2EMYA

Solution structure of the c2h2 type zinc finger (region 551-583) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGENPYECHECGKAFSRKYQLISHQRTHAGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 551-583) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emyA00
3EPJA 2EMAA 1RMDA 2WBSA 2EMWA 2EN6A 2EOOA 2D9HA 2GHFA 2MDGA 3EPKA 1Z1BA 2EPAA 5KL2A 2YTNA 2EL4A 2YTFA 2YTIA 2LT7A 2DMIA 1BB8A 2A25A 2LO3A 2CSHA 2EMGA 1G2FC 2EQ3A 2EM8A 2EM9A 2LCEA 1TN9A 4F2JC 4R2CA 4R2EA 3M99B 2EORA 1TF3A 1A1IA 2ENHA 2DGCA 2ENAA 4F6NA 2EPRA 2YTDA 2EOYA 2CT1A 2WCC3 1JK1A 3EPHA 1X6EA 4WSGA 1AAYA 1ZAAC 2YU5A 2EOEA 1NCSA 2EOHA 1DGCA 2GLIA 1X6HA 2EM0A 2EMCA 2YTGA 2WBUA 2DLKA 2EOXA 2LV2A 2EPUA 5KL3A 2YTQA 2EM7A 2EPXA 3VHTB 4R2QA 1A1LA 4FK5C 1A1GA 1G2DC 2DLQA 2EOIA 2YSOA 1P47A 2ADRA 2EJ4A 4R2AA 2EN1A 2DRPA 2WBTA 1B69A 2MKDA 2I13A 3UK3C 2BB8A 2EOMA 2EN3A 2ELYA 2EPPA 4R2DA 4GZNC 2EM3A 4F6MA 2HGHA 2YTEA 1ZU1A 1MEYC 2EMLA 2EQ1A 2E72A 2YSPA 1YSAC 1KJKA 2J7JA 2M9AA 2RSIA 2EN7A 2LVHA 4IJDA 2EOQA 2EOSA 4R2SA 2EMYA 1X5WA 1YUJA 1UBDC 2EOFA 2PRTA 5KL7A 2VRDA 1A1JA 2MKNA 2RPCA 2CTDA 2EM6A 4R2RA 2NABA 5KL6A 5KL5A 2EMZA 2EM5A 4IS1C 1WJPA 2EMFA 2EL5A 2EPCA 2EOZA 4R2PA 1F2IG 2EN8A 1A1HA 1X6FA 2R1FA 2ELZA 2EMIA 2EQ0A 2ENCA 2YRKA 4X9JA 2YRHA 2YRMA 5KL4A 2JPAA 3EPLA 1A1KA 1ZR9A 2EN2A 2EMHA 1BBOA 2EMBA 1A1FA 2YTJA 1UN6B 2EM4A 1YUIA 2EP3A 2YTPA 2EMKA 2YU8A 2EPZA 3MHHC 1TF6A 1X3CA 2EL6A 2EE8A 4M9VC 3MHSC 2YTOA 1JK2A 1LLMC 2EMXA 2JP9A 2EM2A 2EN4A 2EOJA
chains in the Genus database with same CATH superfamily
2VF1A 2NA2A 2V83A 3JU0A 2WBSA 4ZYEA 2VQEE 3THNA 2EOOA 2MDGA 2GHFA 1IMUA 2V86A 1N34E 1XNRE 2YTFA 2Q8UA 4AQYE 1BB8A 4M30A 2LO3A 2CSHA 1G2FC 4R8OA 2EM8A 4R2CA 4R2EA 2EORA 1PJSA 2V85A 5A6AA 2E1MA 2ENAA 4B3ME 4F6NA 4LF9E 1GTKA 1JK1A 2KOUA 3T1YE 4DR6E 4WXCA 1ZAAC 1T4NA 2RS7A 1NCSA 2EMCA 2EM0A 1N36E 2LV2A 2MC6A 2EPUA 4B3TE 5AE2A 2EPXA 4R2QA 4FK5C 5A6BD 4MLVA 1N32E 1P47A 2ADRA 4GKJE 2WBTA 1B69A 2MKDA 2L8TA 1IBME 3J80C 3J7AG 2EN3A 2ODRD 4JI7E 4NXNE 3OTOE 2HGHA 2LUQA 4LF7E 5CFFE 1O0WA 2K7IA 3DF6A 2EZ6A 2LJUA 2DIXA 2M9AA 4DV0E 4BHBA 4DV6E 1X5WA 4DV3E 4LU9A 1STUA 3ZOQB 2VRDA 2EM6A 4R2RA 4P78A 1XMQE 3HPZA 2NUFA 5KL6A 4DR3E 5F3WA 4LFAE 3FIGA 3TQMA 3IWDA 2EMFA 2EPCA 2NUEA 2JXPA 1A1HA 1X6FA 5AC4A 3HXLA 2YRMA 4WXDA 4JI3E 4F54A 3F6GA 1BBOA 2EMBA 2LMZA 1XMOE 2YTJA 1J5EE 1IBLE 2EP3A 2HJJA 3C4BA 1T38A 2DB2A 4DV4E 2KHXA 4YY3E 3AV0A 1WHQA 4F9BB 2JP9A 2EM2A 5IV8B 3ADLA 1SFEA 3EPJA 2RS6A 1X49A 2N8XA 2I9IA 2JOXA 2L33A 4KHPE 4HTGA 2D9HA 1Z1BA 5KL2A 2EL4A 2ZM6E 2YTIA 1GQEA 2EMGA 1T4LB 3K6QA 3DJWA 1HNWE 1EKZA 4JV5E 2UU9E 4DUZE 2ENHA 5LMUE 2DGCA 2MDRA 2EOYA 2CT1A 4LF4E 3VYYA 3BGHA 1AAYA 2YU5A 2EOHA 2GLIA 1QNTA 3BBGA 5LLQA 3L00A 2WBUA 2DLKA 3VHTB 1A1LA 4JI2E 3HTXA 4BBYA 4KWYA 1T39A 2YSOA 5A6KA 3BIDA 4WYQB 1WHNA 4LTYA 5T6JA 2N3HA 3UK3C 1FJGE 5LL6R 2ELYA 2H36X 2EPPA 4O43A 2F4VE 2EM3A 4F6MA 5BR8E 5ADZA 4JI4E 2WZOA 3THOB 2LTRA 1ZU1A 4JI1E 1YYKA 2E72A 2JY9A 5AASA 1YSAC 2FV4B 2RSIA 4DUYE 4DR2E 4GEQB 1YFHA 2L92A 2EOFA 1WXRA 2M1SA 4X66E 2NABA 3HQ1A 2EMZA 2EM5A 4IS1C 2EL5A 2EOZA 4R2PA 1F2IG 3T1HE 2EN8A 3ADIA 2R1FA 3P1XA 2EQ0A 2YRKA 3C6MA 5TSEA 4X9JA 5KL4A 1PKPA 1A1KA 2EMHA 2HC5A 1A1FA 5LMNE 2LUPB 4DR5E 1UN6B 2EM4A 2YU8A 3MHHC 4J8ZA 4WPYA 2EL6A 1IQSA 3MHSC 4JI5E 1JK2A 1LLMC 3VK6A 2L6MA 3IWBA 4WX9A 4BC7A 2EN4A 4MLQA 4O5GA 4BS9A 4GKKE 2K4VA 4LFCE 2EN6A 3EPKA 2BBGA 2EPAA 5AE1A 2IHR1 5A69A 1PJQA 2B7TA 2LT7A 2LE2A 2B3TB 2JOBA 3J7Yp 2RSMA 2L3JA 2EM9A 2V88A 2EPLX 4WSPA 1DI2A 3JAMC 1A1IA 1X47A 3HPSA 2RTXA 5IWAE 4F9AB 2B7VA 4BCAA 2YTDA 5IXMB 3KZYA 2WCC3 4LF8E 4L8NA 1N3GA 1HR0E 3H09A 4YHHE 1DGCA 1X6HA 1EH8A 2YTGA 4RH8A 2L2NA 3ADGA 4X65E 1BBGA 2YTQA 2EM7A 4TUGA 2FTXB 2EPOA 4LF5E 3IWCA 2DLQA 1MGTA 2EOIA 3EQ1A 4LFBE 4DV7E 4M2ZA 2EJ4A 5A6BA 2F8BA 2EPNA 4X64E 4HEIA 2EN1A 5A6JA 4WFTA 2YWQA 2EOMA 1HNZE 4O24A 2UUCE 4DV2E 1XNQE 4DKKA 4Q28A 2YTEA 5FLXC 4F9CB 1I94E 2YSPA 2EQ1A 2J7JA 2JYAA 2EN7A 2VQFE 2LRSA 1RQ0A 4DR1E 2UUAE 2JVAA 2EMYA 1RC7A 1T4OA 3F6HA 2PRTA 1QU6A 1UILA 3J81C 5KL7A 1A1JA 2RPCA 2CTDA 4L5NC 4X8WA 2B9DA 2EPMX 5A2QC 2KONA 1AH5A 2UXCE 4I8OA 4DR4E 2ELZA 4Q35B 2EMIA 3ADJA 2HHHE 3MSWA 2G7HA 4NHRA 3C6KA 2YRHA 3OMLA 2JPAA 2M4IA 2EPKX 1ZR9A 2V87A 2EN2A 2YTPA 2EMKA 3LMLA 1TF6A 2L2KB 1X3CA 4BMJA 3BF2A 4M9VC 3KZZA 2YTOA 2EMXA 4JI6E 5IT9C 2EMAA 2V89A 1RMDA 1J26A 4JI8E 4OX9E 3ECRA 1PDAA 2EMWA 2MC5A 2YTNA 5DNYA 2DMIA 2UUBE 2A25A 1NEIA 2EQ3A 2LCEA 4P7DA 1TN9A 4F2JC 2E5LE 2RQLA 3M99B 4DV1E 2UXBE 2L3CA 4ZYHA 1TF3A 4O4KA 1YYOA 2EPRA 4DV5E 4R03A 5AE3A 3EPHA 1X6EA 4WSGA 2EOEA 3LLHA 2L2MA 2V8QB 2UXDE 2EOXA 1HNXE 5KL3A 2DSYA 4LF6E 2M7QA 3AUZA 1A1GA 1G2DC 3JTZA 2YZTA 2FGGA 1ZBTA 1UHZA 4BC9A 4R2AA 4X62E 2JR1A 2I13A 2DRPA 2BB8A 4DMIA 4R2DA 4GZNC 4RHBB 2LBSB 3QG5C 1IQOA 1PJTA 3C4TA 1YPNA 1MEYC 1X48A 5AC5A 1EH6A 4JI0E 2EMLA 1KJKA 2VE7C 2CPNA 1L4SA 1EH7A 1GZ6A 1DQ3A 2LVHA 4IJDA 2EOQA 2R76A 4B3SE 2EOSA 4R2SA 2DMYA 4OOGC 1YUJA 1WRJA 1UBDC 4N4RB 2N3GA 3RMPA 1FKAE 4B3RE 2ODRC 2EWLA 2MKNA 3VYXA 5KL5A 4ZYGA 4TUIA 1YZ9A 1YYWA 4BHCA 2LJHA 1SR9A 1WJPA 4K0KE 2YPNA 1KYQA 4JYAE 4NZVA 2GPIA 2LTSA 2ENCA 3KWRA 3EPLA 1ZBQA 4KZSA 4NXME 4DR7E 1IBKE 1YUIA 4ZYDA 2EPZA 2EE8A 4M0VA 2JWOA 2NUGA 2YT4A 1N33E 2EOJA
chains in the Genus database with same CATH topology
3EPJA 2EMAA 1RMDA 2WBSA 2EMWA 2EN6A 2EOOA 2D9HA 2GHFA 2MDGA 3EPKA 1Z1BA 2EPAA 5KL2A 2YTNA 2EL4A 2YTFA 2YTIA 2LT7A 2DMIA 1BB8A 2A25A 2LO3A 2CSHA 2EMGA 1G2FC 2EQ3A 2EM8A 2EM9A 2LCEA 1TN9A 4F2JC 4R2CA 4R2EA 3M99B 2EORA 1TF3A 1A1IA 2ENHA 2DGCA 2ENAA 4F6NA 2EPRA 2YTDA 2EOYA 2CT1A 2WCC3 1JK1A 3EPHA 1X6EA 4WSGA 1AAYA 1ZAAC 2YU5A 2EOEA 1NCSA 2EOHA 1DGCA 2GLIA 1X6HA 2EM0A 2EMCA 2YTGA 2WBUA 2DLKA 2EOXA 2LV2A 2EPUA 5KL3A 2YTQA 2EM7A 2EPXA 3VHTB 4R2QA 1A1LA 4FK5C 1A1GA 1G2DC 2DLQA 2EOIA 2YSOA 1P47A 2ADRA 2EJ4A 4R2AA 2EN1A 2DRPA 2WBTA 1B69A 2MKDA 2I13A 3UK3C 2BB8A 2EOMA 2EN3A 2ELYA 2EPPA 4R2DA 4GZNC 2EM3A 4F6MA 2HGHA 2YTEA 1ZU1A 1MEYC 2EMLA 2EQ1A 2E72A 2YSPA 1YSAC 1KJKA 2J7JA 2M9AA 2RSIA 2EN7A 2LVHA 4IJDA 2EOQA 2EOSA 4R2SA 2EMYA 1X5WA 1YUJA 1UBDC 2EOFA 2PRTA 5KL7A 2VRDA 1A1JA 2MKNA 2RPCA 2CTDA 2EM6A 4R2RA 2NABA 5KL6A 5KL5A 2EMZA 2EM5A 4IS1C 1WJPA 2EMFA 2EL5A 2EPCA 2EOZA 4R2PA 1F2IG 2EN8A 1A1HA 1X6FA 2R1FA 2ELZA 2EMIA 2EQ0A 2ENCA 2YRKA 4X9JA 2YRHA 2YRMA 5KL4A 2JPAA 3EPLA 1A1KA 1ZR9A 2EN2A 2EMHA 1BBOA 2EMBA 1A1FA 2YTJA 1UN6B 2EM4A 1YUIA 2EP3A 2YTPA 2EMKA 2YU8A 2EPZA 3MHHC 1TF6A 1X3CA 2EL6A 2EE8A 4M9VC 3MHSC 2YTOA 1JK2A 1LLMC 2EMXA 2JP9A 2EM2A 2EN4A 2EOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPJ A;  2EMA A;  1RMD A;  2WBS A;  2EMW A;  2EN6 A;  2EOO A;  2D9H A;  2GHF A;  2MDG A;  3EPK A;  1Z1B A;  2EPA A;  5KL2 A;  2YTN A;  2EL4 A;  2YTF A;  2YTI A;  2LT7 A;  2DMI A;  1BB8 A;  2A25 A;  2LO3 A;  2CSH A;  2EMG A;  1G2F C;  2EQ3 A;  2EM8 A;  2EM9 A;  2LCE A;  1TN9 A;  4F2J C;  4R2C A;  4R2E A;  3M99 B;  2EOR A;  1TF3 A;  1A1I A;  2ENH A;  2DGC A;  2ENA A;  4F6N A;  2EPR A;  2YTD A;  2EOY A;  2CT1 A;  2WCC 3;  1JK1 A;  3EPH A;  1X6E A;  4WSG A;  1AAY A;  1ZAA C;  2YU5 A;  2EOE A;  1NCS A;  2EOH A;  1DGC A;  2GLI A;  1X6H A;  2EM0 A;  2EMC A;  2YTG A;  2WBU A;  2DLK A;  2EOX A;  2LV2 A;  2EPU A;  5KL3 A;  2YTQ A;  2EM7 A;  2EPX A;  3VHT B;  4R2Q A;  1A1L A;  4FK5 C;  1A1G A;  1G2D C;  2DLQ A;  2EOI A;  2YSO A;  1P47 A;  2ADR A;  2EJ4 A;  4R2A A;  2EN1 A;  2DRP A;  2WBT A;  1B69 A;  2MKD A;  2I13 A;  3UK3 C;  2BB8 A;  2EOM A;  2EN3 A;  2ELY A;  2EPP A;  4R2D A;  4GZN C;  2EM3 A;  4F6M A;  2HGH A;  2YTE A;  1ZU1 A;  1MEY C;  2EML A;  2EQ1 A;  2E72 A;  2YSP A;  1YSA C;  1KJK A;  2J7J A;  2M9A A;  2RSI A;  2EN7 A;  2LVH A;  4IJD A;  2EOQ A;  2EOS A;  4R2S A;  2EMY A;  1X5W A;  1YUJ A;  1UBD C;  2EOF A;  2PRT A;  5KL7 A;  2VRD A;  1A1J A;  2MKN A;  2RPC A;  2CTD A;  2EM6 A;  4R2R A;  2NAB A;  5KL6 A;  5KL5 A;  2EMZ A;  2EM5 A;  4IS1 C;  1WJP A;  2EMF A;  2EL5 A;  2EPC A;  2EOZ A;  4R2P A;  1F2I G;  2EN8 A;  1A1H A;  1X6F A;  2R1F A;  2ELZ A;  2EMI A;  2EQ0 A;  2ENC A;  2YRK A;  4X9J A;  2YRH A;  2YRM A;  5KL4 A;  2JPA A;  3EPL A;  1A1K A;  1ZR9 A;  2EN2 A;  2EMH A;  1BBO A;  2EMB A;  1A1F A;  2YTJ A;  1UN6 B;  2EM4 A;  1YUI A;  2EP3 A;  2YTP A;  2EMK A;  2YU8 A;  2EPZ A;  3MHH C;  1TF6 A;  1X3C A;  2EL6 A;  2EE8 A;  4M9V C;  3MHS C;  2YTO A;  1JK2 A;  1LLM C;  2EMX A;  2JP9 A;  2EM2 A;  2EN4 A;  2EOJ A; 
#chains in the Genus database with same CATH topology
 2VF1 A;  2NA2 A;  2V83 A;  3JU0 A;  2WBS A;  4ZYE A;  2VQE E;  3THN A;  2EOO A;  2MDG A;  2GHF A;  1IMU A;  2V86 A;  1N34 E;  1XNR E;  2YTF A;  2Q8U A;  4AQY E;  1BB8 A;  4M30 A;  2LO3 A;  2CSH A;  1G2F C;  4R8O A;  2EM8 A;  4R2C A;  4R2E A;  2EOR A;  1PJS A;  2V85 A;  5A6A A;  2E1M A;  2ENA A;  4B3M E;  4F6N A;  4LF9 E;  1GTK A;  1JK1 A;  2KOU A;  3T1Y E;  4DR6 E;  4WXC A;  1ZAA C;  1T4N A;  2RS7 A;  1NCS A;  2EMC A;  2EM0 A;  1N36 E;  2LV2 A;  2MC6 A;  2EPU A;  4B3T E;  5AE2 A;  2EPX A;  4R2Q A;  4FK5 C;  5A6B D;  4MLV A;  1N32 E;  1P47 A;  2ADR A;  4GKJ E;  2WBT A;  1B69 A;  2MKD A;  2L8T A;  1IBM E;  3J80 C;  3J7A G;  2EN3 A;  2ODR D;  4JI7 E;  4NXN E;  3OTO E;  2HGH A;  2LUQ A;  4LF7 E;  5CFF E;  1O0W A;  2K7I A;  3DF6 A;  2EZ6 A;  2LJU A;  2DIX A;  2M9A A;  4DV0 E;  4BHB A;  4DV6 E;  1X5W A;  4DV3 E;  4LU9 A;  1STU A;  3ZOQ B;  2VRD A;  2EM6 A;  4R2R A;  4P78 A;  1XMQ E;  3HPZ A;  2NUF A;  5KL6 A;  4DR3 E;  5F3W A;  4LFA E;  3FIG A;  3TQM A;  3IWD A;  2EMF A;  2EPC A;  2NUE A;  2JXP A;  1A1H A;  1X6F A;  5AC4 A;  3HXL A;  2YRM A;  4WXD A;  4JI3 E;  4F54 A;  3F6G A;  1BBO A;  2EMB A;  2LMZ A;  1XMO E;  2YTJ A;  1J5E E;  1IBL E;  2EP3 A;  2HJJ A;  3C4B A;  1T38 A;  2DB2 A;  4DV4 E;  2KHX A;  4YY3 E;  3AV0 A;  1WHQ A;  4F9B B;  2JP9 A;  2EM2 A;  5IV8 B;  3ADL A;  1SFE A;  3EPJ A;  2RS6 A;  1X49 A;  2N8X A;  2I9I A;  2JOX A;  2L33 A;  4KHP E;  4HTG A;  2D9H A;  1Z1B A;  5KL2 A;  2EL4 A;  2ZM6 E;  2YTI A;  1GQE A;  2EMG A;  1T4L B;  3K6Q A;  3DJW A;  1HNW E;  1EKZ A;  4JV5 E;  2UU9 E;  4DUZ E;  2ENH A;  5LMU E;  2DGC A;  2MDR A;  2EOY A;  2CT1 A;  4LF4 E;  3VYY A;  3BGH A;  1AAY A;  2YU5 A;  2EOH A;  2GLI A;  1QNT A;  3BBG A;  5LLQ A;  3L00 A;  2WBU A;  2DLK A;  3VHT B;  1A1L A;  4JI2 E;  3HTX A;  4BBY A;  4KWY A;  1T39 A;  2YSO A;  5A6K A;  3BID A;  4WYQ B;  1WHN A;  4LTY A;  5T6J A;  2N3H A;  3UK3 C;  1FJG E;  5LL6 R;  2ELY A;  2H36 X;  2EPP A;  4O43 A;  2F4V E;  2EM3 A;  4F6M A;  5BR8 E;  5ADZ A;  4JI4 E;  2WZO A;  3THO B;  2LTR A;  1ZU1 A;  4JI1 E;  1YYK A;  2E72 A;  2JY9 A;  5AAS A;  1YSA C;  2FV4 B;  2RSI A;  4DUY E;  4DR2 E;  4GEQ B;  1YFH A;  2L92 A;  2EOF A;  1WXR A;  2M1S A;  4X66 E;  2NAB A;  3HQ1 A;  2EMZ A;  2EM5 A;  4IS1 C;  2EL5 A;  2EOZ A;  4R2P A;  1F2I G;  3T1H E;  2EN8 A;  3ADI A;  2R1F A;  3P1X A;  2EQ0 A;  2YRK A;  3C6M A;  5TSE A;  4X9J A;  5KL4 A;  1PKP A;  1A1K A;  2EMH A;  2HC5 A;  1A1F A;  5LMN E;  2LUP B;  4DR5 E;  1UN6 B;  2EM4 A;  2YU8 A;  3MHH C;  4J8Z A;  4WPY A;  2EL6 A;  1IQS A;  3MHS C;  4JI5 E;  1JK2 A;  1LLM C;  3VK6 A;  2L6M A;  3IWB A;  4WX9 A;  4BC7 A;  2EN4 A;  4MLQ A;  4O5G A;  4BS9 A;  4GKK E;  2K4V A;  4LFC E;  2EN6 A;  3EPK A;  2BBG A;  2EPA A;  5AE1 A;  2IHR 1;  5A69 A;  1PJQ A;  2B7T A;  2LT7 A;  2LE2 A;  2B3T B;  2JOB A;  3J7Y p;  2RSM A;  2L3J A;  2EM9 A;  2V88 A;  2EPL X;  4WSP A;  1DI2 A;  3JAM C;  1A1I A;  1X47 A;  3HPS A;  2RTX A;  5IWA E;  4F9A B;  2B7V A;  4BCA A;  2YTD A;  5IXM B;  3KZY A;  2WCC 3;  4LF8 E;  4L8N A;  1N3G A;  1HR0 E;  3H09 A;  4YHH E;  1DGC A;  1X6H A;  1EH8 A;  2YTG A;  4RH8 A;  2L2N A;  3ADG A;  4X65 E;  1BBG A;  2YTQ A;  2EM7 A;  4TUG A;  2FTX B;  2EPO A;  4LF5 E;  3IWC A;  2DLQ A;  1MGT A;  2EOI A;  3EQ1 A;  4LFB E;  4DV7 E;  4M2Z A;  2EJ4 A;  5A6B A;  2F8B A;  2EPN A;  4X64 E;  4HEI A;  2EN1 A;  5A6J A;  4WFT A;  2YWQ A;  2EOM A;  1HNZ E;  4O24 A;  2UUC E;  4DV2 E;  1XNQ E;  4DKK A;  4Q28 A;  2YTE A;  5FLX C;  4F9C B;  1I94 E;  2YSP A;  2EQ1 A;  2J7J A;  2JYA A;  2EN7 A;  2VQF E;  2LRS A;  1RQ0 A;  4DR1 E;  2UUA E;  2JVA A;  2EMY A;  1RC7 A;  1T4O A;  3F6H A;  2PRT A;  1QU6 A;  1UIL A;  3J81 C;  5KL7 A;  1A1J A;  2RPC A;  2CTD A;  4L5N C;  4X8W A;  2B9D A;  2EPM X;  5A2Q C;  2KON A;  1AH5 A;  2UXC E;  4I8O A;  4DR4 E;  2ELZ A;  4Q35 B;  2EMI A;  3ADJ A;  2HHH E;  3MSW A;  2G7H A;  4NHR A;  3C6K A;  2YRH A;  3OML A;  2JPA A;  2M4I A;  2EPK X;  1ZR9 A;  2V87 A;  2EN2 A;  2YTP A;  2EMK A;  3LML A;  1TF6 A;  2L2K B;  1X3C A;  4BMJ A;  3BF2 A;  4M9V C;  3KZZ A;  2YTO A;  2EMX A;  4JI6 E;  5IT9 C;  2EMA A;  2V89 A;  1RMD A;  1J26 A;  4JI8 E;  4OX9 E;  3ECR A;  1PDA A;  2EMW A;  2MC5 A;  2YTN A;  5DNY A;  2DMI A;  2UUB E;  2A25 A;  1NEI A;  2EQ3 A;  2LCE A;  4P7D A;  1TN9 A;  4F2J C;  2E5L E;  2RQL A;  3M99 B;  4DV1 E;  2UXB E;  2L3C A;  4ZYH A;  1TF3 A;  4O4K A;  1YYO A;  2EPR A;  4DV5 E;  4R03 A;  5AE3 A;  3EPH A;  1X6E A;  4WSG A;  2EOE A;  3LLH A;  2L2M A;  2V8Q B;  2UXD E;  2EOX A;  1HNX E;  5KL3 A;  2DSY A;  4LF6 E;  2M7Q A;  3AUZ A;  1A1G A;  1G2D C;  3JTZ A;  2YZT A;  2FGG A;  1ZBT A;  1UHZ A;  4BC9 A;  4R2A A;  4X62 E;  2JR1 A;  2I13 A;  2DRP A;  2BB8 A;  4DMI A;  4R2D A;  4GZN C;  4RHB B;  2LBS B;  3QG5 C;  1IQO A;  1PJT A;  3C4T A;  1YPN A;  1MEY C;  1X48 A;  5AC5 A;  1EH6 A;  4JI0 E;  2EML A;  1KJK A;  2VE7 C;  2CPN A;  1L4S A;  1EH7 A;  1GZ6 A;  1DQ3 A;  2LVH A;  4IJD A;  2EOQ A;  2R76 A;  4B3S E;  2EOS A;  4R2S A;  2DMY A;  4OOG C;  1YUJ A;  1WRJ A;  1UBD C;  4N4R B;  2N3G A;  3RMP A;  1FKA E;  4B3R E;  2ODR C;  2EWL A;  2MKN A;  3VYX A;  5KL5 A;  4ZYG A;  4TUI A;  1YZ9 A;  1YYW A;  4BHC A;  2LJH A;  1SR9 A;  1WJP A;  4K0K E;  2YPN A;  1KYQ A;  4JYA E;  4NZV A;  2GPI A;  2LTS A;  2ENC A;  3KWR A;  3EPL A;  1ZBQ A;  4KZS A;  4NXM E;  4DR7 E;  1IBK E;  1YUI A;  4ZYD A;  2EPZ A;  2EE8 A;  4M0V A;  2JWO A;  2NUG A;  2YT4 A;  1N33 E;  2EOJ A; 
#chains in the Genus database with same CATH homology
 3EPJ A;  2EMA A;  1RMD A;  2WBS A;  2EMW A;  2EN6 A;  2EOO A;  2D9H A;  2GHF A;  2MDG A;  3EPK A;  1Z1B A;  2EPA A;  5KL2 A;  2YTN A;  2EL4 A;  2YTF A;  2YTI A;  2LT7 A;  2DMI A;  1BB8 A;  2A25 A;  2LO3 A;  2CSH A;  2EMG A;  1G2F C;  2EQ3 A;  2EM8 A;  2EM9 A;  2LCE A;  1TN9 A;  4F2J C;  4R2C A;  4R2E A;  3M99 B;  2EOR A;  1TF3 A;  1A1I A;  2ENH A;  2DGC A;  2ENA A;  4F6N A;  2EPR A;  2YTD A;  2EOY A;  2CT1 A;  2WCC 3;  1JK1 A;  3EPH A;  1X6E A;  4WSG A;  1AAY A;  1ZAA C;  2YU5 A;  2EOE A;  1NCS A;  2EOH A;  1DGC A;  2GLI A;  1X6H A;  2EM0 A;  2EMC A;  2YTG A;  2WBU A;  2DLK A;  2EOX A;  2LV2 A;  2EPU A;  5KL3 A;  2YTQ A;  2EM7 A;  2EPX A;  3VHT B;  4R2Q A;  1A1L A;  4FK5 C;  1A1G A;  1G2D C;  2DLQ A;  2EOI A;  2YSO A;  1P47 A;  2ADR A;  2EJ4 A;  4R2A A;  2EN1 A;  2DRP A;  2WBT A;  1B69 A;  2MKD A;  2I13 A;  3UK3 C;  2BB8 A;  2EOM A;  2EN3 A;  2ELY A;  2EPP A;  4R2D A;  4GZN C;  2EM3 A;  4F6M A;  2HGH A;  2YTE A;  1ZU1 A;  1MEY C;  2EML A;  2EQ1 A;  2E72 A;  2YSP A;  1YSA C;  1KJK A;  2J7J A;  2M9A A;  2RSI A;  2EN7 A;  2LVH A;  4IJD A;  2EOQ A;  2EOS A;  4R2S A;  2EMY A;  1X5W A;  1YUJ A;  1UBD C;  2EOF A;  2PRT A;  5KL7 A;  2VRD A;  1A1J A;  2MKN A;  2RPC A;  2CTD A;  2EM6 A;  4R2R A;  2NAB A;  5KL6 A;  5KL5 A;  2EMZ A;  2EM5 A;  4IS1 C;  1WJP A;  2EMF A;  2EL5 A;  2EPC A;  2EOZ A;  4R2P A;  1F2I G;  2EN8 A;  1A1H A;  1X6F A;  2R1F A;  2ELZ A;  2EMI A;  2EQ0 A;  2ENC A;  2YRK A;  4X9J A;  2YRH A;  2YRM A;  5KL4 A;  2JPA A;  3EPL A;  1A1K A;  1ZR9 A;  2EN2 A;  2EMH A;  1BBO A;  2EMB A;  1A1F A;  2YTJ A;  1UN6 B;  2EM4 A;  1YUI A;  2EP3 A;  2YTP A;  2EMK A;  2YU8 A;  2EPZ A;  3MHH C;  1TF6 A;  1X3C A;  2EL6 A;  2EE8 A;  4M9V C;  3MHS C;  2YTO A;  1JK2 A;  1LLM C;  2EMX A;  2JP9 A;  2EM2 A;  2EN4 A;  2EOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...