2YZTA

Crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MRRRYRVVVERDEEGYFVAHVPELHAHTQAQSFEELLRRLQEAIAVSLEEERAEVVGLEGALEIEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein TTHA1756 from Thermus thermophilus HB8: Structural variety in UPF0150 family proteins.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA1756
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yztA00
2YZTA 2DSYA 4P7DA 4P78A 3KWRA
chains in the Genus database with same CATH superfamily
3VK6A 1X6FA 2ADRA 2EPAA 4JI3E 2EZ6A 4DR6E 2UXBE 4J8ZA 2BB8A 3HTXA 1GTKA 1A1JA 3JTZA 2LV2A 2H36X 2E72A 2EPXA 2EOHA 2LUPB 1ZR9A 2RPCA 4FK5C 2B7VA 1EKZA 2EMWA 4LF4E 2L2NA 3IWBA 4RHBB 5A6BA 1JK1A 1L4SA 4KWYA 4DR4E 2DLKA 1T4LB 2DSYA 1X6EA 4OOGC 3F6HA 1X47A 2EMHA 4LU9A 1QU6A 3M99B 1YSAC 5AE2A 4DR3E 4R8OA 2EOMA 4RH8A 4DUZE 2NUEA 2M4IA 2WBUA 3K6QA 4R2PA 2EOQA 2YRMA 3LLHA 1FKAE 4F9AB 1BBGA 3BF2A 3C6KA 4JV5E 1BBOA 4X65E 4R2EA 3ADIA 2I13A 1O0WA 4ZYGA 1B69A 4R2QA 2KONA 4K0KE 2YTDA 3MSWA 1UBDC 2WCC3 4R2RA 2M1SA 2YTIA 2JYAA 1DQ3A 3DF6A 3MHSC 1XMOE 2YTFA 2EOJA 3C6MA 2M7QA 3T1YE 1GZ6A 2VRDA 4F6NA 5KL6A 2GHFA 1A1GA 3L00A 2EORA 3HQ1A 4R03A 1RQ0A 1YYOA 5KL2A 2YTQA 2EN8A 1KYQA 2EPNA 2FTXB 4JI7E 2EOSA 2EPUA 2K4VA 3UK3C 2JOBA 1TF3A 2EPZA 2EOFA 2V86A 1G2FC 4P78A 5AASA 3ECRA 1PJTA 3EPLA 1A1IA 1UN6B 2MC5A 4X64E 2PRTA 4BC9A 1IBME 2B7TA 4JI8E 1G2DC 1RC7A 3IWDA 2YRHA 5LL6R 4KHPE 2VF1A 4DR5E 3ZOQB 4BS9A 2EQ0A 4GKJE 1YFHA 1X3CA 2RQLA 2UUAE 2YU5A 3IWCA 2EOYA 4DV0E 2MKNA 2N3HA 2EMBA 3P1XA 2HJJA 2EMIA 4L5NC 4JI1E 4MLQA 5CFFE 2NUFA 2KHXA 5BR8E 3MHHC 4B3RE 1T4NA 2UXDE 4O43A 2EOOA 2B3TB 2DMYA 2EMZA 3H09A 2ODRD 4X9JA 1I94E 2YTEA 2EOZA 5DNYA 2L2MA 2EN7A 3JAMC 5IV8B 4ZYEA 1N32E 2EMAA 1HNWE 5LMNE 3HXLA 1YUIA 3EPHA 4BCAA 1T39A 4LF5E 1N36E 2V87A 5KL3A 2LRSA 1A1HA 1NEIA 4NHRA 2FV4B 4LFAE 1PKPA 2JR1A 1A1KA 2L3CA 2EPCA 2B9DA 3OMLA 2VQEE 2EMKA 1SFEA 2EOXA 2EMCA 2CSHA 2CPNA 1IQSA 1A1LA 4F9BB 2DGCA 2K7IA 2YTOA 2R1FA 3T1HE 1N33E 2BBGA 3KWRA 2HHHE 2EJ4A 3C4TA 4I8OA 1WHNA 1DGCA 1QNTA 4KZSA 2EP3A 2JOXA 3KZYA 2EMFA 2EMXA 2ELZA 4BBYA 2LJUA 1T38A 5KL5A 2F4VE 2E5LE 1WHQA 3HPSA 2NABA 2DIXA 3RMPA 4Q28A 4B3ME 3VYXA 1DI2A 4F6MA 1STUA 2WBTA 1MEYC 2V85A 4M9VC 2F8BA 2EN4A 2MC6A 1YYWA 3J80C 2R76A 2NA2A 5AE1A 5IXMB 2EPPA 4JI4E 1ZBTA 2LMZA 2LVHA 4JI6E 2UXCE 2UUCE 4B3SE 1NCSA 2EE8A 3JU0A 3LMLA 4IS1C 4LF9E 4P7DA 5ADZA 2EQ3A 1ZBQA 2RS7A 2EOIA 4MLVA 4YHHE 3THNA 1XNRE 2Q8UA 1HNZE 2EM0A 4O5GA 1EH7A 4F54A 2JPAA 4B3TE 4GKKE 5TSEA 2UUBE 5A6BD 5LMUE 2V8QB 1T4OA 3BGHA 2EPMX 1WRJA 2LE2A 2MDGA 4WFTA 4YY3E 4ZYDA 2DB2A 5A6KA 1X49A 4GZNC 1AAYA 4LFCE 2ENAA 2CT1A 2LTRA 2V89A 3VYYA 4F2JC 4X62E 4LFBE 2EN6A 4JI0E 4DV6E 1X48A 5KL7A 2EMYA 1PJQA 4DR2E 4M30A 4DV5E 3FIGA 2VE7C 4F9CB 4LF6E 1WXRA 2A25A 2YWQA 2LTSA 2YTGA 2VQFE 4L8NA 2EM5A 1UHZA 1J5EE 1PDAA 2DRPA 2LJHA 2D9HA 2EOEA 2EPKX 4TUGA 4LTYA 2L6MA 3J81C 1XNQE 1RMDA 1TN9A 4WXDA 2EM7A 2N8XA 3EPJA 4DKKA 1F2IG 4WPYA 2YTPA 4NXME 2EPLX 1IQOA 2YPNA 4WX9A 2LCEA 2YTNA 4JI2E 4GEQB 2RS6A 1YPNA 4X66E 1A1FA 2IHR1 2M9AA 4BHBA 2YRKA 1N34E 2KOUA 2EM8A 2G7HA 5T6JA 1KJKA 2V88A 2ELYA 2L92A 2V83A 4WSGA 2J7JA 2HGHA 2EN3A 1BB8A 2CTDA 2E1MA 2EMLA 5AC4A 2I9IA 1N3GA 1UILA 2JP9A 4ZYHA 4DUYE 4O4KA 2EN2A 4BMJA 3VHTB 2YSPA 2YT4A 2GLIA 1FJGE 2EL5A 2EQ1A 1X5WA 1J26A 2WBSA 4TUIA 3AUZA 3BIDA 1Z1BA 5IWAE 2UU9E 4DMIA 4R2CA 4DV7E 2RSIA 4R2AA 2EPOA 2JXPA 2N3GA 5A6JA 1ZAAC 2JVAA 3AV0A 4IJDA 1SR9A 2LO3A 5A2QC 5AC5A 2L8TA 1P47A 2DLQA 2NUGA 2YU8A 4M0VA 2YSOA 1MGTA 2EM4A 2JWOA 3ADJA 4O24A 4JYAE 4DV4E 1WJPA 5A6AA 3EPKA 3ADLA 1JK2A 2DMIA 5AE3A 2YZTA 1YYKA 4X8WA 2MDRA 4BC7A 4LF8E 1IBLE 1TF6A 2JY9A 3BBGA 4WYQB 4DV1E 3EQ1A 2LBSB 4LF7E 1GQEA 2ENCA 2EPRA 3OTOE 2FGGA 2EMGA 2EM6A 1XMQE 3TQMA 1ZU1A 2WZOA 4DV3E 2LT7A 2EL4A 1HNXE 2EM2A 2GPIA 2EWLA 4NZVA 1IMUA 3J7Yp 4WSPA 4JI5E 5F3WA 2L33A 3KZZA 2RSMA 3F6GA 1YUJA 2EN1A 3DJWA 3ADGA 4AQYE 1IBKE 4DR7E 4DV2E 3QG5C 4BHCA 4R2DA 4R2SA 3J7AG 2HC5A 4N4RB 2LUQA 4DR1E 2ENHA 3C4BA 2ODRC 1YZ9A 4Q35B 4HEIA 2RTXA 5KL4A 1HR0E 3HPZA 2L3JA 1LLMC 2L2KB 4HTGA 4M2ZA 5IT9C 5FLXC 5A69A 4NXNE 2EL6A 1EH8A 2EM9A 3THOB 1X6HA 2MKDA 4WXCA 1EH6A 1AH5A 2ZM6E 1PJSA 2YTJA 5LLQA 4OX9E 2EM3A
chains in the Genus database with same CATH topology
4BMJA 3VK6A 4YHHE 2N3HA 3P1XA 1XNRE 2YT4A 4JI3E 2EZ6A 4DR6E 2UXBE 4J8ZA 1HNZE 1YZ9A 3HTXA 3JTZA 4L5NC 1FJGE 4JI1E 2H36X 5CFFE 2NUFA 2KHXA 1J26A 5BR8E 4F54A 4B3TE 4TUIA 4GKKE 3AUZA 2LUPB 4LF4E 2UUBE 2B7VA 1EKZA 4B3RE 1T4NA 2L2NA 3IWBA 5IWAE 2UXDE 2UU9E 5LMUE 4DMIA 2B3TB 2V8QB 2DMYA 4DR4E 1T4OA 1T4LB 4DV7E 2DSYA 2LE2A 4WFTA 3H09A 4OOGC 4YY3E 2DB2A 1X47A 2ODRD 1X49A 3F6HA 1I94E 4LU9A 1QU6A 5DNYA 4LFCE 5AE2A 2N3GA 4DR3E 2L2MA 2LTRA 2V89A 2JVAA 4X62E 3VYYA 4LFBE 3JAMC 3AV0A 4R8OA 2NUEA 1SR9A 4DUZE 4JI0E 2M4IA 5A2QC 1N32E 4DV6E 3K6QA 1HNWE 2L8TA 5LMNE 3HXLA 2NUGA 1X48A 3LLHA 4BCAA 1FKAE 4M0VA 4LF5E 4F9AB 1N36E 2V87A 2JWOA 2LRSA 4DR2E 3ADJA 4JYAE 4M30A 4DV5E 4JV5E 3FIGA 2VE7C 4F9CB 4LF6E 1WXRA 4X65E 4DV4E 3ADIA 1O0WA 3ADLA 2FV4B 2LTSA 4LFAE 5AE3A 2VQFE 1PKPA 2JR1A 2YZTA 1YYKA 4L8NA 2KONA 2MDRA 4X8WA 2B9DA 3OMLA 2L3CA 4BC7A 3MSWA 2VQEE 4LF8E 4K0KE 1UHZA 1IBLE 2M1SA 2CPNA 1DQ3A 3DF6A 2JY9A 4DV1E 4WYQB 1XMOE 1J5EE 2LBSB 4F9BB 4LF7E 2M7QA 2LJHA 3T1YE 1GZ6A 1GQEA 3OTOE 2FGGA 3T1HE 1XMQE 3KWRA 2HHHE 1N33E 2WZOA 4TUGA 3C4TA 4I8OA 4LTYA 1WHNA 2L6MA 4DV3E 3J81C 3HQ1A 4R03A 1RQ0A 1YYOA 1XNQE 1HNXE 4KZSA 2EWLA 2JOXA 2FTXB 3J7Yp 4JI7E 4DKKA 4WSPA 4BBYA 4JI5E 2K4VA 5F3WA 2L33A 2JOBA 4WPYA 2RSMA 3F6GA 4NXME 2F4VE 3DJWA 2E5LE 3ADGA 1WHQA 2V86A 3HPSA 4JI2E 4AQYE 1IBKE 4DR7E 2DIXA 4DV2E 3RMPA 4Q28A 4GEQB 2RS6A 4P78A 5AASA 4B3ME 3VYXA 1DI2A 3J7AG 4X66E 1STUA 2IHR1 2LUQA 4DR1E 2MC5A 2V85A 3C4BA 4X64E 1N34E 2KOUA 2F8BA 2ODRC 2G7HA 2MC6A 4BC9A 5T6JA 2B7TA 3J80C 1IBME 1YYWA 2RTXA 2V88A 2NA2A 4JI8E 1HR0E 5AE1A 1RC7A 3IWDA 2L92A 2V83A 5LL6R 3HPZA 2L3JA 4JI4E 2L2KB 4KHPE 2VF1A 1ZBTA 4DR5E 4M2ZA 2LMZA 3ZOQB 5IT9C 5FLXC 4BS9A 4JI6E 2E1MA 2UUCE 4NXNE 2UXCE 4GKJE 4B3SE 1UILA 3JU0A 3LMLA 4DUYE 2ZM6E 2UUAE 3IWCA 4LF9E 4OX9E 4P7DA 5ADZA 1ZBQA 2RS7A 4DV0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZT A;  2DSY A;  4P7D A;  4P78 A;  3KWR A; 
#chains in the Genus database with same CATH topology
 3VK6 A;  1X6F A;  2ADR A;  2EPA A;  4JI3 E;  2EZ6 A;  4DR6 E;  2UXB E;  4J8Z A;  2BB8 A;  3HTX A;  1GTK A;  1A1J A;  3JTZ A;  2LV2 A;  2H36 X;  2E72 A;  2EPX A;  2EOH A;  2LUP B;  1ZR9 A;  2RPC A;  4FK5 C;  2B7V A;  1EKZ A;  2EMW A;  4LF4 E;  2L2N A;  3IWB A;  4RHB B;  5A6B A;  1JK1 A;  1L4S A;  4KWY A;  4DR4 E;  2DLK A;  1T4L B;  2DSY A;  1X6E A;  4OOG C;  3F6H A;  1X47 A;  2EMH A;  4LU9 A;  1QU6 A;  3M99 B;  1YSA C;  5AE2 A;  4DR3 E;  4R8O A;  2EOM A;  4RH8 A;  4DUZ E;  2NUE A;  2M4I A;  2WBU A;  3K6Q A;  4R2P A;  2EOQ A;  2YRM A;  3LLH A;  1FKA E;  4F9A B;  1BBG A;  3BF2 A;  3C6K A;  4JV5 E;  1BBO A;  4X65 E;  4R2E A;  3ADI A;  2I13 A;  1O0W A;  4ZYG A;  1B69 A;  4R2Q A;  2KON A;  4K0K E;  2YTD A;  3MSW A;  1UBD C;  2WCC 3;  4R2R A;  2M1S A;  2YTI A;  2JYA A;  1DQ3 A;  3DF6 A;  3MHS C;  1XMO E;  2YTF A;  2EOJ A;  3C6M A;  2M7Q A;  3T1Y E;  1GZ6 A;  2VRD A;  4F6N A;  5KL6 A;  2GHF A;  1A1G A;  3L00 A;  2EOR A;  3HQ1 A;  4R03 A;  1RQ0 A;  1YYO A;  5KL2 A;  2YTQ A;  2EN8 A;  1KYQ A;  2EPN A;  2FTX B;  4JI7 E;  2EOS A;  2EPU A;  2K4V A;  3UK3 C;  2JOB A;  1TF3 A;  2EPZ A;  2EOF A;  2V86 A;  1G2F C;  4P78 A;  5AAS A;  3ECR A;  1PJT A;  3EPL A;  1A1I A;  1UN6 B;  2MC5 A;  4X64 E;  2PRT A;  4BC9 A;  1IBM E;  2B7T A;  4JI8 E;  1G2D C;  1RC7 A;  3IWD A;  2YRH A;  5LL6 R;  4KHP E;  2VF1 A;  4DR5 E;  3ZOQ B;  4BS9 A;  2EQ0 A;  4GKJ E;  1YFH A;  1X3C A;  2RQL A;  2UUA E;  2YU5 A;  3IWC A;  2EOY A;  4DV0 E;  2MKN A;  2N3H A;  2EMB A;  3P1X A;  2HJJ A;  2EMI A;  4L5N C;  4JI1 E;  4MLQ A;  5CFF E;  2NUF A;  2KHX A;  5BR8 E;  3MHH C;  4B3R E;  1T4N A;  2UXD E;  4O43 A;  2EOO A;  2B3T B;  2DMY A;  2EMZ A;  3H09 A;  2ODR D;  4X9J A;  1I94 E;  2YTE A;  2EOZ A;  5DNY A;  2L2M A;  2EN7 A;  3JAM C;  5IV8 B;  4ZYE A;  1N32 E;  2EMA A;  1HNW E;  5LMN E;  3HXL A;  1YUI A;  3EPH A;  4BCA A;  1T39 A;  4LF5 E;  1N36 E;  2V87 A;  5KL3 A;  2LRS A;  1A1H A;  1NEI A;  4NHR A;  2FV4 B;  4LFA E;  1PKP A;  2JR1 A;  1A1K A;  2L3C A;  2EPC A;  2B9D A;  3OML A;  2VQE E;  2EMK A;  1SFE A;  2EOX A;  2EMC A;  2CSH A;  2CPN A;  1IQS A;  1A1L A;  4F9B B;  2DGC A;  2K7I A;  2YTO A;  2R1F A;  3T1H E;  1N33 E;  2BBG A;  3KWR A;  2HHH E;  2EJ4 A;  3C4T A;  4I8O A;  1WHN A;  1DGC A;  1QNT A;  4KZS A;  2EP3 A;  2JOX A;  3KZY A;  2EMF A;  2EMX A;  2ELZ A;  4BBY A;  2LJU A;  1T38 A;  5KL5 A;  2F4V E;  2E5L E;  1WHQ A;  3HPS A;  2NAB A;  2DIX A;  3RMP A;  4Q28 A;  4B3M E;  3VYX A;  1DI2 A;  4F6M A;  1STU A;  2WBT A;  1MEY C;  2V85 A;  4M9V C;  2F8B A;  2EN4 A;  2MC6 A;  1YYW A;  3J80 C;  2R76 A;  2NA2 A;  5AE1 A;  5IXM B;  2EPP A;  4JI4 E;  1ZBT A;  2LMZ A;  2LVH A;  4JI6 E;  2UXC E;  2UUC E;  4B3S E;  1NCS A;  2EE8 A;  3JU0 A;  3LML A;  4IS1 C;  4LF9 E;  4P7D A;  5ADZ A;  2EQ3 A;  1ZBQ A;  2RS7 A;  2EOI A;  4MLV A;  4YHH E;  3THN A;  1XNR E;  2Q8U A;  1HNZ E;  2EM0 A;  4O5G A;  1EH7 A;  4F54 A;  2JPA A;  4B3T E;  4GKK E;  5TSE A;  2UUB E;  5A6B D;  5LMU E;  2V8Q B;  1T4O A;  3BGH A;  2EPM X;  1WRJ A;  2LE2 A;  2MDG A;  4WFT A;  4YY3 E;  4ZYD A;  2DB2 A;  5A6K A;  1X49 A;  4GZN C;  1AAY A;  4LFC E;  2ENA A;  2CT1 A;  2LTR A;  2V89 A;  3VYY A;  4F2J C;  4X62 E;  4LFB E;  2EN6 A;  4JI0 E;  4DV6 E;  1X48 A;  5KL7 A;  2EMY A;  1PJQ A;  4DR2 E;  4M30 A;  4DV5 E;  3FIG A;  2VE7 C;  4F9C B;  4LF6 E;  1WXR A;  2A25 A;  2YWQ A;  2LTS A;  2YTG A;  2VQF E;  4L8N A;  2EM5 A;  1UHZ A;  1J5E E;  1PDA A;  2DRP A;  2LJH A;  2D9H A;  2EOE A;  2EPK X;  4TUG A;  4LTY A;  2L6M A;  3J81 C;  1XNQ E;  1RMD A;  1TN9 A;  4WXD A;  2EM7 A;  2N8X A;  3EPJ A;  4DKK A;  1F2I G;  4WPY A;  2YTP A;  4NXM E;  2EPL X;  1IQO A;  2YPN A;  4WX9 A;  2LCE A;  2YTN A;  4JI2 E;  4GEQ B;  2RS6 A;  1YPN A;  4X66 E;  1A1F A;  2IHR 1;  2M9A A;  4BHB A;  2YRK A;  1N34 E;  2KOU A;  2EM8 A;  2G7H A;  5T6J A;  1KJK A;  2V88 A;  2ELY A;  2L92 A;  2V83 A;  4WSG A;  2J7J A;  2HGH A;  2EN3 A;  1BB8 A;  2CTD A;  2E1M A;  2EML A;  5AC4 A;  2I9I A;  1N3G A;  1UIL A;  2JP9 A;  4ZYH A;  4DUY E;  4O4K A;  2EN2 A;  4BMJ A;  3VHT B;  2YSP A;  2YT4 A;  2GLI A;  1FJG E;  2EL5 A;  2EQ1 A;  1X5W A;  1J26 A;  2WBS A;  4TUI A;  3AUZ A;  3BID A;  1Z1B A;  5IWA E;  2UU9 E;  4DMI A;  4R2C A;  4DV7 E;  2RSI A;  4R2A A;  2EPO A;  2JXP A;  2N3G A;  5A6J A;  1ZAA C;  2JVA A;  3AV0 A;  4IJD A;  1SR9 A;  2LO3 A;  5A2Q C;  5AC5 A;  2L8T A;  1P47 A;  2DLQ A;  2NUG A;  2YU8 A;  4M0V A;  2YSO A;  1MGT A;  2EM4 A;  2JWO A;  3ADJ A;  4O24 A;  4JYA E;  4DV4 E;  1WJP A;  5A6A A;  3EPK A;  3ADL A;  1JK2 A;  2DMI A;  5AE3 A;  2YZT A;  1YYK A;  4X8W A;  2MDR A;  4BC7 A;  4LF8 E;  1IBL E;  1TF6 A;  2JY9 A;  3BBG A;  4WYQ B;  4DV1 E;  3EQ1 A;  2LBS B;  4LF7 E;  1GQE A;  2ENC A;  2EPR A;  3OTO E;  2FGG A;  2EMG A;  2EM6 A;  1XMQ E;  3TQM A;  1ZU1 A;  2WZO A;  4DV3 E;  2LT7 A;  2EL4 A;  1HNX E;  2EM2 A;  2GPI A;  2EWL A;  4NZV A;  1IMU A;  3J7Y p;  4WSP A;  4JI5 E;  5F3W A;  2L33 A;  3KZZ A;  2RSM A;  3F6G A;  1YUJ A;  2EN1 A;  3DJW A;  3ADG A;  4AQY E;  1IBK E;  4DR7 E;  4DV2 E;  3QG5 C;  4BHC A;  4R2D A;  4R2S A;  3J7A G;  2HC5 A;  4N4R B;  2LUQ A;  4DR1 E;  2ENH A;  3C4B A;  2ODR C;  1YZ9 A;  4Q35 B;  4HEI A;  2RTX A;  5KL4 A;  1HR0 E;  3HPZ A;  2L3J A;  1LLM C;  2L2K B;  4HTG A;  4M2Z A;  5IT9 C;  5FLX C;  5A69 A;  4NXN E;  2EL6 A;  1EH8 A;  2EM9 A;  3THO B;  1X6H A;  2MKD A;  4WXC A;  1EH6 A;  1AH5 A;  2ZM6 E;  1PJS A;  2YTJ A;  5LLQ A;  4OX9 E;  2EM3 A; 
#chains in the Genus database with same CATH homology
 4BMJ A;  3VK6 A;  4YHH E;  2N3H A;  3P1X A;  1XNR E;  2YT4 A;  4JI3 E;  2EZ6 A;  4DR6 E;  2UXB E;  4J8Z A;  1HNZ E;  1YZ9 A;  3HTX A;  3JTZ A;  4L5N C;  1FJG E;  4JI1 E;  2H36 X;  5CFF E;  2NUF A;  2KHX A;  1J26 A;  5BR8 E;  4F54 A;  4B3T E;  4TUI A;  4GKK E;  3AUZ A;  2LUP B;  4LF4 E;  2UUB E;  2B7V A;  1EKZ A;  4B3R E;  1T4N A;  2L2N A;  3IWB A;  5IWA E;  2UXD E;  2UU9 E;  5LMU E;  4DMI A;  2B3T B;  2V8Q B;  2DMY A;  4DR4 E;  1T4O A;  1T4L B;  4DV7 E;  2DSY A;  2LE2 A;  4WFT A;  3H09 A;  4OOG C;  4YY3 E;  2DB2 A;  1X47 A;  2ODR D;  1X49 A;  3F6H A;  1I94 E;  4LU9 A;  1QU6 A;  5DNY A;  4LFC E;  5AE2 A;  2N3G A;  4DR3 E;  2L2M A;  2LTR A;  2V89 A;  2JVA A;  4X62 E;  3VYY A;  4LFB E;  3JAM C;  3AV0 A;  4R8O A;  2NUE A;  1SR9 A;  4DUZ E;  4JI0 E;  2M4I A;  5A2Q C;  1N32 E;  4DV6 E;  3K6Q A;  1HNW E;  2L8T A;  5LMN E;  3HXL A;  2NUG A;  1X48 A;  3LLH A;  4BCA A;  1FKA E;  4M0V A;  4LF5 E;  4F9A B;  1N36 E;  2V87 A;  2JWO A;  2LRS A;  4DR2 E;  3ADJ A;  4JYA E;  4M30 A;  4DV5 E;  4JV5 E;  3FIG A;  2VE7 C;  4F9C B;  4LF6 E;  1WXR A;  4X65 E;  4DV4 E;  3ADI A;  1O0W A;  3ADL A;  2FV4 B;  2LTS A;  4LFA E;  5AE3 A;  2VQF E;  1PKP A;  2JR1 A;  2YZT A;  1YYK A;  4L8N A;  2KON A;  2MDR A;  4X8W A;  2B9D A;  3OML A;  2L3C A;  4BC7 A;  3MSW A;  2VQE E;  4LF8 E;  4K0K E;  1UHZ A;  1IBL E;  2M1S A;  2CPN A;  1DQ3 A;  3DF6 A;  2JY9 A;  4DV1 E;  4WYQ B;  1XMO E;  1J5E E;  2LBS B;  4F9B B;  4LF7 E;  2M7Q A;  2LJH A;  3T1Y E;  1GZ6 A;  1GQE A;  3OTO E;  2FGG A;  3T1H E;  1XMQ E;  3KWR A;  2HHH E;  1N33 E;  2WZO A;  4TUG A;  3C4T A;  4I8O A;  4LTY A;  1WHN A;  2L6M A;  4DV3 E;  3J81 C;  3HQ1 A;  4R03 A;  1RQ0 A;  1YYO A;  1XNQ E;  1HNX E;  4KZS A;  2EWL A;  2JOX A;  2FTX B;  3J7Y p;  4JI7 E;  4DKK A;  4WSP A;  4BBY A;  4JI5 E;  2K4V A;  5F3W A;  2L33 A;  2JOB A;  4WPY A;  2RSM A;  3F6G A;  4NXM E;  2F4V E;  3DJW A;  2E5L E;  3ADG A;  1WHQ A;  2V86 A;  3HPS A;  4JI2 E;  4AQY E;  1IBK E;  4DR7 E;  2DIX A;  4DV2 E;  3RMP A;  4Q28 A;  4GEQ B;  2RS6 A;  4P78 A;  5AAS A;  4B3M E;  3VYX A;  1DI2 A;  3J7A G;  4X66 E;  1STU A;  2IHR 1;  2LUQ A;  4DR1 E;  2MC5 A;  2V85 A;  3C4B A;  4X64 E;  1N34 E;  2KOU A;  2F8B A;  2ODR C;  2G7H A;  2MC6 A;  4BC9 A;  5T6J A;  2B7T A;  3J80 C;  1IBM E;  1YYW A;  2RTX A;  2V88 A;  2NA2 A;  4JI8 E;  1HR0 E;  5AE1 A;  1RC7 A;  3IWD A;  2L92 A;  2V83 A;  5LL6 R;  3HPZ A;  2L3J A;  4JI4 E;  2L2K B;  4KHP E;  2VF1 A;  1ZBT A;  4DR5 E;  4M2Z A;  2LMZ A;  3ZOQ B;  5IT9 C;  5FLX C;  4BS9 A;  4JI6 E;  2E1M A;  2UUC E;  4NXN E;  2UXC E;  4GKJ E;  4B3S E;  1UIL A;  3JU0 A;  3LML A;  4DUY E;  2ZM6 E;  2UUA E;  3IWC A;  4LF9 E;  4OX9 E;  4P7D A;  5ADZ A;  1ZBQ A;  2RS7 A;  4DV0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...