2YZTA

Crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MRRRYRVVVERDEEGYFVAHVPELHAHTQAQSFEELLRRLQEAIAVSLEEERAEVVGLEGALEIEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHA1756
publication title Crystal structure of uncharacterized protein TTHA1756 from Thermus thermophilus HB8: Structural variety in UPF0150 family proteins.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yztA00
4P78A 2YZTA 4P7DA 2DSYA 3KWRA
chains in the Genus database with same CATH superfamily
2EOIA 3VHTB 4X8WA 4DR5E 3HPZA 4DV7E 2NABA 4F9CB 4DV3E 3TQMA 3J7Yp 4F2JC 3EPLA 2MDGA 1IBLE 2L2KB 3JU0A 2HHHE 2JWOA 1J26A 2EOOA 2UUBE 2EN7A 2B3TB 2RS7A 2ENHA 2HC5A 4X65E 1WHQA 2NA2A 2JPAA 4O5GA 4ZYEA 1I94E 1A1FA 3LMLA 4DV1E 4O24A 2KHXA 1J5EE 1XMOE 3HXLA 1ZBQA 1RC7A 2EM6A 2EN3A 4F6MA 3ECRA 4LF6E 2MKDA 3VK6A 5IWAE 2MKNA 4JI7E 2PRTA 2YZTA 2EOYA 2V88A 1P47A 4LFCE 1YPNA 3BF2A 2LV2A 1TN9A 2ENAA 4DR1E 2EZ6A 2M1SA 4KWYA 1PJQA 2L8TA 1ZR9A 1WXRA 4KZSA 2ZM6E 2YTOA 3ADLA 4RHBB 4X64E 1LLMC 2EPAA 1EH6A 2ODRD 4R2AA 5A6AA 2YT4A 2ENCA 1N36E 1QU6A 1A1JA 2GPIA 3QG5C 1ZU1A 4RH8A 1WJPA 2EN1A 3J81C 3RMPA 2B7TA 4LTYA 2RTXA 4O4KA 2DMIA 2EL6A 4ZYHA 1B69A 2DB2A 4GEQB 1A1GA 4R2QA 4JI0E 1HNWE 5AC5A 2EM7A 2LMZA 3THNA 1O0WA 2FV4B 4AQYE 4JI1E 1YYKA 2LUQA 2EWLA 4BC9A 3L00A 2EOZA 2L33A 2V85A 4X66E 2JYAA 3DJWA 2EM4A 4DUYE 2L6MA 1UBDC 2JXPA 4WXDA 3K6QA 2D9HA 1HR0E 4M30A 2JOXA 4LF9E 2WBSA 2UU9E 2EM8A 1DGCA 2E5LE 2LBSB 1N32E 4DR6E 5KL7A 4MLQA 4N4RB 4J8ZA 2VRDA 5FLXC 3H09A 2EPNA 2V8QB 2EMKA 2GLIA 2EPXA 2EN4A 4M2ZA 3AUZA 4JI2E 4WPYA 2MDRA 4JI5E 4LF8E 3VYXA 4JI3E 2M4IA 5A2QC 4JYAE 1XNRE 2UXCE 2EMAA 2LVHA 4BHCA 4WX9A 4DKKA 1PKPA 1KYQA 2EPKX 2L92A 1A1LA 2J7JA 3C4BA 2CPNA 4GZNC 3EPJA 4ZYDA 3BGHA 1T4LB 2EM9A 2YTNA 4B3RE 1IQSA 4DV6E 2LJHA 2E72A 2DIXA 1UHZA 4WSPA 1TF6A 1N33E 2M7QA 3P1XA 4DR3E 1X48A 2VE7C 5A6BD 3AV0A 2YU8A 2EQ0A 4F9AB 3JTZA 4Q35B 2YSPA 4OOGC 2JVAA 3BBGA 1T38A 3J7AG 1BB8A 4LF5E 4R2SA 2EJ4A 1GQEA 4IJDA 4R8OA 5AASA 2LE2A 3IWCA 3KZZA 4B3ME 4X62E 1WHNA 2RSIA 2EMYA 2GHFA 2WCC3 1F2IG 2LO3A 2EMLA 1JK2A 1KJKA 4YY3E 4R2DA 2F8BA 2H36X 2EN2A 2DMYA 2JY9A 5KL2A 1X47A 2YRKA 2L3CA 1QNTA 1N34E 1UILA 1X3CA 4WXCA 4BHBA 1T4OA 3EPKA 2WBTA 4JI8E 3T1HE 2LRSA 4P78A 2UUCE 2EMXA 3T1YE 4M9VC 2DLQA 2NUEA 4F9BB 4B3SE 4DV2E 1IMUA 3IWDA 2ELZA 1Z1BA 1ZBTA 2YTDA 2KOUA 4BCAA 2YPNA 1XMQE 2EPUA 2I9IA 2JR1A 5KL6A 2DRPA 2NUGA 1IQOA 4DR7E 2EMIA 4DMIA 5LLQA 1FJGE 2M9AA 2BBGA 3IWBA 2BB8A 1YUJA 3KWRA 4DV5E 4LF4E 2RSMA 2EN8A 4JI4E 2E1MA 2LJUA 4R2PA 3C4TA 4M0VA 2LTSA 4NZVA 1JK1A 4NXME 5IV8B 3ZOQB 1EH7A 1YYWA 4LFAE 3EPHA 4NXNE 1HNZE 2EMGA 2EPOA 5TSEA 4OX9E 4BC7A 1WRJA 5A69A 2CTDA 2EMWA 1PDAA 4DV4E 2EPRA 2L2NA 1PJTA 3UK3C 4BS9A 2EMHA 3FIGA 2DLKA 2EE8A 1BBOA 1STUA 1GTKA 3M99B 2YTPA 4R03A 2EOMA 4JV5E 1X6EA 1SFEA 5CFFE 4B3TE 1RMDA 1YUIA 4WSGA 2EPPA 2EP3A 1ZAAC 2N3GA 2YTEA 1T4NA 4X9JA 5KL3A 2N3HA 3MHHC 2YTFA 4YHHE 2EMCA 3F6HA 2L3JA 5IXMB 3MSWA 1TF3A 3MHSC 5DNYA 2ODRC 4R2RA 1EH8A 1IBKE 1MGTA 4R2EA 5AE2A 2YSOA 3THOB 2VQFE 2HGHA 2JOBA 2EL5A 5A6BA 2YTGA 1DQ3A 5LMNE 1YYOA 2LCEA 4HTGA 2ELYA 2FGGA 4JI6E 3OTOE 5T6JA 4GKKE 2IHR1 2EMFA 1UN6B 4LF7E 2LTRA 1NCSA 2YRHA 1X6FA 3C6KA 5AE3A 2V87A 1YFHA 3LLHA 4WYQB 3BIDA 2EMBA 2YTIA 1YZ9A 2NUFA 2FTXB 2K4VA 2I13A 1MEYC 2EPCA 2N8XA 1A1HA 2B9DA 4NHRA 1X5WA 5KL5A 5LMUE 3J80C 1EKZA 4BMJA 1G2FC 2RPCA 2EQ1A 3HQ1A 4MLVA 1A1KA 2EL4A 4F6NA 4K0KE 2Q8UA 5A6JA 1T39A 2EM5A 2CT1A 1RQ0A 2YRMA 5AE1A 3ADGA 1X49A 2EPLX 4L5NC 3KZYA 1A1IA 4F54A 4ZYGA 2HJJA 3JAMC 2EPMX 4TUGA 2EMZA 2EOSA 2LUPB 1BBGA 2K7IA 5AC4A 1NEIA 5IT9C 2EOEA 2R76A 2VF1A 1AH5A 4DR2E 5ADZA 1GZ6A 2YU5A 2RS6A 3F6GA 2EOXA 4Q28A 4L8NA 3HTXA 2EPZA 4BBYA 2MC6A 1FKAE 4O43A 2UXBE 2ADRA 3EQ1A 3OMLA 4R2CA 2EM2A 1XNQE 4I8OA 2EM0A 2CSHA 4P7DA 2EOFA 2B7VA 2EOQA 4LFBE 2R1FA 2EQ3A 1SR9A 4HEIA 2MC5A 1N3GA 1AAYA 4TUIA 2JP9A 3HPSA 2G7HA 4FK5C 2WBUA 2YWQA 2DGCA 4WFTA 2EM3A 3C6MA 4DV0E 5KL4A 4DUZE 2EORA 4IS1C 3VYYA 4DR4E 3DF6A 2DSYA 3ADIA 2RQLA 2VQEE 2V89A 5A6KA 2V83A 1DI2A 1IBME 4LU9A 5F3WA 2YTJA 4KHPE 1G2DC 2KONA 2UXDE 1YSAC 2F4VE 4GKJE 1PJSA 2L2MA 2EOHA 3ADJA 5BR8E 2UUAE 2A25A 2EN6A 2V86A 2WZOA 2EOJA 1HNXE 1L4SA 1X6HA 2LT7A 2YTQA 5LL6R
chains in the Genus database with same CATH topology
5AE3A 4B3SE 2V87A 2JOXA 4X8WA 4DV2E 4DR5E 2UU9E 3LLHA 4WYQB 2E5LE 4LF9E 3HPZA 4DV7E 3IWDA 4F9CB 4DV3E 1YZ9A 3J7Yp 2LBSB 1N32E 4DR6E 1ZBTA 2NUFA 2FTXB 2K4VA 2KOUA 1IBLE 4BCAA 2L2KB 4J8ZA 3JU0A 2B9DA 5FLXC 2JWOA 3H09A 5LMUE 2HHHE 1XMQE 3J80C 1J26A 2V8QB 4BMJA 2JR1A 1EKZA 3HQ1A 2NUGA 2UUBE 4DR7E 4DMIA 1FJGE 3IWBA 4K0KE 4M2ZA 3KWRA 3AUZA 4DV5E 2B3TB 4WPYA 2MDRA 2RS7A 4JI5E 4JI2E 2RSMA 4LF4E 4LF8E 3VYXA 4JI3E 4JI4E 2M4IA 3HTXA 4X65E 2E1MA 1WHQA 2NA2A 1RQ0A 5A2QC 4JYAE 5AE1A 1XNRE 2UXCE 1I94E 3ADGA 3C4TA 1X49A 2LTSA 3LMLA 4L5NC 4M0VA 4DKKA 4DV1E 2KHXA 4NXME 1PKPA 4F54A 1J5EE 1XMOE 3ZOQB 1YYWA 3HXLA 1ZBQA 3JAMC 4LFAE 2L92A 4TUGA 4NXNE 2LUPB 1HNZE 4OX9E 5IT9C 4BC7A 3C4BA 2CPNA 1RC7A 2VF1A 1T4LB 4LF6E 4DV4E 4DR2E 5ADZA 3VK6A 1GZ6A 5IWAE 4JI7E 4B3RE 2RS6A 3F6GA 4DV6E 2L2NA 2LJHA 2YZTA 4L8NA 2DIXA 4Q28A 4BS9A 1UHZA 2MC6A 3FIGA 4WSPA 2V88A 4BBYA 1FKAE 2UXBE 4LFCE 1STUA 1N33E 2M7QA 3OMLA 3P1XA 4DR3E 1XNQE 1X48A 2VE7C 4R03A 3AV0A 4DR1E 2EZ6A 4JV5E 4F9AB 4I8OA 5CFFE 3JTZA 4B3TE 2M1SA 4OOGC 2L8TA 4P7DA 2JVAA 3J7AG 2B7VA 4KZSA 4F9BB 1WXRA 2ZM6E 2N3GA 3ADLA 4LFBE 1T4NA 4X64E 1SR9A 4LF5E 2N3HA 2MC5A 1GQEA 4R8OA 4YHHE 3F6HA 2ODRD 5AASA 2LE2A 3IWCA 2L3JA 4B3ME 4X62E 3MSWA 4TUIA 2YT4A 1WHNA 1N36E 1QU6A 3HPSA 2ODRC 5DNYA 1IBKE 2G7HA 5AE2A 4WFTA 3J81C 3RMPA 2B7TA 2VQFE 4LTYA 4YY3E 2JOBA 4DV0E 2F8BA 2H36X 4DUZE 2RTXA 1DQ3A 2DMYA 5LMNE 3VYYA 2DB2A 4GEQB 4DR4E 2JY9A 2DSYA 3DF6A 1YYOA 4JI0E 1HNWE 3ADIA 2LMZA 2VQEE 1X47A 1O0WA 2FV4B 2V89A 4AQYE 2V83A 2L3CA 4JI1E 1YYKA 2LUQA 2EWLA 4BC9A 1N34E 2FGGA 1UILA 4LU9A 1IBME 4JI6E 1DI2A 2L33A 2V85A 5F3WA 4X66E 3DJWA 4KHPE 1T4OA 3OTOE 5T6JA 4GKKE 2KONA 4DUYE 2UXDE 2L6MA 2F4VE 2IHR1 4GKJE 2L2MA 4JI8E 3T1HE 2LRSA 3ADJA 4P78A 4LF7E 5BR8E 2UUAE 2LTRA 2V86A 2WZOA 2UUCE 3T1YE 1HNXE 3K6QA 1HR0E 2NUEA 4M30A 5LL6R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P78 A;  2YZT A;  4P7D A;  2DSY A;  3KWR A; 
#chains in the Genus database with same CATH topology
 2EOI A;  3VHT B;  4X8W A;  4DR5 E;  3HPZ A;  4DV7 E;  2NAB A;  4F9C B;  4DV3 E;  3TQM A;  3J7Y p;  4F2J C;  3EPL A;  2MDG A;  1IBL E;  2L2K B;  3JU0 A;  2HHH E;  2JWO A;  1J26 A;  2EOO A;  2UUB E;  2EN7 A;  2B3T B;  2RS7 A;  2ENH A;  2HC5 A;  4X65 E;  1WHQ A;  2NA2 A;  2JPA A;  4O5G A;  4ZYE A;  1I94 E;  1A1F A;  3LML A;  4DV1 E;  4O24 A;  2KHX A;  1J5E E;  1XMO E;  3HXL A;  1ZBQ A;  1RC7 A;  2EM6 A;  2EN3 A;  4F6M A;  3ECR A;  4LF6 E;  2MKD A;  3VK6 A;  5IWA E;  2MKN A;  4JI7 E;  2PRT A;  2YZT A;  2EOY A;  2V88 A;  1P47 A;  4LFC E;  1YPN A;  3BF2 A;  2LV2 A;  1TN9 A;  2ENA A;  4DR1 E;  2EZ6 A;  2M1S A;  4KWY A;  1PJQ A;  2L8T A;  1ZR9 A;  1WXR A;  4KZS A;  2ZM6 E;  2YTO A;  3ADL A;  4RHB B;  4X64 E;  1LLM C;  2EPA A;  1EH6 A;  2ODR D;  4R2A A;  5A6A A;  2YT4 A;  2ENC A;  1N36 E;  1QU6 A;  1A1J A;  2GPI A;  3QG5 C;  1ZU1 A;  4RH8 A;  1WJP A;  2EN1 A;  3J81 C;  3RMP A;  2B7T A;  4LTY A;  2RTX A;  4O4K A;  2DMI A;  2EL6 A;  4ZYH A;  1B69 A;  2DB2 A;  4GEQ B;  1A1G A;  4R2Q A;  4JI0 E;  1HNW E;  5AC5 A;  2EM7 A;  2LMZ A;  3THN A;  1O0W A;  2FV4 B;  4AQY E;  4JI1 E;  1YYK A;  2LUQ A;  2EWL A;  4BC9 A;  3L00 A;  2EOZ A;  2L33 A;  2V85 A;  4X66 E;  2JYA A;  3DJW A;  2EM4 A;  4DUY E;  2L6M A;  1UBD C;  2JXP A;  4WXD A;  3K6Q A;  2D9H A;  1HR0 E;  4M30 A;  2JOX A;  4LF9 E;  2WBS A;  2UU9 E;  2EM8 A;  1DGC A;  2E5L E;  2LBS B;  1N32 E;  4DR6 E;  5KL7 A;  4MLQ A;  4N4R B;  4J8Z A;  2VRD A;  5FLX C;  3H09 A;  2EPN A;  2V8Q B;  2EMK A;  2GLI A;  2EPX A;  2EN4 A;  4M2Z A;  3AUZ A;  4JI2 E;  4WPY A;  2MDR A;  4JI5 E;  4LF8 E;  3VYX A;  4JI3 E;  2M4I A;  5A2Q C;  4JYA E;  1XNR E;  2UXC E;  2EMA A;  2LVH A;  4BHC A;  4WX9 A;  4DKK A;  1PKP A;  1KYQ A;  2EPK X;  2L92 A;  1A1L A;  2J7J A;  3C4B A;  2CPN A;  4GZN C;  3EPJ A;  4ZYD A;  3BGH A;  1T4L B;  2EM9 A;  2YTN A;  4B3R E;  1IQS A;  4DV6 E;  2LJH A;  2E72 A;  2DIX A;  1UHZ A;  4WSP A;  1TF6 A;  1N33 E;  2M7Q A;  3P1X A;  4DR3 E;  1X48 A;  2VE7 C;  5A6B D;  3AV0 A;  2YU8 A;  2EQ0 A;  4F9A B;  3JTZ A;  4Q35 B;  2YSP A;  4OOG C;  2JVA A;  3BBG A;  1T38 A;  3J7A G;  1BB8 A;  4LF5 E;  4R2S A;  2EJ4 A;  1GQE A;  4IJD A;  4R8O A;  5AAS A;  2LE2 A;  3IWC A;  3KZZ A;  4B3M E;  4X62 E;  1WHN A;  2RSI A;  2EMY A;  2GHF A;  2WCC 3;  1F2I G;  2LO3 A;  2EML A;  1JK2 A;  1KJK A;  4YY3 E;  4R2D A;  2F8B A;  2H36 X;  2EN2 A;  2DMY A;  2JY9 A;  5KL2 A;  1X47 A;  2YRK A;  2L3C A;  1QNT A;  1N34 E;  1UIL A;  1X3C A;  4WXC A;  4BHB A;  1T4O A;  3EPK A;  2WBT A;  4JI8 E;  3T1H E;  2LRS A;  4P78 A;  2UUC E;  2EMX A;  3T1Y E;  4M9V C;  2DLQ A;  2NUE A;  4F9B B;  4B3S E;  4DV2 E;  1IMU A;  3IWD A;  2ELZ A;  1Z1B A;  1ZBT A;  2YTD A;  2KOU A;  4BCA A;  2YPN A;  1XMQ E;  2EPU A;  2I9I A;  2JR1 A;  5KL6 A;  2DRP A;  2NUG A;  1IQO A;  4DR7 E;  2EMI A;  4DMI A;  5LLQ A;  1FJG E;  2M9A A;  2BBG A;  3IWB A;  2BB8 A;  1YUJ A;  3KWR A;  4DV5 E;  4LF4 E;  2RSM A;  2EN8 A;  4JI4 E;  2E1M A;  2LJU A;  4R2P A;  3C4T A;  4M0V A;  2LTS A;  4NZV A;  1JK1 A;  4NXM E;  5IV8 B;  3ZOQ B;  1EH7 A;  1YYW A;  4LFA E;  3EPH A;  4NXN E;  1HNZ E;  2EMG A;  2EPO A;  5TSE A;  4OX9 E;  4BC7 A;  1WRJ A;  5A69 A;  2CTD A;  2EMW A;  1PDA A;  4DV4 E;  2EPR A;  2L2N A;  1PJT A;  3UK3 C;  4BS9 A;  2EMH A;  3FIG A;  2DLK A;  2EE8 A;  1BBO A;  1STU A;  1GTK A;  3M99 B;  2YTP A;  4R03 A;  2EOM A;  4JV5 E;  1X6E A;  1SFE A;  5CFF E;  4B3T E;  1RMD A;  1YUI A;  4WSG A;  2EPP A;  2EP3 A;  1ZAA C;  2N3G A;  2YTE A;  1T4N A;  4X9J A;  5KL3 A;  2N3H A;  3MHH C;  2YTF A;  4YHH E;  2EMC A;  3F6H A;  2L3J A;  5IXM B;  3MSW A;  1TF3 A;  3MHS C;  5DNY A;  2ODR C;  4R2R A;  1EH8 A;  1IBK E;  1MGT A;  4R2E A;  5AE2 A;  2YSO A;  3THO B;  2VQF E;  2HGH A;  2JOB A;  2EL5 A;  5A6B A;  2YTG A;  1DQ3 A;  5LMN E;  1YYO A;  2LCE A;  4HTG A;  2ELY A;  2FGG A;  4JI6 E;  3OTO E;  5T6J A;  4GKK E;  2IHR 1;  2EMF A;  1UN6 B;  4LF7 E;  2LTR A;  1NCS A;  2YRH A;  1X6F A;  3C6K A;  5AE3 A;  2V87 A;  1YFH A;  3LLH A;  4WYQ B;  3BID A;  2EMB A;  2YTI A;  1YZ9 A;  2NUF A;  2FTX B;  2K4V A;  2I13 A;  1MEY C;  2EPC A;  2N8X A;  1A1H A;  2B9D A;  4NHR A;  1X5W A;  5KL5 A;  5LMU E;  3J80 C;  1EKZ A;  4BMJ A;  1G2F C;  2RPC A;  2EQ1 A;  3HQ1 A;  4MLV A;  1A1K A;  2EL4 A;  4F6N A;  4K0K E;  2Q8U A;  5A6J A;  1T39 A;  2EM5 A;  2CT1 A;  1RQ0 A;  2YRM A;  5AE1 A;  3ADG A;  1X49 A;  2EPL X;  4L5N C;  3KZY A;  1A1I A;  4F54 A;  4ZYG A;  2HJJ A;  3JAM C;  2EPM X;  4TUG A;  2EMZ A;  2EOS A;  2LUP B;  1BBG A;  2K7I A;  5AC4 A;  1NEI A;  5IT9 C;  2EOE A;  2R76 A;  2VF1 A;  1AH5 A;  4DR2 E;  5ADZ A;  1GZ6 A;  2YU5 A;  2RS6 A;  3F6G A;  2EOX A;  4Q28 A;  4L8N A;  3HTX A;  2EPZ A;  4BBY A;  2MC6 A;  1FKA E;  4O43 A;  2UXB E;  2ADR A;  3EQ1 A;  3OML A;  4R2C A;  2EM2 A;  1XNQ E;  4I8O A;  2EM0 A;  2CSH A;  4P7D A;  2EOF A;  2B7V A;  2EOQ A;  4LFB E;  2R1F A;  2EQ3 A;  1SR9 A;  4HEI A;  2MC5 A;  1N3G A;  1AAY A;  4TUI A;  2JP9 A;  3HPS A;  2G7H A;  4FK5 C;  2WBU A;  2YWQ A;  2DGC A;  4WFT A;  2EM3 A;  3C6M A;  4DV0 E;  5KL4 A;  4DUZ E;  2EOR A;  4IS1 C;  3VYY A;  4DR4 E;  3DF6 A;  2DSY A;  3ADI A;  2RQL A;  2VQE E;  2V89 A;  5A6K A;  2V83 A;  1DI2 A;  1IBM E;  4LU9 A;  5F3W A;  2YTJ A;  4KHP E;  1G2D C;  2KON A;  2UXD E;  1YSA C;  2F4V E;  4GKJ E;  1PJS A;  2L2M A;  2EOH A;  3ADJ A;  5BR8 E;  2UUA E;  2A25 A;  2EN6 A;  2V86 A;  2WZO A;  2EOJ A;  1HNX E;  1L4S A;  1X6H A;  2LT7 A;  2YTQ A;  5LL6 R; 
#chains in the Genus database with same CATH homology
 5AE3 A;  4B3S E;  2V87 A;  2JOX A;  4X8W A;  4DV2 E;  4DR5 E;  2UU9 E;  3LLH A;  4WYQ B;  2E5L E;  4LF9 E;  3HPZ A;  4DV7 E;  3IWD A;  4F9C B;  4DV3 E;  1YZ9 A;  3J7Y p;  2LBS B;  1N32 E;  4DR6 E;  1ZBT A;  2NUF A;  2FTX B;  2K4V A;  2KOU A;  1IBL E;  4BCA A;  2L2K B;  4J8Z A;  3JU0 A;  2B9D A;  5FLX C;  2JWO A;  3H09 A;  5LMU E;  2HHH E;  1XMQ E;  3J80 C;  1J26 A;  2V8Q B;  4BMJ A;  2JR1 A;  1EKZ A;  3HQ1 A;  2NUG A;  2UUB E;  4DR7 E;  4DMI A;  1FJG E;  3IWB A;  4K0K E;  4M2Z A;  3KWR A;  3AUZ A;  4DV5 E;  2B3T B;  4WPY A;  2MDR A;  2RS7 A;  4JI5 E;  4JI2 E;  2RSM A;  4LF4 E;  4LF8 E;  3VYX A;  4JI3 E;  4JI4 E;  2M4I A;  3HTX A;  4X65 E;  2E1M A;  1WHQ A;  2NA2 A;  1RQ0 A;  5A2Q C;  4JYA E;  5AE1 A;  1XNR E;  2UXC E;  1I94 E;  3ADG A;  3C4T A;  1X49 A;  2LTS A;  3LML A;  4L5N C;  4M0V A;  4DKK A;  4DV1 E;  2KHX A;  4NXM E;  1PKP A;  4F54 A;  1J5E E;  1XMO E;  3ZOQ B;  1YYW A;  3HXL A;  1ZBQ A;  3JAM C;  4LFA E;  2L92 A;  4TUG A;  4NXN E;  2LUP B;  1HNZ E;  4OX9 E;  5IT9 C;  4BC7 A;  3C4B A;  2CPN A;  1RC7 A;  2VF1 A;  1T4L B;  4LF6 E;  4DV4 E;  4DR2 E;  5ADZ A;  3VK6 A;  1GZ6 A;  5IWA E;  4JI7 E;  4B3R E;  2RS6 A;  3F6G A;  4DV6 E;  2L2N A;  2LJH A;  2YZT A;  4L8N A;  2DIX A;  4Q28 A;  4BS9 A;  1UHZ A;  2MC6 A;  3FIG A;  4WSP A;  2V88 A;  4BBY A;  1FKA E;  2UXB E;  4LFC E;  1STU A;  1N33 E;  2M7Q A;  3OML A;  3P1X A;  4DR3 E;  1XNQ E;  1X48 A;  2VE7 C;  4R03 A;  3AV0 A;  4DR1 E;  2EZ6 A;  4JV5 E;  4F9A B;  4I8O A;  5CFF E;  3JTZ A;  4B3T E;  2M1S A;  4OOG C;  2L8T A;  4P7D A;  2JVA A;  3J7A G;  2B7V A;  4KZS A;  4F9B B;  1WXR A;  2ZM6 E;  2N3G A;  3ADL A;  4LFB E;  1T4N A;  4X64 E;  1SR9 A;  4LF5 E;  2N3H A;  2MC5 A;  1GQE A;  4R8O A;  4YHH E;  3F6H A;  2ODR D;  5AAS A;  2LE2 A;  3IWC A;  2L3J A;  4B3M E;  4X62 E;  3MSW A;  4TUI A;  2YT4 A;  1WHN A;  1N36 E;  1QU6 A;  3HPS A;  2ODR C;  5DNY A;  1IBK E;  2G7H A;  5AE2 A;  4WFT A;  3J81 C;  3RMP A;  2B7T A;  2VQF E;  4LTY A;  4YY3 E;  2JOB A;  4DV0 E;  2F8B A;  2H36 X;  4DUZ E;  2RTX A;  1DQ3 A;  2DMY A;  5LMN E;  3VYY A;  2DB2 A;  4GEQ B;  4DR4 E;  2JY9 A;  2DSY A;  3DF6 A;  1YYO A;  4JI0 E;  1HNW E;  3ADI A;  2LMZ A;  2VQE E;  1X47 A;  1O0W A;  2FV4 B;  2V89 A;  4AQY E;  2V83 A;  2L3C A;  4JI1 E;  1YYK A;  2LUQ A;  2EWL A;  4BC9 A;  1N34 E;  2FGG A;  1UIL A;  4LU9 A;  1IBM E;  4JI6 E;  1DI2 A;  2L33 A;  2V85 A;  5F3W A;  4X66 E;  3DJW A;  4KHP E;  1T4O A;  3OTO E;  5T6J A;  4GKK E;  2KON A;  4DUY E;  2UXD E;  2L6M A;  2F4V E;  2IHR 1;  4GKJ E;  2L2M A;  4JI8 E;  3T1H E;  2LRS A;  3ADJ A;  4P78 A;  4LF7 E;  5BR8 E;  2UUA E;  2LTR A;  2V86 A;  2WZO A;  2UUC E;  3T1Y E;  1HNX E;  3K6Q A;  1HR0 E;  2NUE A;  4M30 A;  5LL6 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...