2YZTA

Crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MRRRYRVVVERDEEGYFVAHVPELHAHTQAQSFEELLRRLQEAIAVSLEEERAEVVGLEGALEIEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA1756
publication title Crystal structure of uncharacterized protein TTHA1756 from Thermus thermophilus HB8: Structural variety in UPF0150 family proteins.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2yztA00
2YZTA 3KWRA 4P7DA 4P78A 2DSYA
chains in the Genus database with same CATH superfamily
2JVAA 2L2KB 3LLHA 1AAYA 2R76A 2GPIA 1YYKA 2MDGA 3HPZA 2EMAA 1B69A 1Z1BA 5DNYA 1J5EE 2MKDA 5BR8E 2WBUA 1A1JA 1T4NA 2JYAA 5A6JA 4TUIA 4DV4E 4F2JC 3BIDA 2JOBA 3DF6A 2MDRA 2LCEA 4JV5E 2EL4A 2DLQA 3EPKA 2LUPB 1X48A 4R8OA 1LLMC 2EOZA 2VF1A 2KONA 4DV1E 4DV6E 4X8WA 2EPPA 1IMUA 1N3GA 3ADGA 4DMIA 2DB2A 4F6NA 2ODRD 2EMBA 2M9AA 2YSPA 2YTIA 2V85A 2CT1A 2JWOA 3VYYA 4BMJA 2EMIA 1N32E 2B7TA 2E72A 2HC5A 4DV5E 3ADLA 2EM5A 2EM0A 4JYAE 5A2QC 2EOEA 2M1SA 4KZSA 2GLIA 3J7Yp 2CSHA 4F6MA 1EKZA 4BC7A 5IWAE 2EN4A 3C4TA 4OX9E 4LTYA 2ENAA 4F9AB 2L92A 2ELYA 1BB8A 3ZOQB 2YRHA 4DKKA 5LL6R 4WXDA 2L6MA 4NXNE 2NA2A 2EOMA 2LBSB 4LF4E 5KL3A 4GZNC 4LFCE 2MC6A 1JK2A 2EMKA 2G7HA 3F6HA 4DV2E 3UK3C 1X49A 4GKKE 5AASA 4R2EA 1SR9A 4MLQA 2LT7A 3RMPA 1IQSA 2YT4A 3LMLA 2ZM6E 1HNWE 2LVHA 2EPLX 1ZAAC 4KHPE 2V88A 2YTQA 4B3ME 4I8OA 2JXPA 2FV4B 3AUZA 3T1YE 1FKAE 4R2QA 4R03A 3HXLA 1T4OA 3OMLA 3JTZA 4NZVA 3C6KA 1UHZA 4WSGA 1MEYC 4RHBB 4JI6E 2B9DA 2M4IA 5KL5A 3QG5C 5IT9C 2R1FA 2EQ3A 2EN2A 5ADZA 2EMWA 2DGCA 2LRSA 4WPYA 2EOFA 1JK1A 4BHBA 1A1IA 4KWYA 4DR7E 5CFFE 2EM2A 1G2DC 2F4VE 3TQMA 1TF6A 1T4LB 1HR0E 3DJWA 3BBGA 1XMOE 1KJKA 1X5WA 2ADRA 2YU5A 3IWCA 1TF3A 3HTXA 2EMHA 2RSMA 1DI2A 4ZYEA 2EMYA 3JU0A 1YYOA 3HPSA 1A1GA 2GHFA 2HJJA 3L00A 1X3CA 4R2PA 1YUJA 4P78A 1PDAA 4X66E 4BC9A 1P47A 1I94E 2RS7A 5A6BA 3EPLA 1BBOA 2EPZA 2EPRA 4JI3E 1DQ3A 5IV8B 2NUEA 2JPAA 2VRDA 2YSOA 2LJUA 3MHHC 4R2RA 2YU8A 4M2ZA 4TUGA 2EM9A 2YPNA 1DGCA 4O5GA 2UU9E 4DR5E 4R2AA 1NEIA 2YTEA 4WSPA 2KHXA 1QU6A 3JAMC 4DR2E 2EL5A 2EOJA 2EPCA 3H09A 4R2DA 1FJGE 3EPHA 1ZBQA 2EP3A 4JI7E 2EPAA 2EPUA 1NCSA 1HNXE 3C4BA 3THOB 2JP9A 4DR1E 5T6JA 2WBSA 2EN8A 4B3SE 2N8XA 4DV3E 3ADIA 2YTOA 4M9VC 2YZTA 2EL6A 4M0VA 4LFAE 2K4VA 1AH5A 2EN1A 2V87A 4NHRA 4O24A 3VYXA 1EH8A 2LUQA 3OTOE 1XMQE 3BGHA 2EM3A 2YTFA 3KZYA 4WYQB 2JR1A 4LFBE 1WHNA 2MKNA 1RQ0A 1IBME 4WFTA 1F2IG 2EPKX 2EOIA 2F8BA 1X6HA 2I13A 4LF7E 1BBGA 5A6AA 2EM6A 2L33A 4DR3E 3THNA 2NABA 1YFHA 2EE8A 3M99B 1PJTA 2KOUA 2E1MA 4YY3E 2LTSA 1UN6B 3MHSC 1A1HA 2EM7A 2RTXA 2HGHA 5AE3A 4M30A 1PKPA 2M7QA 5FLXC 2EZ6A 2LJHA 5LLQA 4R2CA 4O43A 4BCAA 2DRPA 4BHCA 2EM8A 4Q28A 2V86A 5AE2A 1ZR9A 4NXME 1YSAC 2FGGA 2ENCA 2JY9A 4RH8A 1T38A 5TSEA 2EOYA 2LV2A 1WXRA 2EMZA 4BS9A 4X64E 1X6FA 2EJ4A 3K6QA 4Q35B 1UILA 1EH7A 3AV0A 2NUGA 2JOXA 2HHHE 3EQ1A 2MC5A 2EWLA 2EMXA 1WJPA 4X65E 4LF5E 4AQYE 4FK5C 4X9JA 1N36E 4YHHE 2N3HA 4WXCA 4K0KE 2VQFE 1ZU1A 4JI1E 2UUAE 2DLKA 1ZBTA 2EOHA 2B7VA 1YUIA 5KL4A 2UUCE 2EN3A 4JI8E 1A1FA 2UXBE 4DR4E 4DUZE 2VE7C 3EPJA 2EM4A 4F54A 2EOXA 2LE2A 2EQ1A 2L3CA 4P7DA 2FTXB 5AC4A 5IXMB 4HTGA 1RMDA 2Q8UA 4LF6E 1N34E 2L8TA 2PRTA 2EORA 2L2NA 2EQ0A 2LTRA 3T1HE 4ZYGA 2IHR1 2NUFA 4N4RB 2V89A 3KZZA 4IJDA 4R2SA 1TN9A 2I9IA 1GQEA 2DMIA 5KL7A 4JI2E 2EMFA 2EMCA 2EPMX 4JI0E 5KL6A 3MSWA 3ECRA 1WRJA 1O0WA 2V8QB 2EPXA 4DV0E 5AE1A 2L3JA 4X62E 4O4KA 2E5LE 3ADJA 1N33E 2DIXA 4LF8E 4OOGC 4ZYDA 4B3TE 4IS1C 1YYWA 2RQLA 2BB8A 2UUBE 4F9CB 4ZYHA 2RPCA 4B3RE 3J81C 1GZ6A 1XNQE 2CTDA 5AC5A 3IWDA 2BBGA 1YPNA 2EPOA 4MLVA 2EN6A 4DR6E 5LMUE 1L4SA 1EH6A 4DV7E 2K7IA 3FIGA 1J26A 4JI5E 1PJQA 1HNZE 3J7AG 4GKJE 1X47A 2N3GA 1X6EA 1SFEA 2UXDE 3J80C 2WZOA 2VQEE 1T39A 4GEQB 5F3WA 3F6GA 2RSIA 2YRMA 2D9HA 2L2MA 2A25A 2J7JA 4J8ZA 1IBLE 2YWQA 1WHQA 1RC7A 3VHTB 4WX9A 4L5NC 1XNRE 2EN7A 2ELZA 1IQOA 2DSYA 4LU9A 1UBDC 1IBKE 1KYQA 2WBTA 1YZ9A 3KWRA 1MGTA 2EMLA 2LMZA 3IWBA 2YTGA 1GTKA 5A69A 4JI4E 4LF9E 2YRKA 2EOQA 2V83A 2ENHA 2YTDA 3HQ1A 1QNTA 2CPNA 2UXCE 2EPNA 2EOSA 4L8NA 1A1LA 5LMNE 5A6KA 3P1XA 3C6MA 1G2FC 2H36X 1STUA 3BF2A 3VK6A 5A6BD 2DMYA 2ODRC 2YTNA 1A1KA 2EMGA 4F9BB 2RS6A 1PJSA 2EOOA 2YTJA 2YTPA 2B3TB 4BBYA 4HEIA 2WCC3 5KL2A 2LO3A 4DUYE
chains in the Genus database with same CATH topology
2JVAA 2L2KB 4JI2E 3LLHA 1RQ0A 1IBME 1YYKA 4WFTA 4JI0E 3MSWA 3HPZA 2B9DA 4JI6E 2M4IA 1O0WA 2V8QB 5DNYA 4DV0E 5IT9C 1J5EE 2F8BA 5AE1A 2L3JA 5BR8E 5ADZA 4X62E 2E5LE 4LF7E 1T4NA 3ADJA 1N33E 2DIXA 4LF8E 4OOGC 2LRSA 4TUIA 4DV4E 4B3TE 4WPYA 1YYWA 2L33A 4DR3E 2JOBA 2UUBE 3DF6A 4F9CB 4DR7E 2MDRA 5CFFE 2F4VE 4JV5E 4B3RE 1T4LB 3J81C 1HR0E 1GZ6A 2LUPB 1XNQE 1X48A 3DJWA 4R8OA 2KOUA 3IWDA 2VF1A 2E1MA 4YY3E 1XMOE 2LTSA 2KONA 4DV1E 4DV6E 2RTXA 4X8WA 5AE3A 4M30A 4DR6E 1PKPA 5LMUE 2M7QA 3IWCA 5FLXC 2EZ6A 3HTXA 2LJHA 4DV7E 3ADGA 3FIGA 2RSMA 1DI2A 4DMIA 2DB2A 1J26A 4JI5E 4BCAA 2ODRD 3JU0A 1HNZE 1YYOA 3J7AG 4GKJE 1X47A 2N3GA 2V85A 3HPSA 2UXDE 2JWOA 3J80C 4Q28A 4BMJA 2WZOA 4P78A 2VQEE 2V86A 5AE2A 3VYYA 4X66E 2B7TA 4BC9A 4GEQB 4DV5E 5F3WA 1I94E 1N32E 2RS7A 4NXME 3ADLA 2FGGA 2JY9A 3F6GA 4JYAE 5A2QC 1WXRA 4KZSA 2M1SA 4BS9A 4X64E 3J7Yp 2L2MA 4JI3E 3K6QA 1EKZA 4J8ZA 1UILA 1DQ3A 4BC7A 5IWAE 3AV0A 1IBLE 2NUGA 2JOXA 1WHQA 3C4TA 2HHHE 2NUEA 2MC5A 4LFBE 1RC7A 2EWLA 4OX9E 4LTYA 4M2ZA 4X65E 4F9AB 2L92A 4TUGA 4AQYE 4L5NC 4LF5E 1XNRE 3ZOQB 1N36E 2UU9E 4DKKA 4YHHE 2N3HA 4DR5E 2DSYA 5LL6R 4LU9A 4WSPA 1IBKE 4K0KE 2KHXA 1QU6A 2VQFE 1YZ9A 2L6MA 4JI1E 2UUAE 3KWRA 2LMZA 3JAMC 1ZBTA 4NXNE 2B7VA 2NA2A 3IWBA 4DR2E 2LBSB 2UUCE 4LF4E 4JI8E 3H09A 1FJGE 1ZBQA 4JI4E 2UXBE 4LFCE 4LF9E 2MC6A 4DR4E 4JI7E 4DUZE 2G7HA 3F6HA 4DV2E 1X49A 2VE7C 2V83A 1HNXE 4GKKE 3C4BA 4F54A 2LE2A 3HQ1A 5AASA 2L3CA 4P7DA 2CPNA 4DR1E 5T6JA 2UXCE 4B3SE 2FTXB 4L8NA 1SR9A 5LMNE 4DV3E 3RMPA 3P1XA 3ADIA 4LF6E 2YT4A 2H36X 3LMLA 2YZTA 2ZM6E 1N34E 2L8TA 1STUA 4M0VA 3VK6A 2K4VA 4LFAE 1HNWE 4KHPE 2DMYA 2V87A 2ODRC 2V88A 4B3ME 4I8OA 2L2NA 3VYXA 2LTRA 4F9BB 2FV4B 3AUZA 3T1HE 2RS6A 3T1YE 2LUQA 3OTOE 2IHR1 1XMQE 2NUFA 1FKAE 2V89A 2B3TB 4BBYA 4R03A 4WYQB 3HXLA 4DUYE 1T4OA 3OMLA 3JTZA 1GQEA 1UHZA 2JR1A 1WHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZT A;  3KWR A;  4P7D A;  4P78 A;  2DSY A; 
#chains in the Genus database with same CATH topology
 2JVA A;  2L2K B;  3LLH A;  1AAY A;  2R76 A;  2GPI A;  1YYK A;  2MDG A;  3HPZ A;  2EMA A;  1B69 A;  1Z1B A;  5DNY A;  1J5E E;  2MKD A;  5BR8 E;  2WBU A;  1A1J A;  1T4N A;  2JYA A;  5A6J A;  4TUI A;  4DV4 E;  4F2J C;  3BID A;  2JOB A;  3DF6 A;  2MDR A;  2LCE A;  4JV5 E;  2EL4 A;  2DLQ A;  3EPK A;  2LUP B;  1X48 A;  4R8O A;  1LLM C;  2EOZ A;  2VF1 A;  2KON A;  4DV1 E;  4DV6 E;  4X8W A;  2EPP A;  1IMU A;  1N3G A;  3ADG A;  4DMI A;  2DB2 A;  4F6N A;  2ODR D;  2EMB A;  2M9A A;  2YSP A;  2YTI A;  2V85 A;  2CT1 A;  2JWO A;  3VYY A;  4BMJ A;  2EMI A;  1N32 E;  2B7T A;  2E72 A;  2HC5 A;  4DV5 E;  3ADL A;  2EM5 A;  2EM0 A;  4JYA E;  5A2Q C;  2EOE A;  2M1S A;  4KZS A;  2GLI A;  3J7Y p;  2CSH A;  4F6M A;  1EKZ A;  4BC7 A;  5IWA E;  2EN4 A;  3C4T A;  4OX9 E;  4LTY A;  2ENA A;  4F9A B;  2L92 A;  2ELY A;  1BB8 A;  3ZOQ B;  2YRH A;  4DKK A;  5LL6 R;  4WXD A;  2L6M A;  4NXN E;  2NA2 A;  2EOM A;  2LBS B;  4LF4 E;  5KL3 A;  4GZN C;  4LFC E;  2MC6 A;  1JK2 A;  2EMK A;  2G7H A;  3F6H A;  4DV2 E;  3UK3 C;  1X49 A;  4GKK E;  5AAS A;  4R2E A;  1SR9 A;  4MLQ A;  2LT7 A;  3RMP A;  1IQS A;  2YT4 A;  3LML A;  2ZM6 E;  1HNW E;  2LVH A;  2EPL X;  1ZAA C;  4KHP E;  2V88 A;  2YTQ A;  4B3M E;  4I8O A;  2JXP A;  2FV4 B;  3AUZ A;  3T1Y E;  1FKA E;  4R2Q A;  4R03 A;  3HXL A;  1T4O A;  3OML A;  3JTZ A;  4NZV A;  3C6K A;  1UHZ A;  4WSG A;  1MEY C;  4RHB B;  4JI6 E;  2B9D A;  2M4I A;  5KL5 A;  3QG5 C;  5IT9 C;  2R1F A;  2EQ3 A;  2EN2 A;  5ADZ A;  2EMW A;  2DGC A;  2LRS A;  4WPY A;  2EOF A;  1JK1 A;  4BHB A;  1A1I A;  4KWY A;  4DR7 E;  5CFF E;  2EM2 A;  1G2D C;  2F4V E;  3TQM A;  1TF6 A;  1T4L B;  1HR0 E;  3DJW A;  3BBG A;  1XMO E;  1KJK A;  1X5W A;  2ADR A;  2YU5 A;  3IWC A;  1TF3 A;  3HTX A;  2EMH A;  2RSM A;  1DI2 A;  4ZYE A;  2EMY A;  3JU0 A;  1YYO A;  3HPS A;  1A1G A;  2GHF A;  2HJJ A;  3L00 A;  1X3C A;  4R2P A;  1YUJ A;  4P78 A;  1PDA A;  4X66 E;  4BC9 A;  1P47 A;  1I94 E;  2RS7 A;  5A6B A;  3EPL A;  1BBO A;  2EPZ A;  2EPR A;  4JI3 E;  1DQ3 A;  5IV8 B;  2NUE A;  2JPA A;  2VRD A;  2YSO A;  2LJU A;  3MHH C;  4R2R A;  2YU8 A;  4M2Z A;  4TUG A;  2EM9 A;  2YPN A;  1DGC A;  4O5G A;  2UU9 E;  4DR5 E;  4R2A A;  1NEI A;  2YTE A;  4WSP A;  2KHX A;  1QU6 A;  3JAM C;  4DR2 E;  2EL5 A;  2EOJ A;  2EPC A;  3H09 A;  4R2D A;  1FJG E;  3EPH A;  1ZBQ A;  2EP3 A;  4JI7 E;  2EPA A;  2EPU A;  1NCS A;  1HNX E;  3C4B A;  3THO B;  2JP9 A;  4DR1 E;  5T6J A;  2WBS A;  2EN8 A;  4B3S E;  2N8X A;  4DV3 E;  3ADI A;  2YTO A;  4M9V C;  2YZT A;  2EL6 A;  4M0V A;  4LFA E;  2K4V A;  1AH5 A;  2EN1 A;  2V87 A;  4NHR A;  4O24 A;  3VYX A;  1EH8 A;  2LUQ A;  3OTO E;  1XMQ E;  3BGH A;  2EM3 A;  2YTF A;  3KZY A;  4WYQ B;  2JR1 A;  4LFB E;  1WHN A;  2MKN A;  1RQ0 A;  1IBM E;  4WFT A;  1F2I G;  2EPK X;  2EOI A;  2F8B A;  1X6H A;  2I13 A;  4LF7 E;  1BBG A;  5A6A A;  2EM6 A;  2L33 A;  4DR3 E;  3THN A;  2NAB A;  1YFH A;  2EE8 A;  3M99 B;  1PJT A;  2KOU A;  2E1M A;  4YY3 E;  2LTS A;  1UN6 B;  3MHS C;  1A1H A;  2EM7 A;  2RTX A;  2HGH A;  5AE3 A;  4M30 A;  1PKP A;  2M7Q A;  5FLX C;  2EZ6 A;  2LJH A;  5LLQ A;  4R2C A;  4O43 A;  4BCA A;  2DRP A;  4BHC A;  2EM8 A;  4Q28 A;  2V86 A;  5AE2 A;  1ZR9 A;  4NXM E;  1YSA C;  2FGG A;  2ENC A;  2JY9 A;  4RH8 A;  1T38 A;  5TSE A;  2EOY A;  2LV2 A;  1WXR A;  2EMZ A;  4BS9 A;  4X64 E;  1X6F A;  2EJ4 A;  3K6Q A;  4Q35 B;  1UIL A;  1EH7 A;  3AV0 A;  2NUG A;  2JOX A;  2HHH E;  3EQ1 A;  2MC5 A;  2EWL A;  2EMX A;  1WJP A;  4X65 E;  4LF5 E;  4AQY E;  4FK5 C;  4X9J A;  1N36 E;  4YHH E;  2N3H A;  4WXC A;  4K0K E;  2VQF E;  1ZU1 A;  4JI1 E;  2UUA E;  2DLK A;  1ZBT A;  2EOH A;  2B7V A;  1YUI A;  5KL4 A;  2UUC E;  2EN3 A;  4JI8 E;  1A1F A;  2UXB E;  4DR4 E;  4DUZ E;  2VE7 C;  3EPJ A;  2EM4 A;  4F54 A;  2EOX A;  2LE2 A;  2EQ1 A;  2L3C A;  4P7D A;  2FTX B;  5AC4 A;  5IXM B;  4HTG A;  1RMD A;  2Q8U A;  4LF6 E;  1N34 E;  2L8T A;  2PRT A;  2EOR A;  2L2N A;  2EQ0 A;  2LTR A;  3T1H E;  4ZYG A;  2IHR 1;  2NUF A;  4N4R B;  2V89 A;  3KZZ A;  4IJD A;  4R2S A;  1TN9 A;  2I9I A;  1GQE A;  2DMI A;  5KL7 A;  4JI2 E;  2EMF A;  2EMC A;  2EPM X;  4JI0 E;  5KL6 A;  3MSW A;  3ECR A;  1WRJ A;  1O0W A;  2V8Q B;  2EPX A;  4DV0 E;  5AE1 A;  2L3J A;  4X62 E;  4O4K A;  2E5L E;  3ADJ A;  1N33 E;  2DIX A;  4LF8 E;  4OOG C;  4ZYD A;  4B3T E;  4IS1 C;  1YYW A;  2RQL A;  2BB8 A;  2UUB E;  4F9C B;  4ZYH A;  2RPC A;  4B3R E;  3J81 C;  1GZ6 A;  1XNQ E;  2CTD A;  5AC5 A;  3IWD A;  2BBG A;  1YPN A;  2EPO A;  4MLV A;  2EN6 A;  4DR6 E;  5LMU E;  1L4S A;  1EH6 A;  4DV7 E;  2K7I A;  3FIG A;  1J26 A;  4JI5 E;  1PJQ A;  1HNZ E;  3J7A G;  4GKJ E;  1X47 A;  2N3G A;  1X6E A;  1SFE A;  2UXD E;  3J80 C;  2WZO A;  2VQE E;  1T39 A;  4GEQ B;  5F3W A;  3F6G A;  2RSI A;  2YRM A;  2D9H A;  2L2M A;  2A25 A;  2J7J A;  4J8Z A;  1IBL E;  2YWQ A;  1WHQ A;  1RC7 A;  3VHT B;  4WX9 A;  4L5N C;  1XNR E;  2EN7 A;  2ELZ A;  1IQO A;  2DSY A;  4LU9 A;  1UBD C;  1IBK E;  1KYQ A;  2WBT A;  1YZ9 A;  3KWR A;  1MGT A;  2EML A;  2LMZ A;  3IWB A;  2YTG A;  1GTK A;  5A69 A;  4JI4 E;  4LF9 E;  2YRK A;  2EOQ A;  2V83 A;  2ENH A;  2YTD A;  3HQ1 A;  1QNT A;  2CPN A;  2UXC E;  2EPN A;  2EOS A;  4L8N A;  1A1L A;  5LMN E;  5A6K A;  3P1X A;  3C6M A;  1G2F C;  2H36 X;  1STU A;  3BF2 A;  3VK6 A;  5A6B D;  2DMY A;  2ODR C;  2YTN A;  1A1K A;  2EMG A;  4F9B B;  2RS6 A;  1PJS A;  2EOO A;  2YTJ A;  2YTP A;  2B3T B;  4BBY A;  4HEI A;  2WCC 3;  5KL2 A;  2LO3 A;  4DUY E; 
#chains in the Genus database with same CATH homology
 2JVA A;  2L2K B;  4JI2 E;  3LLH A;  1RQ0 A;  1IBM E;  1YYK A;  4WFT A;  4JI0 E;  3MSW A;  3HPZ A;  2B9D A;  4JI6 E;  2M4I A;  1O0W A;  2V8Q B;  5DNY A;  4DV0 E;  5IT9 C;  1J5E E;  2F8B A;  5AE1 A;  2L3J A;  5BR8 E;  5ADZ A;  4X62 E;  2E5L E;  4LF7 E;  1T4N A;  3ADJ A;  1N33 E;  2DIX A;  4LF8 E;  4OOG C;  2LRS A;  4TUI A;  4DV4 E;  4B3T E;  4WPY A;  1YYW A;  2L33 A;  4DR3 E;  2JOB A;  2UUB E;  3DF6 A;  4F9C B;  4DR7 E;  2MDR A;  5CFF E;  2F4V E;  4JV5 E;  4B3R E;  1T4L B;  3J81 C;  1HR0 E;  1GZ6 A;  2LUP B;  1XNQ E;  1X48 A;  3DJW A;  4R8O A;  2KOU A;  3IWD A;  2VF1 A;  2E1M A;  4YY3 E;  1XMO E;  2LTS A;  2KON A;  4DV1 E;  4DV6 E;  2RTX A;  4X8W A;  5AE3 A;  4M30 A;  4DR6 E;  1PKP A;  5LMU E;  2M7Q A;  3IWC A;  5FLX C;  2EZ6 A;  3HTX A;  2LJH A;  4DV7 E;  3ADG A;  3FIG A;  2RSM A;  1DI2 A;  4DMI A;  2DB2 A;  1J26 A;  4JI5 E;  4BCA A;  2ODR D;  3JU0 A;  1HNZ E;  1YYO A;  3J7A G;  4GKJ E;  1X47 A;  2N3G A;  2V85 A;  3HPS A;  2UXD E;  2JWO A;  3J80 C;  4Q28 A;  4BMJ A;  2WZO A;  4P78 A;  2VQE E;  2V86 A;  5AE2 A;  3VYY A;  4X66 E;  2B7T A;  4BC9 A;  4GEQ B;  4DV5 E;  5F3W A;  1I94 E;  1N32 E;  2RS7 A;  4NXM E;  3ADL A;  2FGG A;  2JY9 A;  3F6G A;  4JYA E;  5A2Q C;  1WXR A;  4KZS A;  2M1S A;  4BS9 A;  4X64 E;  3J7Y p;  2L2M A;  4JI3 E;  3K6Q A;  1EKZ A;  4J8Z A;  1UIL A;  1DQ3 A;  4BC7 A;  5IWA E;  3AV0 A;  1IBL E;  2NUG A;  2JOX A;  1WHQ A;  3C4T A;  2HHH E;  2NUE A;  2MC5 A;  4LFB E;  1RC7 A;  2EWL A;  4OX9 E;  4LTY A;  4M2Z A;  4X65 E;  4F9A B;  2L92 A;  4TUG A;  4AQY E;  4L5N C;  4LF5 E;  1XNR E;  3ZOQ B;  1N36 E;  2UU9 E;  4DKK A;  4YHH E;  2N3H A;  4DR5 E;  2DSY A;  5LL6 R;  4LU9 A;  4WSP A;  1IBK E;  4K0K E;  2KHX A;  1QU6 A;  2VQF E;  1YZ9 A;  2L6M A;  4JI1 E;  2UUA E;  3KWR A;  2LMZ A;  3JAM C;  1ZBT A;  4NXN E;  2B7V A;  2NA2 A;  3IWB A;  4DR2 E;  2LBS B;  2UUC E;  4LF4 E;  4JI8 E;  3H09 A;  1FJG E;  1ZBQ A;  4JI4 E;  2UXB E;  4LFC E;  4LF9 E;  2MC6 A;  4DR4 E;  4JI7 E;  4DUZ E;  2G7H A;  3F6H A;  4DV2 E;  1X49 A;  2VE7 C;  2V83 A;  1HNX E;  4GKK E;  3C4B A;  4F54 A;  2LE2 A;  3HQ1 A;  5AAS A;  2L3C A;  4P7D A;  2CPN A;  4DR1 E;  5T6J A;  2UXC E;  4B3S E;  2FTX B;  4L8N A;  1SR9 A;  5LMN E;  4DV3 E;  3RMP A;  3P1X A;  3ADI A;  4LF6 E;  2YT4 A;  2H36 X;  3LML A;  2YZT A;  2ZM6 E;  1N34 E;  2L8T A;  1STU A;  4M0V A;  3VK6 A;  2K4V A;  4LFA E;  1HNW E;  4KHP E;  2DMY A;  2V87 A;  2ODR C;  2V88 A;  4B3M E;  4I8O A;  2L2N A;  3VYX A;  2LTR A;  4F9B B;  2FV4 B;  3AUZ A;  3T1H E;  2RS6 A;  3T1Y E;  2LUQ A;  3OTO E;  2IHR 1;  1XMQ E;  2NUF A;  1FKA E;  2V89 A;  2B3T B;  4BBY A;  4R03 A;  4WYQ B;  3HXL A;  4DUY E;  1T4O A;  3OML A;  3JTZ A;  1GQE A;  1UHZ A;  2JR1 A;  1WHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...