2YZTA

Crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MRRRYRVVVERDEEGYFVAHVPELHAHTQAQSFEELLRRLQEAIAVSLEEERAEVVGLEGALEIEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHA1756
publication title Crystal structure of uncharacterized protein TTHA1756 from Thermus thermophilus HB8: Structural variety in UPF0150 family proteins.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yztA00
2DSYA 2YZTA 3KWRA 4P78A 4P7DA
chains in the Genus database with same CATH superfamily
4N4RB 1MEYC 4KHPE 3BBGA 4DR5E 4JI5E 2LE2A 4DV0E 4NXME 4ZYHA 4JV5E 4JI3E 1EH7A 2BBGA 2B7VA 2EOOA 3HXLA 1X47A 1ZR9A 2EORA 2VE7C 2NUFA 2GPIA 1ZAAC 5LLQA 2PRTA 5IWAE 4B3TE 4IJDA 4ZYDA 4LTYA 2EOJA 3JAMC 2LCEA 4BBYA 2VRDA 2DLQA 1O0WA 5IV8B 4HTGA 2EQ0A 3JTZA 4M0VA 1YYKA 5A6BA 2LUPB 3EPLA 2IHR1 1GTKA 4JI8E 2WCC3 4JI6E 2ODRC 3ADGA 2RS7A 2EM0A 2RS6A 2R76A 2N3GA 4WPYA 1PJQA 1WXRA 1WRJA 4M9VC 5KL3A 3UK3C 3T1HE 4DUYE 2EOXA 2EL5A 3KZZA 3EQ1A 1UBDC 2WBSA 2VQFE 1ZBQA 2YRHA 2DIXA 2HGHA 2EE8A 2EL4A 2GHFA 4R2RA 2EQ3A 1YZ9A 2DMYA 2EMXA 2EPZA 2EM4A 3J80C 1J5EE 3VYXA 1YPNA 2L8TA 2L33A 2BB8A 4LFCE 2EN2A 4DV3E 1GQEA 2LV2A 2EOIA 1DQ3A 2B9DA 2I13A 4RHBB 1A1HA 1IMUA 4DV5E 4B3RE 1STUA 2MKNA 2NUEA 3HTXA 2EOEA 3C6KA 2EMLA 3THNA 2HJJA 5TSEA 2V88A 1IQSA 4BC9A 2HHHE 2NUGA 1F2IG 2LBSB 1N34E 2YZTA 3F6GA 1J26A 2EOSA 2YTJA 4GEQB 3J7AG 2MDGA 5A2QC 3VYYA 2UU9E 4DUZE 2JR1A 2ELZA 4NHRA 1G2FC 4ZYEA 5A69A 1XMOE 4LF5E 2N8XA 5AE1A 4M2ZA 2ADRA 5AE2A 1X49A 2YRKA 2L2MA 3ZOQB 5KL6A 5F3WA 1N3GA 1FJGE 2EPKX 2K7IA 4LF9E 3L00A 1Z1BA 2EPUA 1G2DC 3K6QA 1N36E 4R2QA 2I9IA 2CTDA 2YU8A 5LMUE 2EMBA 2L92A 4X8WA 4L5NC 1IQOA 4KWYA 1T4NA 1A1JA 5IT9C 4F6NA 1ZBTA 4JI2E 3ECRA 2EQ1A 1YUIA 4DR3E 3MHSC 4O24A 2EL6A 2EPPA 3THOB 1KJKA 3FIGA 4X62E 2DMIA 4X64E 4TUIA 4O5GA 2V8QB 1A1GA 2YTDA 2KONA 2UUAE 5KL2A 2DRPA 2FTXB 2JY9A 1NEIA 2EMCA 3KWRA 4DV7E 1AAYA 2EPAA 2YTGA 1XNRE 4Q28A 1TF3A 3IWDA 4LF6E 1IBLE 4NXNE 2JVAA 4LF7E 2LUQA 3HPSA 3LMLA 2V89A 5FLXC 5KL4A 1T4LB 4MLVA 3IWCA 4DR1E 2ENHA 2EN1A 4F9BB 2YT4A 4DR6E 2EOYA 1I94E 1A1LA 2LJUA 2FV4B 2YWQA 2E1MA 4WXDA 1RQ0A 2VQEE 3DF6A 2YTOA 1BB8A 1X6EA 2D9HA 2MDRA 4WSPA 2EMYA 1N32E 5KL5A 1EKZA 1UILA 1HNWE 2L3CA 3DJWA 4NZVA 1PKPA 4K0KE 2FGGA 4FK5C 2EN4A 4YHHE 4O4KA 2KOUA 2KHXA 2LMZA 1QU6A 2CSHA 2YSOA 1X6FA 4TUGA 2EN8A 4I8OA 4JYAE 2V83A 2V86A 2RPCA 4JI0E 2YU5A 4WSGA 4R2EA 4L8NA 1IBME 4DV1E 2JP9A 2L2KB 1BBOA 4F9CB 2RSIA 4DV4E 4DKKA 2YRMA 2YPNA 5AE3A 4BCAA 2Q8UA 2E5LE 3F6HA 2EM6A 4R8OA 3P1XA 4R2PA 4KZSA 2M4IA 3ADIA 2EP3A 3MSWA 4HEIA 4ZYGA 4DV6E 2F8BA 1TN9A 1A1FA 4J8ZA 2EWLA 5A6KA 4AQYE 3LLHA 1LLMC 1UHZA 2EPOA 1RC7A 4R03A 1EH6A 1IBKE 1A1IA 2YTPA 2VF1A 4RH8A 1MGTA 2UXCE 2EMFA 4P7DA 5A6JA 3JU0A 4DR2E 2EPXA 2LVHA 5IXMB 2CPNA 1ZU1A 4JI4E 5AC5A 3C4BA 2MC5A 4R2SA 2EMAA 4WYQB 2EOZA 1FKAE 4X65E 2ODRD 2WBTA 2UUCE 1WHQA 5LL6R 4R2CA 4X66E 3J7Yp 1HNXE 2DSYA 4LF4E 2EOMA 1N33E 4OX9E 4P78A 2LRSA 4Q35B 2EMHA 4DMIA 2V85A 2N3HA 2HC5A 2G7HA 1KYQA 4F9AB 1PDAA 2EN7A 4F54A 1AH5A 5CFFE 2H36X 2EM7A 3HQ1A 2DLKA 2DGCA 4X9JA 4DR4E 1X3CA 2EMZA 2RTXA 1SFEA 2EPMX 2RSMA 4GKJE 1DI2A 1YYOA 2EZ6A 2JXPA 2M1SA 4F2JC 2F4VE 4BHBA 1PJTA 4GZNC 2L6MA 2EOFA 3C4TA 2EMKA 5AC4A 2LTRA 2EJ4A 2EMGA 4LFBE 2ENAA 3ADLA 4GKKE 4F6MA 4WFTA 2GLIA 2ELYA 2L3JA 3M99B 2DB2A 4M30A 1YYWA 5AASA 1X5WA 4B3ME 3T1YE 2NA2A 2E72A 1SR9A 1WHNA 4BHCA 2YTFA 2EM8A 4BC7A 2EMWA 2YTEA 3BIDA 4WXCA 1L4SA 2EPLX 3BF2A 3MHHC 4O43A 4R2AA 3RMPA 5T6JA 4JI7E 2JPAA 2WBUA 3OMLA 1X6HA 2MKDA 4LU9A 3IWBA 2M9AA 2LT7A 2B7TA 1UN6B 4R2DA 4JI1E 2EM2A 1NCSA 2K4VA 2YTQA 2JYAA 2EPCA 4BMJA 2EPRA 2UUBE 2EM5A 1T38A 3AV0A 3C6MA 5A6AA 2M7QA 1JK1A 2A25A 3EPKA 1WJPA 4WX9A 4IS1C 1EH8A 2NABA 3KZYA 4BS9A 2EOQA 1XNQE 2EPNA 1B69A 1A1KA 2LO3A 5LMNE 1QNTA 2LTSA 5DNYA 3J81C 2R1FA 5ADZA 3AUZA 1TF6A 1YSAC 1DGCA 4DR7E 4MLQA 1PJSA 1HR0E 3EPJA 4OOGC 1X48A 2EN3A 2JOXA 2V87A 3H09A 2RQLA 2CT1A 2ENCA 1YUJA 2EM3A 2EMIA 2EM9A 1YFHA 3TQMA 5KL7A 3BGHA 3VK6A 1JK2A 4YY3E 2EOHA 1T4OA 4LFAE 2B3TB 1BBGA 2JOBA 4B3SE 3QG5C 1T39A 3EPHA 2WZOA 3HPZA 1RMDA 2UXDE 2YTNA 2JWOA 4DV2E 1HNZE 5BR8E 4LF8E 3VHTB 2L2NA 1GZ6A 2ZM6E 2UXBE 1XMQE 2YSPA 2LJHA 1P47A 2J7JA 5A6BD 2EN6A 2MC6A 3ADJA 3OTOE 2YTIA
chains in the Genus database with same CATH topology
4I8OA 5AE1A 2L3JA 4M2ZA 2DB2A 2V83A 4M30A 5AE2A 1X49A 4JYAE 2L2MA 3ZOQB 1YYWA 5AASA 2V86A 5F3WA 4KHPE 4JI0E 4DR5E 4JI5E 2LE2A 4B3ME 3T1YE 4L8NA 2NA2A 1FJGE 1IBME 4DV1E 2L2KB 4LF9E 4F9CB 4DV0E 4NXME 1SR9A 1WHNA 4DV4E 4JV5E 4JI3E 4BC7A 4DKKA 2B7VA 3HXLA 5AE3A 1X47A 4BCAA 3K6QA 3F6HA 2VE7C 4R8OA 1N36E 2E5LE 3P1XA 3RMPA 2NUFA 4KZSA 5T6JA 5IWAE 2M4IA 4B3TE 3MSWA 3ADIA 1XMOE 4JI7E 5LMUE 2L92A 4X8WA 2F8BA 4L5NC 4DV6E 1DI2A 4J8ZA 4LTYA 3OMLA 2EWLA 3JAMC 4AQYE 1T4NA 4LU9A 4BBYA 5IT9C 3LLHA 3IWBA 1O0WA 1ZBTA 1YYKA 3JTZA 1UHZA 4M0VA 2LUPB 4JI2E 2B7TA 2IHR1 4JI8E 1RC7A 4R03A 1IBKE 4JI6E 4JI1E 2ODRC 2K4VA 2VF1A 2RS7A 3ADGA 2UXCE 4DR3E 2RS6A 4BMJA 4TUGA 2UUBE 4P7DA 2N3GA 3JU0A 4WPYA 4DR2E 1WXRA 3AV0A 2M7QA 3FIGA 3T1HE 2CPNA 4DUYE 4X62E 4X64E 4TUIA 2V8QB 2VQFE 4BS9A 2KONA 1ZBQA 3C4BA 4JI4E 2MC5A 2UUAE 1XNQE 2DIXA 2FTXB 2JY9A 5LMNE 3KWRA 4DV7E 1YZ9A 2LTSA 4WYQB 5DNYA 3J81C 1FKAE 2DMYA 2ODRD 4X65E 5ADZA 3J80C 2UUCE 3AUZA 1XNRE 1J5EE 4Q28A 3VYXA 2L8TA 2L33A 4DR7E 3IWDA 1WHQA 4LF6E 5LL6R 4X66E 1IBLE 1HR0E 4LFCE 4NXNE 2JVAA 4LF7E 4OOGC 4DV3E 2LUQA 1X48A 2JOXA 3HPSA 3J7Yp 1HNXE 3LMLA 2DSYA 2EZ6A 2V89A 4LF4E 5FLXC 2V87A 1N33E 3H09A 1GQEA 1T4LB 4OX9E 4P78A 3IWCA 2LRSA 1DQ3A 4DR1E 4DMIA 2B9DA 4F9BB 2V85A 2YT4A 4DR6E 1I94E 3VK6A 2N3HA 4DV5E 4YY3E 2FV4B 2VQEE 1STUA 1T4OA 1RQ0A 2E1MA 4B3RE 2NUEA 4LFAE 2G7HA 2B3TB 4F9AB 3DF6A 2JOBA 3HTXA 4F54A 4B3SE 5CFFE 2WZOA 2H36X 2MDRA 2HHHE 2V88A 3HPZA 3HQ1A 4BC9A 2NUGA 4DR4E 2LBSB 4WSPA 1N34E 2YZTA 3F6GA 1J26A 2RTXA 1N32E 2UXDE 2RSMA 2JWOA 4DV2E 4GKJE 1YYOA 1EKZA 1UILA 4GEQB 5BR8E 2M1SA 1HNZE 5A2QC 2L3CA 3VYYA 4LF8E 3DJWA 2UU9E 2L2NA 3J7AG 1GZ6A 2ZM6E 2F4VE 1PKPA 1HNWE 2UXBE 1XMQE 2L6MA 2FGGA 4K0KE 3C4TA 4DUZE 4YHHE 2LJHA 2JR1A 2KOUA 2LTRA 2KHXA 4LFBE 3ADLA 4GKKE 2MC6A 2LMZA 1QU6A 3ADJA 4WFTA 3OTOE 4LF5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSY A;  2YZT A;  3KWR A;  4P78 A;  4P7D A; 
#chains in the Genus database with same CATH topology
 4N4R B;  1MEY C;  4KHP E;  3BBG A;  4DR5 E;  4JI5 E;  2LE2 A;  4DV0 E;  4NXM E;  4ZYH A;  4JV5 E;  4JI3 E;  1EH7 A;  2BBG A;  2B7V A;  2EOO A;  3HXL A;  1X47 A;  1ZR9 A;  2EOR A;  2VE7 C;  2NUF A;  2GPI A;  1ZAA C;  5LLQ A;  2PRT A;  5IWA E;  4B3T E;  4IJD A;  4ZYD A;  4LTY A;  2EOJ A;  3JAM C;  2LCE A;  4BBY A;  2VRD A;  2DLQ A;  1O0W A;  5IV8 B;  4HTG A;  2EQ0 A;  3JTZ A;  4M0V A;  1YYK A;  5A6B A;  2LUP B;  3EPL A;  2IHR 1;  1GTK A;  4JI8 E;  2WCC 3;  4JI6 E;  2ODR C;  3ADG A;  2RS7 A;  2EM0 A;  2RS6 A;  2R76 A;  2N3G A;  4WPY A;  1PJQ A;  1WXR A;  1WRJ A;  4M9V C;  5KL3 A;  3UK3 C;  3T1H E;  4DUY E;  2EOX A;  2EL5 A;  3KZZ A;  3EQ1 A;  1UBD C;  2WBS A;  2VQF E;  1ZBQ A;  2YRH A;  2DIX A;  2HGH A;  2EE8 A;  2EL4 A;  2GHF A;  4R2R A;  2EQ3 A;  1YZ9 A;  2DMY A;  2EMX A;  2EPZ A;  2EM4 A;  3J80 C;  1J5E E;  3VYX A;  1YPN A;  2L8T A;  2L33 A;  2BB8 A;  4LFC E;  2EN2 A;  4DV3 E;  1GQE A;  2LV2 A;  2EOI A;  1DQ3 A;  2B9D A;  2I13 A;  4RHB B;  1A1H A;  1IMU A;  4DV5 E;  4B3R E;  1STU A;  2MKN A;  2NUE A;  3HTX A;  2EOE A;  3C6K A;  2EML A;  3THN A;  2HJJ A;  5TSE A;  2V88 A;  1IQS A;  4BC9 A;  2HHH E;  2NUG A;  1F2I G;  2LBS B;  1N34 E;  2YZT A;  3F6G A;  1J26 A;  2EOS A;  2YTJ A;  4GEQ B;  3J7A G;  2MDG A;  5A2Q C;  3VYY A;  2UU9 E;  4DUZ E;  2JR1 A;  2ELZ A;  4NHR A;  1G2F C;  4ZYE A;  5A69 A;  1XMO E;  4LF5 E;  2N8X A;  5AE1 A;  4M2Z A;  2ADR A;  5AE2 A;  1X49 A;  2YRK A;  2L2M A;  3ZOQ B;  5KL6 A;  5F3W A;  1N3G A;  1FJG E;  2EPK X;  2K7I A;  4LF9 E;  3L00 A;  1Z1B A;  2EPU A;  1G2D C;  3K6Q A;  1N36 E;  4R2Q A;  2I9I A;  2CTD A;  2YU8 A;  5LMU E;  2EMB A;  2L92 A;  4X8W A;  4L5N C;  1IQO A;  4KWY A;  1T4N A;  1A1J A;  5IT9 C;  4F6N A;  1ZBT A;  4JI2 E;  3ECR A;  2EQ1 A;  1YUI A;  4DR3 E;  3MHS C;  4O24 A;  2EL6 A;  2EPP A;  3THO B;  1KJK A;  3FIG A;  4X62 E;  2DMI A;  4X64 E;  4TUI A;  4O5G A;  2V8Q B;  1A1G A;  2YTD A;  2KON A;  2UUA E;  5KL2 A;  2DRP A;  2FTX B;  2JY9 A;  1NEI A;  2EMC A;  3KWR A;  4DV7 E;  1AAY A;  2EPA A;  2YTG A;  1XNR E;  4Q28 A;  1TF3 A;  3IWD A;  4LF6 E;  1IBL E;  4NXN E;  2JVA A;  4LF7 E;  2LUQ A;  3HPS A;  3LML A;  2V89 A;  5FLX C;  5KL4 A;  1T4L B;  4MLV A;  3IWC A;  4DR1 E;  2ENH A;  2EN1 A;  4F9B B;  2YT4 A;  4DR6 E;  2EOY A;  1I94 E;  1A1L A;  2LJU A;  2FV4 B;  2YWQ A;  2E1M A;  4WXD A;  1RQ0 A;  2VQE E;  3DF6 A;  2YTO A;  1BB8 A;  1X6E A;  2D9H A;  2MDR A;  4WSP A;  2EMY A;  1N32 E;  5KL5 A;  1EKZ A;  1UIL A;  1HNW E;  2L3C A;  3DJW A;  4NZV A;  1PKP A;  4K0K E;  2FGG A;  4FK5 C;  2EN4 A;  4YHH E;  4O4K A;  2KOU A;  2KHX A;  2LMZ A;  1QU6 A;  2CSH A;  2YSO A;  1X6F A;  4TUG A;  2EN8 A;  4I8O A;  4JYA E;  2V83 A;  2V86 A;  2RPC A;  4JI0 E;  2YU5 A;  4WSG A;  4R2E A;  4L8N A;  1IBM E;  4DV1 E;  2JP9 A;  2L2K B;  1BBO A;  4F9C B;  2RSI A;  4DV4 E;  4DKK A;  2YRM A;  2YPN A;  5AE3 A;  4BCA A;  2Q8U A;  2E5L E;  3F6H A;  2EM6 A;  4R8O A;  3P1X A;  4R2P A;  4KZS A;  2M4I A;  3ADI A;  2EP3 A;  3MSW A;  4HEI A;  4ZYG A;  4DV6 E;  2F8B A;  1TN9 A;  1A1F A;  4J8Z A;  2EWL A;  5A6K A;  4AQY E;  3LLH A;  1LLM C;  1UHZ A;  2EPO A;  1RC7 A;  4R03 A;  1EH6 A;  1IBK E;  1A1I A;  2YTP A;  2VF1 A;  4RH8 A;  1MGT A;  2UXC E;  2EMF A;  4P7D A;  5A6J A;  3JU0 A;  4DR2 E;  2EPX A;  2LVH A;  5IXM B;  2CPN A;  1ZU1 A;  4JI4 E;  5AC5 A;  3C4B A;  2MC5 A;  4R2S A;  2EMA A;  4WYQ B;  2EOZ A;  1FKA E;  4X65 E;  2ODR D;  2WBT A;  2UUC E;  1WHQ A;  5LL6 R;  4R2C A;  4X66 E;  3J7Y p;  1HNX E;  2DSY A;  4LF4 E;  2EOM A;  1N33 E;  4OX9 E;  4P78 A;  2LRS A;  4Q35 B;  2EMH A;  4DMI A;  2V85 A;  2N3H A;  2HC5 A;  2G7H A;  1KYQ A;  4F9A B;  1PDA A;  2EN7 A;  4F54 A;  1AH5 A;  5CFF E;  2H36 X;  2EM7 A;  3HQ1 A;  2DLK A;  2DGC A;  4X9J A;  4DR4 E;  1X3C A;  2EMZ A;  2RTX A;  1SFE A;  2EPM X;  2RSM A;  4GKJ E;  1DI2 A;  1YYO A;  2EZ6 A;  2JXP A;  2M1S A;  4F2J C;  2F4V E;  4BHB A;  1PJT A;  4GZN C;  2L6M A;  2EOF A;  3C4T A;  2EMK A;  5AC4 A;  2LTR A;  2EJ4 A;  2EMG A;  4LFB E;  2ENA A;  3ADL A;  4GKK E;  4F6M A;  4WFT A;  2GLI A;  2ELY A;  2L3J A;  3M99 B;  2DB2 A;  4M30 A;  1YYW A;  5AAS A;  1X5W A;  4B3M E;  3T1Y E;  2NA2 A;  2E72 A;  1SR9 A;  1WHN A;  4BHC A;  2YTF A;  2EM8 A;  4BC7 A;  2EMW A;  2YTE A;  3BID A;  4WXC A;  1L4S A;  2EPL X;  3BF2 A;  3MHH C;  4O43 A;  4R2A A;  3RMP A;  5T6J A;  4JI7 E;  2JPA A;  2WBU A;  3OML A;  1X6H A;  2MKD A;  4LU9 A;  3IWB A;  2M9A A;  2LT7 A;  2B7T A;  1UN6 B;  4R2D A;  4JI1 E;  2EM2 A;  1NCS A;  2K4V A;  2YTQ A;  2JYA A;  2EPC A;  4BMJ A;  2EPR A;  2UUB E;  2EM5 A;  1T38 A;  3AV0 A;  3C6M A;  5A6A A;  2M7Q A;  1JK1 A;  2A25 A;  3EPK A;  1WJP A;  4WX9 A;  4IS1 C;  1EH8 A;  2NAB A;  3KZY A;  4BS9 A;  2EOQ A;  1XNQ E;  2EPN A;  1B69 A;  1A1K A;  2LO3 A;  5LMN E;  1QNT A;  2LTS A;  5DNY A;  3J81 C;  2R1F A;  5ADZ A;  3AUZ A;  1TF6 A;  1YSA C;  1DGC A;  4DR7 E;  4MLQ A;  1PJS A;  1HR0 E;  3EPJ A;  4OOG C;  1X48 A;  2EN3 A;  2JOX A;  2V87 A;  3H09 A;  2RQL A;  2CT1 A;  2ENC A;  1YUJ A;  2EM3 A;  2EMI A;  2EM9 A;  1YFH A;  3TQM A;  5KL7 A;  3BGH A;  3VK6 A;  1JK2 A;  4YY3 E;  2EOH A;  1T4O A;  4LFA E;  2B3T B;  1BBG A;  2JOB A;  4B3S E;  3QG5 C;  1T39 A;  3EPH A;  2WZO A;  3HPZ A;  1RMD A;  2UXD E;  2YTN A;  2JWO A;  4DV2 E;  1HNZ E;  5BR8 E;  4LF8 E;  3VHT B;  2L2N A;  1GZ6 A;  2ZM6 E;  2UXB E;  1XMQ E;  2YSP A;  2LJH A;  1P47 A;  2J7J A;  5A6B D;  2EN6 A;  2MC6 A;  3ADJ A;  3OTO E;  2YTI A; 
#chains in the Genus database with same CATH homology
 4I8O A;  5AE1 A;  2L3J A;  4M2Z A;  2DB2 A;  2V83 A;  4M30 A;  5AE2 A;  1X49 A;  4JYA E;  2L2M A;  3ZOQ B;  1YYW A;  5AAS A;  2V86 A;  5F3W A;  4KHP E;  4JI0 E;  4DR5 E;  4JI5 E;  2LE2 A;  4B3M E;  3T1Y E;  4L8N A;  2NA2 A;  1FJG E;  1IBM E;  4DV1 E;  2L2K B;  4LF9 E;  4F9C B;  4DV0 E;  4NXM E;  1SR9 A;  1WHN A;  4DV4 E;  4JV5 E;  4JI3 E;  4BC7 A;  4DKK A;  2B7V A;  3HXL A;  5AE3 A;  1X47 A;  4BCA A;  3K6Q A;  3F6H A;  2VE7 C;  4R8O A;  1N36 E;  2E5L E;  3P1X A;  3RMP A;  2NUF A;  4KZS A;  5T6J A;  5IWA E;  2M4I A;  4B3T E;  3MSW A;  3ADI A;  1XMO E;  4JI7 E;  5LMU E;  2L92 A;  4X8W A;  2F8B A;  4L5N C;  4DV6 E;  1DI2 A;  4J8Z A;  4LTY A;  3OML A;  2EWL A;  3JAM C;  4AQY E;  1T4N A;  4LU9 A;  4BBY A;  5IT9 C;  3LLH A;  3IWB A;  1O0W A;  1ZBT A;  1YYK A;  3JTZ A;  1UHZ A;  4M0V A;  2LUP B;  4JI2 E;  2B7T A;  2IHR 1;  4JI8 E;  1RC7 A;  4R03 A;  1IBK E;  4JI6 E;  4JI1 E;  2ODR C;  2K4V A;  2VF1 A;  2RS7 A;  3ADG A;  2UXC E;  4DR3 E;  2RS6 A;  4BMJ A;  4TUG A;  2UUB E;  4P7D A;  2N3G A;  3JU0 A;  4WPY A;  4DR2 E;  1WXR A;  3AV0 A;  2M7Q A;  3FIG A;  3T1H E;  2CPN A;  4DUY E;  4X62 E;  4X64 E;  4TUI A;  2V8Q B;  2VQF E;  4BS9 A;  2KON A;  1ZBQ A;  3C4B A;  4JI4 E;  2MC5 A;  2UUA E;  1XNQ E;  2DIX A;  2FTX B;  2JY9 A;  5LMN E;  3KWR A;  4DV7 E;  1YZ9 A;  2LTS A;  4WYQ B;  5DNY A;  3J81 C;  1FKA E;  2DMY A;  2ODR D;  4X65 E;  5ADZ A;  3J80 C;  2UUC E;  3AUZ A;  1XNR E;  1J5E E;  4Q28 A;  3VYX A;  2L8T A;  2L33 A;  4DR7 E;  3IWD A;  1WHQ A;  4LF6 E;  5LL6 R;  4X66 E;  1IBL E;  1HR0 E;  4LFC E;  4NXN E;  2JVA A;  4LF7 E;  4OOG C;  4DV3 E;  2LUQ A;  1X48 A;  2JOX A;  3HPS A;  3J7Y p;  1HNX E;  3LML A;  2DSY A;  2EZ6 A;  2V89 A;  4LF4 E;  5FLX C;  2V87 A;  1N33 E;  3H09 A;  1GQE A;  1T4L B;  4OX9 E;  4P78 A;  3IWC A;  2LRS A;  1DQ3 A;  4DR1 E;  4DMI A;  2B9D A;  4F9B B;  2V85 A;  2YT4 A;  4DR6 E;  1I94 E;  3VK6 A;  2N3H A;  4DV5 E;  4YY3 E;  2FV4 B;  2VQE E;  1STU A;  1T4O A;  1RQ0 A;  2E1M A;  4B3R E;  2NUE A;  4LFA E;  2G7H A;  2B3T B;  4F9A B;  3DF6 A;  2JOB A;  3HTX A;  4F54 A;  4B3S E;  5CFF E;  2WZO A;  2H36 X;  2MDR A;  2HHH E;  2V88 A;  3HPZ A;  3HQ1 A;  4BC9 A;  2NUG A;  4DR4 E;  2LBS B;  4WSP A;  1N34 E;  2YZT A;  3F6G A;  1J26 A;  2RTX A;  1N32 E;  2UXD E;  2RSM A;  2JWO A;  4DV2 E;  4GKJ E;  1YYO A;  1EKZ A;  1UIL A;  4GEQ B;  5BR8 E;  2M1S A;  1HNZ E;  5A2Q C;  2L3C A;  3VYY A;  4LF8 E;  3DJW A;  2UU9 E;  2L2N A;  3J7A G;  1GZ6 A;  2ZM6 E;  2F4V E;  1PKP A;  1HNW E;  2UXB E;  1XMQ E;  2L6M A;  2FGG A;  4K0K E;  3C4T A;  4DUZ E;  4YHH E;  2LJH A;  2JR1 A;  2KOU A;  2LTR A;  2KHX A;  4LFB E;  3ADL A;  4GKK E;  2MC6 A;  2LMZ A;  1QU6 A;  3ADJ A;  4WFT A;  3OTO E;  4LF5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...