2YZTA

Crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MRRRYRVVVERDEEGYFVAHVPELHAHTQAQSFEELLRRLQEAIAVSLEEERAEVVGLEGALEIEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein TTHA1756 from Thermus thermophilus HB8: Structural variety in UPF0150 family proteins.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA1756
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yztA00
3KWRA 4P7DA 4P78A 2DSYA 2YZTA
chains in the Genus database with same CATH superfamily
2RTXA 2DMYA 2E5LE 1PDAA 2NUEA 4WYQB 1LLMC 5KL5A 1T4LB 2EQ0A 4MLQA 1SFEA 4ZYEA 2LJHA 4L5NC 2EN2A 1BBOA 2YZTA 5BR8E 4JYAE 2EJ4A 1WJPA 4R8OA 2VQEE 2NUFA 2EM0A 2HJJA 4WSPA 1N3GA 2YRMA 4BCAA 4RH8A 2EPRA 2NABA 2EM6A 1RC7A 1N34E 1T38A 3EPKA 3C4TA 5AASA 2N3HA 3JU0A 2VE7C 1P47A 1X49A 1DI2A 3HPZA 2ENCA 4Q28A 1HNWE 2L3JA 2DLKA 3M99B 1XNRE 3JTZA 1IBLE 1EH6A 2B7VA 2CT1A 2BB8A 2EMXA 2DRPA 1PJTA 3J81C 1RQ0A 1T39A 4BHCA 1UILA 2YSOA 4LF7E 4B3TE 2WBTA 4X65E 2EOXA 3EPHA 5IV8B 5F3WA 2IHR1 4J8ZA 2EL6A 2YTDA 2RSIA 1UBDC 1WHNA 4OOGC 3C6KA 1EKZA 1L4SA 2CSHA 1QU6A 3T1HE 2RS6A 1PJSA 2EQ1A 4I8OA 4NHRA 1NCSA 4TUIA 4DR3E 4N4RB 2EMKA 1T4NA 3RMPA 4LF4E 1X6HA 2EPPA 2EM5A 3MHHC 4P7DA 2RSMA 2GPIA 4YHHE 2FV4B 2EE8A 2DB2A 1ZR9A 1JK1A 2EM4A 1XMQE 2L2MA 4DV0E 1HNXE 2M1SA 5CFFE 1AH5A 2EPZA 4DV4E 3F6GA 1N32E 1F2IG 2EWLA 3MSWA 1X5WA 1FJGE 4TUGA 2LV2A 2ODRC 2YTIA 1RMDA 2B9DA 2YSPA 4R2DA 2WZOA 5LLQA 4B3ME 2EPUA 2UXDE 4ZYGA 2LBSB 2LO3A 2YT4A 3ADJA 5KL2A 3HQ1A 2V8QB 4WXDA 5A6JA 2EL5A 1A1GA 2B7TA 5IWAE 2DMIA 5A2QC 1YUIA 1UN6B 2WBUA 2RQLA 3K6QA 5A6AA 4LF8E 2F8BA 2EPCA 2YWQA 3ADLA 2EOMA 3ECRA 1UHZA 5AE2A 3EQ1A 2EOIA 2E72A 3LMLA 1MGTA 1A1FA 3THOB 1G2FC 3LLHA 4LF6E 2YTJA 2PRTA 1YZ9A 1PJQA 4AQYE 4JI5E 2M7QA 4GKJE 1A1HA 3ADIA 3BF2A 2EOZA 2NA2A 2EMGA 4YY3E 4DV7E 5IT9C 4KWYA 2L2KB 2L6MA 4JI8E 4NXNE 2RS7A 5TSEA 5T6JA 2RPCA 3ADGA 3C6MA 2EQ3A 2CPNA 3IWDA 4BC9A 2EPNA 4DV2E 1AAYA 1ZBQA 2YRKA 2ODRD 1G2DC 1J26A 2EOJA 1TN9A 2MKNA 1Z1BA 2DGCA 3HTXA 3ZOQB 4F54A 4GZNC 2JP9A 2N3GA 2YTOA 3VHTB 2JY9A 4HEIA 4X64E 4JI7E 2ZM6E 2I13A 2YTFA 2E1MA 1J5EE 2LTSA 1GQEA 1GZ6A 2EMCA 3KZZA 2JXPA 1ZBTA 4WXCA 1WXRA 1YYOA 3EPLA 5A6BA 1X3CA 2EN3A 4BC7A 4DV5E 5KL7A 4WPYA 2H36X 3QG5C 4JI2E 5AE3A 2GLIA 2LVHA 3AV0A 1X6EA 4O24A 2V85A 5DNYA 5LMUE 2V89A 1KYQA 5KL4A 1A1JA 3DF6A 4X9JA 4OX9E 1MEYC 1YPNA 5LL6R 2JPAA 2EZ6A 2YPNA 4KHPE 2VQFE 3OMLA 4BBYA 1A1LA 5ADZA 2V86A 1YYKA 2LMZA 2EMWA 1YFHA 2EP3A 2FGGA 4DR4E 3JAMC 2UXBE 2CTDA 2EN6A 2EMZA 4O43A 2ENAA 3VK6A 4LU9A 4R03A 5KL6A 4DUYE 1FKAE 2EN1A 2KHXA 4B3SE 4R2PA 2EM3A 1IQOA 2UU9E 2G7HA 4JI1E 2EOQA 3H09A 3J7Yp 2F4VE 1I94E 1WHQA 2EM2A 4B3RE 2EL4A 5LMNE 3KWRA 4WX9A 4MLVA 2EPAA 2UUAE 2D9HA 2M4IA 2ENHA 4BHBA 2EM8A 2V87A 4DR6E 2LE2A 2UUBE 2JOBA 4GEQB 4O5GA 2I9IA 3VYXA 2WBSA 1TF6A 4JI4E 2UXCE 3F6HA 3EPJA 2VF1A 1YSAC 2KOUA 1T4OA 4LFCE 5AC4A 2HHHE 4JI0E 4M0VA 4ZYHA 2JYAA 2LUPB 2VRDA 4IJDA 2YTEA 4LF5E 3TQMA 1JK2A 4F2JC 1IBKE 4R2SA 1WRJA 2V83A 2ELZA 4JV5E 1X6FA 4DKKA 2B3TB 2LJUA 1IBME 4HTGA 2YTQA 4DUZE 2EMHA 4LFBE 2J7JA 2LCEA 2HGHA 2K4VA 1BBGA 4FK5C 2ADRA 2EN4A 2YTGA 2NUGA 2JVAA 4GKKE 1NEIA 5AE1A 4JI3E 2HC5A 4K0KE 4RHBB 4R2AA 2L3CA 4IS1C 2R76A 2EOEA 2EOFA 4X66E 2EM9A 2K7IA 1HR0E 2EN7A 4LF9E 3J7AG 1B69A 2BBGA 2MC6A 2EPLX 3J80C 4X62E 2EPOA 2EN8A 2EM7A 4LTYA 2EOHA 4R2CA 2MDGA 2L33A 2GHFA 2MC5A 5IXMB 2JR1A 3T1YE 2JWOA 4KZSA 4LFAE 4DV3E 2EMYA 5AC5A 4ZYDA 4M2ZA 1O0WA 4R2EA 1IMUA 1DQ3A 4DR2E 2YTPA 2EMBA 2LUQA 2YU5A 1QNTA 1TF3A 2Q8UA 1YUJA 4NXME 3BBGA 1IQSA 4DR5E 1DGCA 2N8XA 4F6NA 1EH8A 4DR1E 3P1XA 2EORA 4R2QA 4L8NA 5KL3A 5A69A 3THNA 1X47A 3OTOE 3VYYA 3L00A 1N36E 1A1KA 4DR7E 5FLXC 2EPMX 1KJKA 4JI6E 3AUZA 4F9BB 2MKDA 2EOOA 2EPKX 2LTRA 1N33E 4R2RA 2YTNA 3BIDA 5A6BD 2M9AA 2R1FA 3BGHA 3MHSC 3C4BA 3KZYA 2DSYA 2DIXA 2L8TA 3IWBA 5A6KA 2MDRA 2L92A 1X48A 1ZU1A 1STUA 1HNZE 4DV1E 4X8WA 3HPSA 4WFTA 2KONA 2EPXA 2EMIA 4F9AB 1XMOE 1BB8A 2YU8A 3FIGA 2LT7A 2V88A 2LRSA 2EMFA 4DMIA 4BS9A 3IWCA 1XNQE 4P78A 3DJWA 2UUCE 2WCC3 2EOSA 2JOXA 1SR9A 4NZVA 4F6MA 1A1IA 2EOYA 1YYWA 2A25A 1ZAAC 3UK3C 4BMJA 2YRHA 1PKPA 2EMLA 2L2NA 1GTKA 4DV6E 2EMAA 2DLQA 4Q35B 1EH7A 3HXLA 2ELYA 4F9CB 4WSGA 4M30A 4M9VC 4O4KA 2FTXB
chains in the Genus database with same CATH topology
2ODRC 5ADZA 2V86A 1YYKA 2LMZA 4LTYA 2RTXA 2DMYA 2E5LE 2B9DA 2NUEA 2WZOA 4B3ME 2FGGA 2L33A 4WYQB 3JAMC 4DR4E 2MC5A 2UXDE 2JR1A 2UXBE 3T1YE 2JWOA 4KZSA 2LBSB 4DV3E 1T4LB 2YT4A 4LU9A 3VK6A 4LFAE 3ADJA 4M2ZA 4R03A 3HQ1A 2LJHA 2V8QB 4L5NC 1O0WA 4BBYA 2YZTA 5BR8E 4JYAE 1DQ3A 2B7TA 4DUYE 4R8OA 5IWAE 5A2QC 2KHXA 2VQEE 4DR2E 1FKAE 2LUQA 2NUFA 4B3SE 4WSPA 2UU9E 2G7HA 4JI1E 3H09A 3J7Yp 2F4VE 1I94E 3K6QA 4BCAA 4NXME 1WHQA 4LF8E 2F8BA 4B3RE 4DR5E 5LMNE 1RC7A 1N34E 3ADLA 3KWRA 1UHZA 5AE2A 3C4TA 4DR1E 3P1XA 5AASA 2UUAE 3LMLA 2N3HA 3JU0A 2M4IA 2VE7C 4L8NA 1X49A 2V87A 1X47A 1DI2A 4DR6E 3LLHA 4LF6E 3HPZA 2HHHE 2LE2A 4Q28A 3OTOE 3VYYA 2UUBE 2L3JA 1N36E 2JOBA 4GEQB 1YZ9A 4AQYE 4JI5E 5FLXC 4DR7E 2M7QA 1XNRE 4GKJE 3JTZA 1IBLE 4JI6E 3ADIA 3VYXA 2B7VA 3AUZA 4F9BB 4JI4E 2UXCE 3F6HA 2LTRA 1N33E 2NA2A 3J81C 2VF1A 4YY3E 1RQ0A 4DV7E 5IT9C 2KOUA 1HNWE 1FJGE 1T4OA 1UILA 4LF7E 2L2KB 2L6MA 4JI8E 4B3TE 2RS7A 4NXNE 3C4BA 5T6JA 2DSYA 3ADGA 4LFCE 2DIXA 2CPNA 2L8TA 3IWBA 3IWDA 4M0VA 4BC9A 4X65E 1ZBQA 4DV2E 2ODRD 1J26A 2MDRA 5F3WA 2LUPB 2IHR1 4J8ZA 2L92A 1X48A 3HTXA 3ZOQB 4F54A 4LF5E 1STUA 2N3GA 1IBKE 1WHNA 2JY9A 4OOGC 4X64E 4JI7E 2ZM6E 1HNZE 4JI0E 2V83A 4X8WA 4DV1E 4JV5E 2E1MA 3HPSA 4WFTA 2KONA 4DKKA 1J5EE 2LTSA 1GQEA 4F9AB 1GZ6A 1XMOE 2B3TB 1ZBTA 1EKZA 1IBME 3FIGA 1WXRA 2V88A 2LRSA 1YYOA 4DMIA 4BC7A 4DV5E 4BS9A 1QU6A 2H36X 4WPYA 4DUZE 2RS6A 3T1HE 3IWCA 4LFBE 4I8OA 1XNQE 4P78A 3DJWA 4TUIA 2UUCE 4DR3E 4JI2E 5AE3A 2K4VA 4X62E 1T4NA 2JOXA 1SR9A 2JVAA 3RMPA 2NUGA 4GKKE 5AE1A 4LF4E 4JI3E 3AV0A 4K0KE 2V85A 1YYWA 5DNYA 2L3CA 5LMUE 4P7DA 2RSMA 2V89A 4BMJA 4YHHE 1PKPA 2FV4B 2L2NA 4X66E 4KHPE 2DB2A 4DV6E 1XMQE 3DF6A 1HR0E 4OX9E 4LF9E 2L2MA 4DV0E 1HNXE 3J7AG 5LL6R 2M1SA 5CFFE 2EZ6A 3HXLA 4F9CB 2MC6A 4M30A 3F6GA 3J80C 2VQFE 2EWLA 3MSWA 2FTXB 3OMLA 4DV4E 1N32E 4TUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWR A;  4P7D A;  4P78 A;  2DSY A;  2YZT A; 
#chains in the Genus database with same CATH topology
 2RTX A;  2DMY A;  2E5L E;  1PDA A;  2NUE A;  4WYQ B;  1LLM C;  5KL5 A;  1T4L B;  2EQ0 A;  4MLQ A;  1SFE A;  4ZYE A;  2LJH A;  4L5N C;  2EN2 A;  1BBO A;  2YZT A;  5BR8 E;  4JYA E;  2EJ4 A;  1WJP A;  4R8O A;  2VQE E;  2NUF A;  2EM0 A;  2HJJ A;  4WSP A;  1N3G A;  2YRM A;  4BCA A;  4RH8 A;  2EPR A;  2NAB A;  2EM6 A;  1RC7 A;  1N34 E;  1T38 A;  3EPK A;  3C4T A;  5AAS A;  2N3H A;  3JU0 A;  2VE7 C;  1P47 A;  1X49 A;  1DI2 A;  3HPZ A;  2ENC A;  4Q28 A;  1HNW E;  2L3J A;  2DLK A;  3M99 B;  1XNR E;  3JTZ A;  1IBL E;  1EH6 A;  2B7V A;  2CT1 A;  2BB8 A;  2EMX A;  2DRP A;  1PJT A;  3J81 C;  1RQ0 A;  1T39 A;  4BHC A;  1UIL A;  2YSO A;  4LF7 E;  4B3T E;  2WBT A;  4X65 E;  2EOX A;  3EPH A;  5IV8 B;  5F3W A;  2IHR 1;  4J8Z A;  2EL6 A;  2YTD A;  2RSI A;  1UBD C;  1WHN A;  4OOG C;  3C6K A;  1EKZ A;  1L4S A;  2CSH A;  1QU6 A;  3T1H E;  2RS6 A;  1PJS A;  2EQ1 A;  4I8O A;  4NHR A;  1NCS A;  4TUI A;  4DR3 E;  4N4R B;  2EMK A;  1T4N A;  3RMP A;  4LF4 E;  1X6H A;  2EPP A;  2EM5 A;  3MHH C;  4P7D A;  2RSM A;  2GPI A;  4YHH E;  2FV4 B;  2EE8 A;  2DB2 A;  1ZR9 A;  1JK1 A;  2EM4 A;  1XMQ E;  2L2M A;  4DV0 E;  1HNX E;  2M1S A;  5CFF E;  1AH5 A;  2EPZ A;  4DV4 E;  3F6G A;  1N32 E;  1F2I G;  2EWL A;  3MSW A;  1X5W A;  1FJG E;  4TUG A;  2LV2 A;  2ODR C;  2YTI A;  1RMD A;  2B9D A;  2YSP A;  4R2D A;  2WZO A;  5LLQ A;  4B3M E;  2EPU A;  2UXD E;  4ZYG A;  2LBS B;  2LO3 A;  2YT4 A;  3ADJ A;  5KL2 A;  3HQ1 A;  2V8Q B;  4WXD A;  5A6J A;  2EL5 A;  1A1G A;  2B7T A;  5IWA E;  2DMI A;  5A2Q C;  1YUI A;  1UN6 B;  2WBU A;  2RQL A;  3K6Q A;  5A6A A;  4LF8 E;  2F8B A;  2EPC A;  2YWQ A;  3ADL A;  2EOM A;  3ECR A;  1UHZ A;  5AE2 A;  3EQ1 A;  2EOI A;  2E72 A;  3LML A;  1MGT A;  1A1F A;  3THO B;  1G2F C;  3LLH A;  4LF6 E;  2YTJ A;  2PRT A;  1YZ9 A;  1PJQ A;  4AQY E;  4JI5 E;  2M7Q A;  4GKJ E;  1A1H A;  3ADI A;  3BF2 A;  2EOZ A;  2NA2 A;  2EMG A;  4YY3 E;  4DV7 E;  5IT9 C;  4KWY A;  2L2K B;  2L6M A;  4JI8 E;  4NXN E;  2RS7 A;  5TSE A;  5T6J A;  2RPC A;  3ADG A;  3C6M A;  2EQ3 A;  2CPN A;  3IWD A;  4BC9 A;  2EPN A;  4DV2 E;  1AAY A;  1ZBQ A;  2YRK A;  2ODR D;  1G2D C;  1J26 A;  2EOJ A;  1TN9 A;  2MKN A;  1Z1B A;  2DGC A;  3HTX A;  3ZOQ B;  4F54 A;  4GZN C;  2JP9 A;  2N3G A;  2YTO A;  3VHT B;  2JY9 A;  4HEI A;  4X64 E;  4JI7 E;  2ZM6 E;  2I13 A;  2YTF A;  2E1M A;  1J5E E;  2LTS A;  1GQE A;  1GZ6 A;  2EMC A;  3KZZ A;  2JXP A;  1ZBT A;  4WXC A;  1WXR A;  1YYO A;  3EPL A;  5A6B A;  1X3C A;  2EN3 A;  4BC7 A;  4DV5 E;  5KL7 A;  4WPY A;  2H36 X;  3QG5 C;  4JI2 E;  5AE3 A;  2GLI A;  2LVH A;  3AV0 A;  1X6E A;  4O24 A;  2V85 A;  5DNY A;  5LMU E;  2V89 A;  1KYQ A;  5KL4 A;  1A1J A;  3DF6 A;  4X9J A;  4OX9 E;  1MEY C;  1YPN A;  5LL6 R;  2JPA A;  2EZ6 A;  2YPN A;  4KHP E;  2VQF E;  3OML A;  4BBY A;  1A1L A;  5ADZ A;  2V86 A;  1YYK A;  2LMZ A;  2EMW A;  1YFH A;  2EP3 A;  2FGG A;  4DR4 E;  3JAM C;  2UXB E;  2CTD A;  2EN6 A;  2EMZ A;  4O43 A;  2ENA A;  3VK6 A;  4LU9 A;  4R03 A;  5KL6 A;  4DUY E;  1FKA E;  2EN1 A;  2KHX A;  4B3S E;  4R2P A;  2EM3 A;  1IQO A;  2UU9 E;  2G7H A;  4JI1 E;  2EOQ A;  3H09 A;  3J7Y p;  2F4V E;  1I94 E;  1WHQ A;  2EM2 A;  4B3R E;  2EL4 A;  5LMN E;  3KWR A;  4WX9 A;  4MLV A;  2EPA A;  2UUA E;  2D9H A;  2M4I A;  2ENH A;  4BHB A;  2EM8 A;  2V87 A;  4DR6 E;  2LE2 A;  2UUB E;  2JOB A;  4GEQ B;  4O5G A;  2I9I A;  3VYX A;  2WBS A;  1TF6 A;  4JI4 E;  2UXC E;  3F6H A;  3EPJ A;  2VF1 A;  1YSA C;  2KOU A;  1T4O A;  4LFC E;  5AC4 A;  2HHH E;  4JI0 E;  4M0V A;  4ZYH A;  2JYA A;  2LUP B;  2VRD A;  4IJD A;  2YTE A;  4LF5 E;  3TQM A;  1JK2 A;  4F2J C;  1IBK E;  4R2S A;  1WRJ A;  2V83 A;  2ELZ A;  4JV5 E;  1X6F A;  4DKK A;  2B3T B;  2LJU A;  1IBM E;  4HTG A;  2YTQ A;  4DUZ E;  2EMH A;  4LFB E;  2J7J A;  2LCE A;  2HGH A;  2K4V A;  1BBG A;  4FK5 C;  2ADR A;  2EN4 A;  2YTG A;  2NUG A;  2JVA A;  4GKK E;  1NEI A;  5AE1 A;  4JI3 E;  2HC5 A;  4K0K E;  4RHB B;  4R2A A;  2L3C A;  4IS1 C;  2R76 A;  2EOE A;  2EOF A;  4X66 E;  2EM9 A;  2K7I A;  1HR0 E;  2EN7 A;  4LF9 E;  3J7A G;  1B69 A;  2BBG A;  2MC6 A;  2EPL X;  3J80 C;  4X62 E;  2EPO A;  2EN8 A;  2EM7 A;  4LTY A;  2EOH A;  4R2C A;  2MDG A;  2L33 A;  2GHF A;  2MC5 A;  5IXM B;  2JR1 A;  3T1Y E;  2JWO A;  4KZS A;  4LFA E;  4DV3 E;  2EMY A;  5AC5 A;  4ZYD A;  4M2Z A;  1O0W A;  4R2E A;  1IMU A;  1DQ3 A;  4DR2 E;  2YTP A;  2EMB A;  2LUQ A;  2YU5 A;  1QNT A;  1TF3 A;  2Q8U A;  1YUJ A;  4NXM E;  3BBG A;  1IQS A;  4DR5 E;  1DGC A;  2N8X A;  4F6N A;  1EH8 A;  4DR1 E;  3P1X A;  2EOR A;  4R2Q A;  4L8N A;  5KL3 A;  5A69 A;  3THN A;  1X47 A;  3OTO E;  3VYY A;  3L00 A;  1N36 E;  1A1K A;  4DR7 E;  5FLX C;  2EPM X;  1KJK A;  4JI6 E;  3AUZ A;  4F9B B;  2MKD A;  2EOO A;  2EPK X;  2LTR A;  1N33 E;  4R2R A;  2YTN A;  3BID A;  5A6B D;  2M9A A;  2R1F A;  3BGH A;  3MHS C;  3C4B A;  3KZY A;  2DSY A;  2DIX A;  2L8T A;  3IWB A;  5A6K A;  2MDR A;  2L92 A;  1X48 A;  1ZU1 A;  1STU A;  1HNZ E;  4DV1 E;  4X8W A;  3HPS A;  4WFT A;  2KON A;  2EPX A;  2EMI A;  4F9A B;  1XMO E;  1BB8 A;  2YU8 A;  3FIG A;  2LT7 A;  2V88 A;  2LRS A;  2EMF A;  4DMI A;  4BS9 A;  3IWC A;  1XNQ E;  4P78 A;  3DJW A;  2UUC E;  2WCC 3;  2EOS A;  2JOX A;  1SR9 A;  4NZV A;  4F6M A;  1A1I A;  2EOY A;  1YYW A;  2A25 A;  1ZAA C;  3UK3 C;  4BMJ A;  2YRH A;  1PKP A;  2EML A;  2L2N A;  1GTK A;  4DV6 E;  2EMA A;  2DLQ A;  4Q35 B;  1EH7 A;  3HXL A;  2ELY A;  4F9C B;  4WSG A;  4M30 A;  4M9V C;  4O4K A;  2FTX B; 
#chains in the Genus database with same CATH homology
 2ODR C;  5ADZ A;  2V86 A;  1YYK A;  2LMZ A;  4LTY A;  2RTX A;  2DMY A;  2E5L E;  2B9D A;  2NUE A;  2WZO A;  4B3M E;  2FGG A;  2L33 A;  4WYQ B;  3JAM C;  4DR4 E;  2MC5 A;  2UXD E;  2JR1 A;  2UXB E;  3T1Y E;  2JWO A;  4KZS A;  2LBS B;  4DV3 E;  1T4L B;  2YT4 A;  4LU9 A;  3VK6 A;  4LFA E;  3ADJ A;  4M2Z A;  4R03 A;  3HQ1 A;  2LJH A;  2V8Q B;  4L5N C;  1O0W A;  4BBY A;  2YZT A;  5BR8 E;  4JYA E;  1DQ3 A;  2B7T A;  4DUY E;  4R8O A;  5IWA E;  5A2Q C;  2KHX A;  2VQE E;  4DR2 E;  1FKA E;  2LUQ A;  2NUF A;  4B3S E;  4WSP A;  2UU9 E;  2G7H A;  4JI1 E;  3H09 A;  3J7Y p;  2F4V E;  1I94 E;  3K6Q A;  4BCA A;  4NXM E;  1WHQ A;  4LF8 E;  2F8B A;  4B3R E;  4DR5 E;  5LMN E;  1RC7 A;  1N34 E;  3ADL A;  3KWR A;  1UHZ A;  5AE2 A;  3C4T A;  4DR1 E;  3P1X A;  5AAS A;  2UUA E;  3LML A;  2N3H A;  3JU0 A;  2M4I A;  2VE7 C;  4L8N A;  1X49 A;  2V87 A;  1X47 A;  1DI2 A;  4DR6 E;  3LLH A;  4LF6 E;  3HPZ A;  2HHH E;  2LE2 A;  4Q28 A;  3OTO E;  3VYY A;  2UUB E;  2L3J A;  1N36 E;  2JOB A;  4GEQ B;  1YZ9 A;  4AQY E;  4JI5 E;  5FLX C;  4DR7 E;  2M7Q A;  1XNR E;  4GKJ E;  3JTZ A;  1IBL E;  4JI6 E;  3ADI A;  3VYX A;  2B7V A;  3AUZ A;  4F9B B;  4JI4 E;  2UXC E;  3F6H A;  2LTR A;  1N33 E;  2NA2 A;  3J81 C;  2VF1 A;  4YY3 E;  1RQ0 A;  4DV7 E;  5IT9 C;  2KOU A;  1HNW E;  1FJG E;  1T4O A;  1UIL A;  4LF7 E;  2L2K B;  2L6M A;  4JI8 E;  4B3T E;  2RS7 A;  4NXN E;  3C4B A;  5T6J A;  2DSY A;  3ADG A;  4LFC E;  2DIX A;  2CPN A;  2L8T A;  3IWB A;  3IWD A;  4M0V A;  4BC9 A;  4X65 E;  1ZBQ A;  4DV2 E;  2ODR D;  1J26 A;  2MDR A;  5F3W A;  2LUP B;  2IHR 1;  4J8Z A;  2L92 A;  1X48 A;  3HTX A;  3ZOQ B;  4F54 A;  4LF5 E;  1STU A;  2N3G A;  1IBK E;  1WHN A;  2JY9 A;  4OOG C;  4X64 E;  4JI7 E;  2ZM6 E;  1HNZ E;  4JI0 E;  2V83 A;  4X8W A;  4DV1 E;  4JV5 E;  2E1M A;  3HPS A;  4WFT A;  2KON A;  4DKK A;  1J5E E;  2LTS A;  1GQE A;  4F9A B;  1GZ6 A;  1XMO E;  2B3T B;  1ZBT A;  1EKZ A;  1IBM E;  3FIG A;  1WXR A;  2V88 A;  2LRS A;  1YYO A;  4DMI A;  4BC7 A;  4DV5 E;  4BS9 A;  1QU6 A;  2H36 X;  4WPY A;  4DUZ E;  2RS6 A;  3T1H E;  3IWC A;  4LFB E;  4I8O A;  1XNQ E;  4P78 A;  3DJW A;  4TUI A;  2UUC E;  4DR3 E;  4JI2 E;  5AE3 A;  2K4V A;  4X62 E;  1T4N A;  2JOX A;  1SR9 A;  2JVA A;  3RMP A;  2NUG A;  4GKK E;  5AE1 A;  4LF4 E;  4JI3 E;  3AV0 A;  4K0K E;  2V85 A;  1YYW A;  5DNY A;  2L3C A;  5LMU E;  4P7D A;  2RSM A;  2V89 A;  4BMJ A;  4YHH E;  1PKP A;  2FV4 B;  2L2N A;  4X66 E;  4KHP E;  2DB2 A;  4DV6 E;  1XMQ E;  3DF6 A;  1HR0 E;  4OX9 E;  4LF9 E;  2L2M A;  4DV0 E;  1HNX E;  3J7A G;  5LL6 R;  2M1S A;  5CFF E;  2EZ6 A;  3HXL A;  4F9C B;  2MC6 A;  4M30 A;  3F6G A;  3J80 C;  2VQF E;  2EWL A;  3MSW A;  2FTX B;  3OML A;  4DV4 E;  1N32 E;  4TUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...