  4LF9 E;  3P1X A;  2CSH A;  3J81 C;  1BBG A;  2IHR 1;  4DR3 E;  2VQE E;  1MEY C;  4NHR A;  1IBL E;  4R2C A;  3J80 C;  1GZ6 A;  3QG5 C;  2YSP A;  4GKJ E;  4JI2 E;  5LL6 R;  3JU0 A;  2DRP A;  4BCA A;  3KZY A;  1ZU1 A;  1UIL A;  2EN6 A;  2EOY A;  4K0K E;  2EPL X;  2A25 A;  3HPS A;  4KWY A;  2EM4 A;  4ZYH A;  4NZV A;  2UXC E;  1SFE A;  2VE7 C;  2JYA A;  5LMU E;  2LE2 A;  2ODR D;  4BHB A;  2EPR A;  1J5E E;  2YTG A;  3DF6 A;  2EN2 A;  1AH5 A;  2FV4 B;  5LMN E;  1ZBQ A;  1A1G A;  5LLQ A;  2YTE A;  4DV2 E;  2EJ4 A;  2MDG A;  2EMG A;  2EMZ A;  1G2F C;  3EPL A;  4WPY A;  3C6K A;  2CT1 A;  2EPO A;  2LO3 A;  4OX9 E;  4DR7 E;  2RS6 A;  1PJT A;  3C4T A;  2D9H A;  1T4L B;  2ELY A;  2YTI A;  2NA2 A;  4DMI A;  2LUP B;  2HC5 A;  4WSP A;  1T4N A;  2LVH A;  2L8T A;  5KL3 A;  4JI5 E;  3FIG A;  4DR1 E;  1IBK E;  1ZR9 A;  3ECR A;  2L2N A;  2YTD A;  1X48 A;  2EN4 A;  4F2J C;  4TUI A;  1YUJ A;  4R2D A;  1A1L A;  2EM5 A;  3BGH A;  2EN1 A;  1TF3 A;  1PJQ A;  2EM0 A;  5F3W A;  3C6M A;  1QU6 A;  3EPJ A;  2E5L E;  1IBM E;  5KL5 A;  2RSM A;  2EM8 A;  4Q35 B;  2ZM6 E;  1YYK A;  2ENH A;  2DSY A;  3JAM C;  2EM7 A;  2ENA A;  4JI3 E;  2EQ0 A;  4F6M A;  1GQE A;  1XNR E;  4MLQ A;  2YZT A;  1JK2 A;  1X49 A;  4LF6 E;  2RPC A;  1A1K A;  5IV8 B;  4L5N C;  1EH7 A;  3VK6 A;  4JYA E;  2NUG A;  4O5G A;  2HGH A;  2EOS A;  4JI4 E;  2EPP A;  2BBG A;  2G7H A;  4JI0 E;  2EOI A;  4P78 A;  4DR4 E;  2EN8 A;  2YT4 A;  4RHB B;  4HTG A;  4P7D A;  3VYY A;  4DV7 E;  4LFA E;  4M0V A;  2VQF E;  4DR2 E;  1WRJ A;  2V89 A;  1T39 A;  1EKZ A;  1WHQ A;  2JY9 A;  2LJU A;  5KL6 A;  2DLK A;  4LTY A;  3IWD A;  1UHZ A;  1I94 E;  5A6A A;  2EMH A;  2DGC A;  1PDA A;  2KON A;  4LFB E;  1N33 E;  2V85 A;  4WFT A;  2M7Q A;  2EOJ A;  4JI6 E;  1ZBT A;  4J8Z A;  3ADJ A;  2JPA A;  1IMU A;  2L3C A;  1HR0 E;  1STU A;  1DGC A;  4GKK E;  1NCS A;  2DMY A;  2Q8U A;  4JI8 E;  2ENC A;  2GHF A;  2KHX A;  5AAS A;  4R03 A;  2EMA A;  2MC6 A;  2EMB A;  2E72 A;  1XMQ E;  2V88 A;  2K7I A;  2EM3 A;  2YTJ A;  2LV2 A;  4O4K A;  1ZAA C;  1FJG E;  1RMD A;  3M99 B;  5A6B A;  2V87 A;  1RC7 A;  4BC9 A;  2JR1 A;  2WCC 3;  2M4I A;  2EOR A;  3T1H E;  2B7V A;  4KHP E;  1YFH A;  4F9A B;  4DR5 E;  4BC7 A;  2EP3 A;  4X8W A;  1A1J A;  3AUZ A;  4WSG A;  2LJH A;  2UUC E;  2N8X A;  5AC4 A;  4DUZ E;  4BS9 A;  2JOX A;  3J7Y p;  4F9B B;  4YHH E;  2L2K B;  1EH8 A;  4DV3 E;  1X3C A;  4DV4 E;  3THO B;  2F8B A;  2EM9 A;  2HJJ A;  2EPA A;  2LMZ A;  5AE3 A;  2LTR A;  5FLX C;  2LT7 A;  1J26 A;  4O43 A;  2ADR A;  1DQ3 A;  4JV5 E;  3KWR A;  3T1Y E;  4R2Q A;  1PJS A;  1HNX E;  4DUY E;  4DV0 E;  1IQO A;  2I13 A;  4F9C B;  3BBG A;  1T4O A;  2F4V E;  2I9I A;  1A1F A;  4I8O A;  2EM2 A;  2EOO A;  2EPN A;  4X62 E;  4WYQ B;  4DV1 E;  1SR9 A;  4M2Z A;  4B3T E;  4DV6 E;  2LUQ A;  2EMF A;  2V83 A;  2YTP A;  1WHN A;  1N32 E;  2EMI A;  2NAB A;  4YY3 E;  4GEQ B;  3RMP A;  1YZ9 A;  1JK1 A;  2YRK A;  4NXM E;  2EN7 A;  3VYX A;  1WJP A;  1PKP A;  3ZOQ B;  3KZZ A;  5A6K A;  4ZYE A;  2R1F A;  2EMC A;  1YUI A;  3MHH C;  1N34 E;  4ZYD A;  2YTF A;  4GZN C;  4M30 A;  1F2I G;  2EOM A;  5AE2 A;  3HPZ A;  2UUA E;  5A69 A;  4R8O A;  1L4S A;  5A6J A;  2EOE A;  4NXN E;  4IJD A;  2YRM A;  2B7T A;  2JWO A;  2BB8 A;  2V86 A;  1X6E A;  4R2R A;  5AC5 A;  3ADL A;  2EL6 A;  2ODR C;  3EPH A;  1G2D C;  2EL4 A;  4N4R B;  4WX9 A;  4BBY A;  3MSW A;  2YTQ A;  4BMJ A;  1UBD C;  2RTX A;  2RQL A;  3F6G A;  2YU8 A;  3OTO E;  2E1M A;  4JI7 E;  2LBS B;  5A2Q C;  4R2S A;  5KL2 A;  2EL5 A;  3K6Q A;  1KYQ A;  2GPI A;  2DIX A;  5IXM B;  1YYW A;  2EPU A;  2EPC A;  1B69 A;  1AAY A;  4F54 A;  4R2A A;  4AQY E;  3OML A;  4OOG C;  2FTX B;  2DLQ A;  2L92 A;  5CFF E;  3DJW A;  1LLM C;  4M9V C;  3HXL A;  5KL4 A;  2WBU A;  4X65 E;  4R2P A;  2EPK X;  2YWQ A;  1QNT A;  1Z1B A;  3HQ1 A;  3ADG A;  2EMY A;  2JVA A;  4DV5 E;  1X6F A;  4LF5 E;  2WZO A;  2H36 X;  2EWL A;  4KZS A;  2EZ6 A;  2EPX A;  1A1I A;  3VHT B;  2KOU A;  2MC5 A;  5TSE A;  1BBO A;  4X9J A;  3ADI A;  4LF8 E;  1YYO A;  1YPN A;  5IWA E;  4X64 E;  4X66 E;  2JP9 A;  5AE1 A;  2GLI A;  2YPN A;  4IS1 C;  2UUB E;  1X47 A;  3BID A;  4O24 A;  2UXB E;  2UXD E;  4DR6 E;  2EQ1 A;  2V8Q B;  2WBT A;  4L8N A;  2EOQ A;  2EN3 A;  2CPN A;  2EMW A;  2MKN A;  4R2E A;  1YSA C;  2UU9 E;  2PRT A;  2EOF A;  2MDR A;  1O0W A;  2LRS A;  5KL7 A;  2FGG A;  4LF7 E;  2YSO A;  2R76 A;  5BR8 E;  1FKA E;  2YTO A;  3J7A G;  4LFC E;  4WXC A;  3TQM A;  2NUF A;  2B9D A;  5T6J A;  2EML A;  1N36 E; 
#chains in the Genus database with same CATH homology
 2YTG A;  1WJP A;  2EOZ A;  2DLK A;  2EMX A;  2EN2 A;  4F6N A;  2EOX A;  1UN6 B;  2R1F A;  2EMC A;  1YUI A;  3MHH C;  2YTF A;  2CTD A;  2YU5 A;  1A1G A;  4GZN C;  1F2I G;  2EMH A;  2EOM A;  2YTE A;  2DGC A;  2EJ4 A;  2ELZ A;  2MDG A;  2EMG A;  2EMZ A;  2EOE A;  1G2F C;  3EPL A;  2LCE A;  2YTN A;  2WBS A;  4IJD A;  2YRM A;  2EOJ A;  2CT1 A;  2DMI A;  2BB8 A;  2LO3 A;  1X6E A;  4R2R A;  1X6H A;  2JPA A;  2EL6 A;  4FK5 C;  2RSI A;  1G2D C;  3EPH A;  2EL4 A;  1DGC A;  2D9H A;  2ELY A;  1NCS A;  2YTI A;  2ENC A;  2YTQ A;  2GHF A;  1UBD C;  2VRD A;  1X5W A;  2EMA A;  2M9A A;  2EMB A;  2E72 A;  2YU8 A;  1TN9 A;  2EQ3 A;  4R2S A;  2EM3 A;  2YTJ A;  2LV2 A;  5KL2 A;  2EL5 A;  1ZAA C;  1RMD A;  2LVH A;  3M99 B;  5KL3 A;  3EPK A;  1KJK A;  2EPU A;  2EPC A;  1B69 A;  1AAY A;  4R2A A;  2WCC 3;  2EOR A;  1TF6 A;  1ZR9 A;  2YTD A;  2EN4 A;  4F2J C;  2DLQ A;  1YUJ A;  2EMK A;  1A1H A;  4R2D A;  3MHS C;  1LLM C;  1A1L A;  4M9V C;  2EM5 A;  2EP3 A;  5KL4 A;  2WBU A;  2EN1 A;  1TF3 A;  4R2P A;  1A1J A;  1BB8 A;  4WSG A;  1Z1B A;  2EM6 A;  2EM0 A;  1P47 A;  2EMY A;  1X6F A;  2EPX A;  3EPJ A;  1A1I A;  3VHT B;  5KL5 A;  2EPZ A;  2J7J A;  3UK3 C;  2EM8 A;  1X3C A;  4X9J A;  1BBO A;  2EOH A;  2EM9 A;  2EPA A;  2ENH A;  2JP9 A;  2EM7 A;  2ENA A;  2LT7 A;  2MKD A;  2EQ0 A;  4F6M A;  2ADR A;  2GLI A;  2EE8 A;  2YRH A;  4IS1 C;  1JK2 A;  4R2Q A;  2CSH A;  2RPC A;  1MEY C;  1A1K A;  2I13 A;  4R2C A;  2YSP A;  2EQ1 A;  2HGH A;  2EOS A;  2WBT A;  2EPP A;  2EM2 A;  2EOQ A;  2EN3 A;  2EOO A;  1A1F A;  2EMW A;  2MKN A;  4R2E A;  2EOI A;  1YSA C;  2DRP A;  2PRT A;  2EOF A;  2EN8 A;  1ZU1 A;  2EN6 A;  2EOY A;  2EMF A;  2YTP A;  5KL7 A;  2A25 A;  2EM4 A;  2YSO A;  2YTO A;  2EMI A;  2NAB A;  1JK1 A;  2YRK A;  2EPR A;  2EN7 A;  2EML A;  5KL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...