1LLMC

Crystal structure of a zif23-gcn4 chimera bound to dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPILEDKVEELLSKNYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a designed dimeric zinc finger protein bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*CP*CP*CP*AP*CP*GP*CP*GP*TP*GP*GP*G)-3'
total genus 35
structure length 87
sequence length 87
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC02
2ENHA 2R1FA 1Z1BA 3M99B 4F2JC 2EN6A 2LVHA 2YTNA 5KL5A 2EM5A 2EMZA 2EPZA 2YU8A 1MEYC 4R2EA 1A1KA 4F6MA 3MHHC 2EM2A 2CSHA 2EN4A 2LV2A 2EPPA 2YRMA 2YTIA 2EJ4A 5KL4A 2DLQA 2YTEA 4R2AA 2EMLA 4IS1C 2DLKA 2EN3A 2JP9A 4M9VC 3MHSC 2EL6A 2M9AA 2MDGA 4R2SA 2GLIA 2MKNA 1BBOA 4R2CA 2EMAA 2ELZA 2EOZA 2DRPA 2YTGA 2EMKA 1LLMC 2EPRA 2EORA 2EM8A 2YSOA 4X9JA 3EPKA 1G2DC 1YUIA 2EOJA 2YTPA 2EM0A 1DGCA 2EPUA 2EPXA 2ELYA 1YSAC 2YU5A 4WSGA 1A1IA 2EOEA 1X3CA 2WCC3 2EM3A 2EOQA 2EQ0A 1JK1A 1A1LA 2WBUA 2YRHA 1G2FC 2EL4A 1A1HA 3EPHA 2EE8A 2EL5A 2E72A 2EMXA 4R2DA 2EMYA 2VRDA 2EOFA 5KL6A 2EQ1A 2EMCA 2RSIA 1ZR9A 1RMDA 2DMIA 2ENAA 5KL3A 2LCEA 2HGHA 2EOMA 2JPAA 2EOOA 2NABA 2YTJA 3EPLA 1P47A 3UK3C 1ZU1A 2EMHA 2EN7A 5KL7A 2YTQA 2YTDA 1WJPA 2RPCA 1X6EA 2PRTA 1A1JA 1BB8A 2EP3A 1ZAAC 4FK5C 2A25A 2EN8A 2J7JA 2D9HA 2EMBA 1X5WA 5KL2A 2I13A 2CT1A 3EPJA 1TF6A 2LT7A 2EM4A 2YTFA 1X6FA 2EMFA 4IJDA 2EOHA 2EMIA 4F6NA 1X6HA 2EOSA 1UBDC 2EM7A 2LO3A 2CTDA 3VHTB 2EN2A 4GZNC 2EMGA 1JK2A 4R2RA 1UN6B 2GHFA 1A1FA 2EM9A 2EQ3A 1YUJA 2WBTA 2YRKA 1KJKA 2EOYA 2BB8A 2EOIA 4R2QA 1A1GA 2ADRA 2EOXA 2YSPA 1B69A 2YTOA 2EMWA 2EN1A 2EM6A 2WBSA 1AAYA 1NCSA 2EPCA 2EPAA 1TF3A 4R2PA 1F2IG 2DGCA 1TN9A 2ENCA 2MKDA
chains in the Genus database with same CATH superfamily
1QU6A 4F9AB 2V87A 2JVAA 1XNRE 3F6GA 2G7HA 2LUPB 1IMUA 4F6MA 1XMQE 4LF7E 4WFTA 2EJ4A 2RTXA 1N36E 4R2AA 2JP9A 1AH5A 2NUGA 2NA2A 2GLIA 1HNXE 4LF6E 2YZTA 1T38A 4DR2E 2ODRC 4Q28A 1PKPA 2FV4B 3LLHA 2DSYA 4MLQA 1HNZE 2YSOA 2MC6A 4JYAE 5TSEA 4L8NA 2ELYA 4LF9E 1N34E 3L00A 4JI7E 2DB2A 2EOQA 4BBYA 1PJQA 4BCAA 4X8WA 2EE8A 1YFHA 1FJGE 2E72A 2EMXA 1UHZA 4DV7E 2EMYA 2V89A 4TUIA 5A6BD 5KL6A 1HNWE 2EMCA 1ZR9A 2K7IA 5LL6R 2LJHA 4DUZE 4DMIA 5KL3A 1N32E 4DR6E 1P47A 2KOUA 1EH6A 3UK3C 1XMOE 2EMHA 4WPYA 3J80C 5FLXC 3C4TA 2FGGA 3J7Yp 5CFFE 3KZZA 3ECRA 1ZAAC 4BHBA 5A6KA 4M30A 4DR7E 3AV0A 2WZOA 2EZ6A 4DR1E 4JI5E 1TF6A 2EM4A 2JY9A 2EMIA 1UBDC 2EM7A 2LO3A 2CTDA 4GZNC 4O24A 2UUCE 4KHPE 2UXBE 4GKJE 4LU9A 2EOYA 3IWBA 2ADRA 4DV5E 2EN1A 2WBSA 2EPCA 1TF3A 4B3TE 4DUYE 3BIDA 4BHCA 1TN9A 1DI2A 5IWAE 4RHBB 4JI2E 1PDAA 4K0KE 1IBKE 1DQ3A 2UXDE 1YPNA 2EN6A 5DNYA 2EM5A 2YU8A 3JTZA 3JU0A 4WXDA 1X47A 4X65E 2EM2A 4J8ZA 5LLQA 2EN4A 2E5LE 5KL4A 4X66E 1YYKA 2YTEA 4WSPA 2EN3A 3MHSC 4DR3E 4R2SA 2MKNA 1YYOA 4NZVA 5ADZA 2UU9E 4DV6E 4DV2E 1XNQE 3ADGA 2ELZA 3OMLA 4P78A 4F9CB 2DRPA 4BC7A 2B7VA 2VE7C 1X49A 3ZOQB 4OOGC 3P1XA 1IQSA 2YPNA 1HR0E 2VQFE 4DV4E 2JOBA 4X9JA 5LMUE 2EM0A 2EPUA 2EPXA 2RSMA 3KWRA 2EOEA 1WRJA 2H36X 2EM3A 4LF5E 4GEQB 4R03A 4KZSA 2YRHA 1QNTA 2WBUA 4DV1E 1MGTA 1T39A 2LE2A 1O0WA 4R2DA 4I8OA 3JAMC 2LMZA 2NUFA 2EQ1A 4KWYA 4O5GA 3MSWA 1T4OA 2JPAA 2LTRA 3T1YE 4JI8E 4R8OA 4JI0E 2EN7A 5KL7A 5IXMB 4JI4E 2VQEE 1X6EA 2KHXA 2ODRD 1X48A 2EP3A 1T4NA 2LRSA 2EPOA 2J7JA 4FK5C 5KL2A 2K4VA 4DR5E 3VK6A 5LMNE 3IWCA 3EPJA 1L4SA 1KYQA 2E1MA 1PJTA 2EPKX 2YTFA 2LT7A 4DKKA 2F8BA 4IJDA 2EOHA 4F6NA 1YYWA 3HPZA 1JK2A 2EN2A 2EWLA 4LTYA 4R2RA 2JOXA 3HTXA 2EM9A 4LF8E 4BMJA 2EQ3A 1ZBQA 1YUJA 1IQOA 3ADIA 2ZM6E 3HXLA 2BB8A 3RMPA 1A1GA 3TQMA 2DIXA 2JYAA 2EMWA 2YTOA 2LJUA 1F2IG 2DGCA 2JR1A 2ENHA 2I9IA 4LF4E 2R1FA 3C6KA 2FTXB 4NXNE 5A2QC 4HEIA 2EPZA 4AQYE 3ADJA 3DF6A 4ZYDA 2CSHA 2LV2A 2EPPA 2YRMA 1PJSA 2DLQA 2EMLA 2UUBE 4ZYEA 5AC4A 2EL6A 5AC5A 2L2KB 2MDGA 3FIGA 1BBOA 4R2CA 2M4IA 2L33A 4JI3E 1IBLE 5AE1A 1N3GA 4X62E 5AASA 5BR8E 1EH8A 2N3GA 3J7AG 1UILA 2GPIA 4BS9A 1G2DC 1YUIA 2EOJA 2YTPA 2DMYA 1DGCA 4F9BB 1YSAC 4WSGA 2N8XA 2HC5A 2WCC3 4B3ME 1EH7A 2JXPA 4NXME 2EQ0A 2F4VE 1G2FC 2EPMX 1A1HA 3EPHA 4DV0E 1EKZA 4P7DA 1N33E 4WXCA 4B3SE 1RMDA 2DMIA 2V85A 2VF1A 2UUAE 1GTKA 2ENAA 2LCEA 5F3WA 2EOMA 2YTJA 4YHHE 3OTOE 3QG5C 2YTDA 1WHNA 2PRTA 4NHRA 1T4LB 2JWOA 2A25A 2EMBA 2I13A 4GKKE 3HPSA 1J5EE 5A6AA 2EMFA 1SR9A 3H09A 2YWQA 2BBGA 2B9DA 3VHTB 1UN6B 2EMGA 2GHFA 2Q8UA 2L3CA 2L3JA 4JV5E 1GZ6A 4TUGA 2YRKA 2N3HA 5IT9C 2EOIA 4R2QA 2V8QB 4OX9E 1B69A 2B3TB 2EM6A 3AUZA 2M1SA 4ZYHA 2IHR1 3DJWA 4WX9A 1Z1BA 3M99B 2V88A 2LUQA 5A6BA 4LFBE 4F2JC 2V83A 3KZYA 2LVHA 2YTNA 2KONA 2L6MA 2EMZA 4L5NC 5KL5A 2CPNA 2MC5A 4R2EA 1I94E 1A1KA 1MEYC 3J81C 3MHHC 2HJJA 2YTIA 3C6MA 4MLVA 2L92A 4IS1C 2DLKA 4M9VC 2M9AA 4JI6E 1WHQA 2ENCA 3HQ1A 4WYQB 3T1HE 2EMAA 2RS6A 2EOZA 1STUA 4O43A 2YTGA 4RH8A 3BF2A 3EQ1A 5AE2A 2EMKA 1GQEA 1LLMC 2R76A 2MDRA 2LTSA 2V86A 1ZBTA 3IWDA 2EPRA 2EORA 2EM8A 3BGHA 3EPKA 4N4RB 1SFEA 2B7TA 1RQ0A 2YU5A 1A1IA 2EPLX 5A6JA 1X3CA 1IBME 1BBGA 3VYXA 4DV3E 1JK1A 1A1LA 3THNA 2EL4A 2EL5A 1RC7A 5IV8B 2RQLA 3VYYA 2YT4A 3BBGA 4YY3E 4DR4E 2VRDA 2EOFA 5T6JA 1YZ9A 2RSIA 4F54A 1WXRA 2HGHA 5AE3A 2EOOA 2NABA 3C4BA 3EPLA 4BC9A 1J26A 3ADLA 1NEIA 2L2NA 1ZU1A 4LFCE 2YTQA 1WJPA 2RPCA 1BB8A 1A1JA 4M0VA 4M2ZA 3LMLA 2EN8A 2D9HA 1X5WA 2NUEA 2L8TA 2CT1A 2UXCE 1X6FA 4B3RE 1X6HA 2EOSA 3K6QA 2EPNA 4X64E 4ZYGA 4Q35B 1A1FA 3THOB 5A69A 2LBSB 2L2MA 4LFAE 2WBTA 1KJKA 4HTGA 2EOXA 2YSPA 2HHHE 1FKAE 4O4KA 4JI1E 1AAYA 1NCSA 2EPAA 2M7QA 4R2PA 3F6HA 2RS7A 2MKDA
chains in the Genus database with same CATH topology
2ENHA 2R1FA 1Z1BA 3M99B 4F2JC 2EN6A 2LVHA 2YTNA 5KL5A 2EM5A 2EMZA 2EPZA 2YU8A 1MEYC 4R2EA 1A1KA 4F6MA 3MHHC 2EM2A 2CSHA 2EN4A 2LV2A 2EPPA 2YRMA 2YTIA 2EJ4A 5KL4A 2DLQA 2YTEA 4R2AA 2EMLA 4IS1C 2DLKA 2EN3A 2JP9A 4M9VC 3MHSC 2EL6A 2M9AA 2MDGA 4R2SA 2GLIA 2MKNA 1BBOA 4R2CA 2EMAA 2ELZA 2EOZA 2DRPA 2YTGA 2EMKA 1LLMC 2EPRA 2EORA 2EM8A 2YSOA 4X9JA 3EPKA 1G2DC 1YUIA 2EOJA 2YTPA 2EM0A 1DGCA 2EPUA 2EPXA 2ELYA 1YSAC 2YU5A 4WSGA 1A1IA 2EOEA 1X3CA 2WCC3 2EM3A 2EOQA 2EQ0A 1JK1A 1A1LA 2WBUA 2YRHA 1G2FC 2EL4A 1A1HA 3EPHA 2EE8A 2EL5A 2E72A 2EMXA 4R2DA 2EMYA 2VRDA 2EOFA 5KL6A 2EQ1A 2EMCA 2RSIA 1ZR9A 1RMDA 2DMIA 2ENAA 5KL3A 2LCEA 2HGHA 2EOMA 2JPAA 2EOOA 2NABA 2YTJA 3EPLA 1P47A 3UK3C 1ZU1A 2EMHA 2EN7A 5KL7A 2YTQA 2YTDA 1WJPA 2RPCA 1X6EA 2PRTA 1A1JA 1BB8A 2EP3A 1ZAAC 4FK5C 2A25A 2EN8A 2J7JA 2D9HA 2EMBA 1X5WA 5KL2A 2I13A 2CT1A 3EPJA 1TF6A 2LT7A 2EM4A 2YTFA 1X6FA 2EMFA 4IJDA 2EOHA 2EMIA 4F6NA 1X6HA 2EOSA 1UBDC 2EM7A 2LO3A 2CTDA 3VHTB 2EN2A 4GZNC 2EMGA 1JK2A 4R2RA 1UN6B 2GHFA 1A1FA 2EM9A 2EQ3A 1YUJA 2WBTA 2YRKA 1KJKA 2EOYA 2BB8A 2EOIA 4R2QA 1A1GA 2ADRA 2EOXA 2YSPA 1B69A 2YTOA 2EMWA 2EN1A 2EM6A 2WBSA 1AAYA 1NCSA 2EPCA 2EPAA 1TF3A 4R2PA 1F2IG 2DGCA 1TN9A 2ENCA 2MKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENH A;  2R1F A;  1Z1B A;  3M99 B;  4F2J C;  2EN6 A;  2LVH A;  2YTN A;  5KL5 A;  2EM5 A;  2EMZ A;  2EPZ A;  2YU8 A;  1MEY C;  4R2E A;  1A1K A;  4F6M A;  3MHH C;  2EM2 A;  2CSH A;  2EN4 A;  2LV2 A;  2EPP A;  2YRM A;  2YTI A;  2EJ4 A;  5KL4 A;  2DLQ A;  2YTE A;  4R2A A;  2EML A;  4IS1 C;  2DLK A;  2EN3 A;  2JP9 A;  4M9V C;  3MHS C;  2EL6 A;  2M9A A;  2MDG A;  4R2S A;  2GLI A;  2MKN A;  1BBO A;  4R2C A;  2EMA A;  2ELZ A;  2EOZ A;  2DRP A;  2YTG A;  2EMK A;  1LLM C;  2EPR A;  2EOR A;  2EM8 A;  2YSO A;  4X9J A;  3EPK A;  1G2D C;  1YUI A;  2EOJ A;  2YTP A;  2EM0 A;  1DGC A;  2EPU A;  2EPX A;  2ELY A;  1YSA C;  2YU5 A;  4WSG A;  1A1I A;  2EOE A;  1X3C A;  2WCC 3;  2EM3 A;  2EOQ A;  2EQ0 A;  1JK1 A;  1A1L A;  2WBU A;  2YRH A;  1G2F C;  2EL4 A;  1A1H A;  3EPH A;  2EE8 A;  2EL5 A;  2E72 A;  2EMX A;  4R2D A;  2EMY A;  2VRD A;  2EOF A;  5KL6 A;  2EQ1 A;  2EMC A;  2RSI A;  1ZR9 A;  1RMD A;  2DMI A;  2ENA A;  5KL3 A;  2LCE A;  2HGH A;  2EOM A;  2JPA A;  2EOO A;  2NAB A;  2YTJ A;  3EPL A;  1P47 A;  3UK3 C;  1ZU1 A;  2EMH A;  2EN7 A;  5KL7 A;  2YTQ A;  2YTD A;  1WJP A;  2RPC A;  1X6E A;  2PRT A;  1A1J A;  1BB8 A;  2EP3 A;  1ZAA C;  4FK5 C;  2A25 A;  2EN8 A;  2J7J A;  2D9H A;  2EMB A;  1X5W A;  5KL2 A;  2I13 A;  2CT1 A;  3EPJ A;  1TF6 A;  2LT7 A;  2EM4 A;  2YTF A;  1X6F A;  2EMF A;  4IJD A;  2EOH A;  2EMI A;  4F6N A;  1X6H A;  2EOS A;  1UBD C;  2EM7 A;  2LO3 A;  2CTD A;  3VHT B;  2EN2 A;  4GZN C;  2EMG A;  1JK2 A;  4R2R A;  1UN6 B;  2GHF A;  1A1F A;  2EM9 A;  2EQ3 A;  1YUJ A;  2WBT A;  2YRK A;  1KJK A;  2EOY A;  2BB8 A;  2EOI A;  4R2Q A;  1A1G A;  2ADR A;  2EOX A;  2YSP A;  1B69 A;  2YTO A;  2EMW A;  2EN1 A;  2EM6 A;  2WBS A;  1AAY A;  1NCS A;  2EPC A;  2EPA A;  1TF3 A;  4R2P A;  1F2I G;  2DGC A;  1TN9 A;  2ENC A;  2MKD A; 
#chains in the Genus database with same CATH topology
 1QU6 A;  4F9A B;  2V87 A;  2JVA A;  1XNR E;  3F6G A;  2G7H A;  2LUP B;  1IMU A;  4F6M A;  1XMQ E;  4LF7 E;  4WFT A;  2EJ4 A;  2RTX A;  1N36 E;  4R2A A;  2JP9 A;  1AH5 A;  2NUG A;  2NA2 A;  2GLI A;  1HNX E;  4LF6 E;  2YZT A;  1T38 A;  4DR2 E;  2ODR C;  4Q28 A;  1PKP A;  2FV4 B;  3LLH A;  2DSY A;  4MLQ A;  1HNZ E;  2YSO A;  2MC6 A;  4JYA E;  5TSE A;  4L8N A;  2ELY A;  4LF9 E;  1N34 E;  3L00 A;  4JI7 E;  2DB2 A;  2EOQ A;  4BBY A;  1PJQ A;  4BCA A;  4X8W A;  2EE8 A;  1YFH A;  1FJG E;  2E72 A;  2EMX A;  1UHZ A;  4DV7 E;  2EMY A;  2V89 A;  4TUI A;  5A6B D;  5KL6 A;  1HNW E;  2EMC A;  1ZR9 A;  2K7I A;  5LL6 R;  2LJH A;  4DUZ E;  4DMI A;  5KL3 A;  1N32 E;  4DR6 E;  1P47 A;  2KOU A;  1EH6 A;  3UK3 C;  1XMO E;  2EMH A;  4WPY A;  3J80 C;  5FLX C;  3C4T A;  2FGG A;  3J7Y p;  5CFF E;  3KZZ A;  3ECR A;  1ZAA C;  4BHB A;  5A6K A;  4M30 A;  4DR7 E;  3AV0 A;  2WZO A;  2EZ6 A;  4DR1 E;  4JI5 E;  1TF6 A;  2EM4 A;  2JY9 A;  2EMI A;  1UBD C;  2EM7 A;  2LO3 A;  2CTD A;  4GZN C;  4O24 A;  2UUC E;  4KHP E;  2UXB E;  4GKJ E;  4LU9 A;  2EOY A;  3IWB A;  2ADR A;  4DV5 E;  2EN1 A;  2WBS A;  2EPC A;  1TF3 A;  4B3T E;  4DUY E;  3BID A;  4BHC A;  1TN9 A;  1DI2 A;  5IWA E;  4RHB B;  4JI2 E;  1PDA A;  4K0K E;  1IBK E;  1DQ3 A;  2UXD E;  1YPN A;  2EN6 A;  5DNY A;  2EM5 A;  2YU8 A;  3JTZ A;  3JU0 A;  4WXD A;  1X47 A;  4X65 E;  2EM2 A;  4J8Z A;  5LLQ A;  2EN4 A;  2E5L E;  5KL4 A;  4X66 E;  1YYK A;  2YTE A;  4WSP A;  2EN3 A;  3MHS C;  4DR3 E;  4R2S A;  2MKN A;  1YYO A;  4NZV A;  5ADZ A;  2UU9 E;  4DV6 E;  4DV2 E;  1XNQ E;  3ADG A;  2ELZ A;  3OML A;  4P78 A;  4F9C B;  2DRP A;  4BC7 A;  2B7V A;  2VE7 C;  1X49 A;  3ZOQ B;  4OOG C;  3P1X A;  1IQS A;  2YPN A;  1HR0 E;  2VQF E;  4DV4 E;  2JOB A;  4X9J A;  5LMU E;  2EM0 A;  2EPU A;  2EPX A;  2RSM A;  3KWR A;  2EOE A;  1WRJ A;  2H36 X;  2EM3 A;  4LF5 E;  4GEQ B;  4R03 A;  4KZS A;  2YRH A;  1QNT A;  2WBU A;  4DV1 E;  1MGT A;  1T39 A;  2LE2 A;  1O0W A;  4R2D A;  4I8O A;  3JAM C;  2LMZ A;  2NUF A;  2EQ1 A;  4KWY A;  4O5G A;  3MSW A;  1T4O A;  2JPA A;  2LTR A;  3T1Y E;  4JI8 E;  4R8O A;  4JI0 E;  2EN7 A;  5KL7 A;  5IXM B;  4JI4 E;  2VQE E;  1X6E A;  2KHX A;  2ODR D;  1X48 A;  2EP3 A;  1T4N A;  2LRS A;  2EPO A;  2J7J A;  4FK5 C;  5KL2 A;  2K4V A;  4DR5 E;  3VK6 A;  5LMN E;  3IWC A;  3EPJ A;  1L4S A;  1KYQ A;  2E1M A;  1PJT A;  2EPK X;  2YTF A;  2LT7 A;  4DKK A;  2F8B A;  4IJD A;  2EOH A;  4F6N A;  1YYW A;  3HPZ A;  1JK2 A;  2EN2 A;  2EWL A;  4LTY A;  4R2R A;  2JOX A;  3HTX A;  2EM9 A;  4LF8 E;  4BMJ A;  2EQ3 A;  1ZBQ A;  1YUJ A;  1IQO A;  3ADI A;  2ZM6 E;  3HXL A;  2BB8 A;  3RMP A;  1A1G A;  3TQM A;  2DIX A;  2JYA A;  2EMW A;  2YTO A;  2LJU A;  1F2I G;  2DGC A;  2JR1 A;  2ENH A;  2I9I A;  4LF4 E;  2R1F A;  3C6K A;  2FTX B;  4NXN E;  5A2Q C;  4HEI A;  2EPZ A;  4AQY E;  3ADJ A;  3DF6 A;  4ZYD A;  2CSH A;  2LV2 A;  2EPP A;  2YRM A;  1PJS A;  2DLQ A;  2EML A;  2UUB E;  4ZYE A;  5AC4 A;  2EL6 A;  5AC5 A;  2L2K B;  2MDG A;  3FIG A;  1BBO A;  4R2C A;  2M4I A;  2L33 A;  4JI3 E;  1IBL E;  5AE1 A;  1N3G A;  4X62 E;  5AAS A;  5BR8 E;  1EH8 A;  2N3G A;  3J7A G;  1UIL A;  2GPI A;  4BS9 A;  1G2D C;  1YUI A;  2EOJ A;  2YTP A;  2DMY A;  1DGC A;  4F9B B;  1YSA C;  4WSG A;  2N8X A;  2HC5 A;  2WCC 3;  4B3M E;  1EH7 A;  2JXP A;  4NXM E;  2EQ0 A;  2F4V E;  1G2F C;  2EPM X;  1A1H A;  3EPH A;  4DV0 E;  1EKZ A;  4P7D A;  1N33 E;  4WXC A;  4B3S E;  1RMD A;  2DMI A;  2V85 A;  2VF1 A;  2UUA E;  1GTK A;  2ENA A;  2LCE A;  5F3W A;  2EOM A;  2YTJ A;  4YHH E;  3OTO E;  3QG5 C;  2YTD A;  1WHN A;  2PRT A;  4NHR A;  1T4L B;  2JWO A;  2A25 A;  2EMB A;  2I13 A;  4GKK E;  3HPS A;  1J5E E;  5A6A A;  2EMF A;  1SR9 A;  3H09 A;  2YWQ A;  2BBG A;  2B9D A;  3VHT B;  1UN6 B;  2EMG A;  2GHF A;  2Q8U A;  2L3C A;  2L3J A;  4JV5 E;  1GZ6 A;  4TUG A;  2YRK A;  2N3H A;  5IT9 C;  2EOI A;  4R2Q A;  2V8Q B;  4OX9 E;  1B69 A;  2B3T B;  2EM6 A;  3AUZ A;  2M1S A;  4ZYH A;  2IHR 1;  3DJW A;  4WX9 A;  1Z1B A;  3M99 B;  2V88 A;  2LUQ A;  5A6B A;  4LFB E;  4F2J C;  2V83 A;  3KZY A;  2LVH A;  2YTN A;  2KON A;  2L6M A;  2EMZ A;  4L5N C;  5KL5 A;  2CPN A;  2MC5 A;  4R2E A;  1I94 E;  1A1K A;  1MEY C;  3J81 C;  3MHH C;  2HJJ A;  2YTI A;  3C6M A;  4MLV A;  2L92 A;  4IS1 C;  2DLK A;  4M9V C;  2M9A A;  4JI6 E;  1WHQ A;  2ENC A;  3HQ1 A;  4WYQ B;  3T1H E;  2EMA A;  2RS6 A;  2EOZ A;  1STU A;  4O43 A;  2YTG A;  4RH8 A;  3BF2 A;  3EQ1 A;  5AE2 A;  2EMK A;  1GQE A;  1LLM C;  2R76 A;  2MDR A;  2LTS A;  2V86 A;  1ZBT A;  3IWD A;  2EPR A;  2EOR A;  2EM8 A;  3BGH A;  3EPK A;  4N4R B;  1SFE A;  2B7T A;  1RQ0 A;  2YU5 A;  1A1I A;  2EPL X;  5A6J A;  1X3C A;  1IBM E;  1BBG A;  3VYX A;  4DV3 E;  1JK1 A;  1A1L A;  3THN A;  2EL4 A;  2EL5 A;  1RC7 A;  5IV8 B;  2RQL A;  3VYY A;  2YT4 A;  3BBG A;  4YY3 E;  4DR4 E;  2VRD A;  2EOF A;  5T6J A;  1YZ9 A;  2RSI A;  4F54 A;  1WXR A;  2HGH A;  5AE3 A;  2EOO A;  2NAB A;  3C4B A;  3EPL A;  4BC9 A;  1J26 A;  3ADL A;  1NEI A;  2L2N A;  1ZU1 A;  4LFC E;  2YTQ A;  1WJP A;  2RPC A;  1BB8 A;  1A1J A;  4M0V A;  4M2Z A;  3LML A;  2EN8 A;  2D9H A;  1X5W A;  2NUE A;  2L8T A;  2CT1 A;  2UXC E;  1X6F A;  4B3R E;  1X6H A;  2EOS A;  3K6Q A;  2EPN A;  4X64 E;  4ZYG A;  4Q35 B;  1A1F A;  3THO B;  5A69 A;  2LBS B;  2L2M A;  4LFA E;  2WBT A;  1KJK A;  4HTG A;  2EOX A;  2YSP A;  2HHH E;  1FKA E;  4O4K A;  4JI1 E;  1AAY A;  1NCS A;  2EPA A;  2M7Q A;  4R2P A;  3F6H A;  2RS7 A;  2MKD A; 
#chains in the Genus database with same CATH homology
 2ENH A;  2R1F A;  1Z1B A;  3M99 B;  4F2J C;  2EN6 A;  2LVH A;  2YTN A;  5KL5 A;  2EM5 A;  2EMZ A;  2EPZ A;  2YU8 A;  1MEY C;  4R2E A;  1A1K A;  4F6M A;  3MHH C;  2EM2 A;  2CSH A;  2EN4 A;  2LV2 A;  2EPP A;  2YRM A;  2YTI A;  2EJ4 A;  5KL4 A;  2DLQ A;  2YTE A;  4R2A A;  2EML A;  4IS1 C;  2DLK A;  2EN3 A;  2JP9 A;  4M9V C;  3MHS C;  2EL6 A;  2M9A A;  2MDG A;  4R2S A;  2GLI A;  2MKN A;  1BBO A;  4R2C A;  2EMA A;  2ELZ A;  2EOZ A;  2DRP A;  2YTG A;  2EMK A;  1LLM C;  2EPR A;  2EOR A;  2EM8 A;  2YSO A;  4X9J A;  3EPK A;  1G2D C;  1YUI A;  2EOJ A;  2YTP A;  2EM0 A;  1DGC A;  2EPU A;  2EPX A;  2ELY A;  1YSA C;  2YU5 A;  4WSG A;  1A1I A;  2EOE A;  1X3C A;  2WCC 3;  2EM3 A;  2EOQ A;  2EQ0 A;  1JK1 A;  1A1L A;  2WBU A;  2YRH A;  1G2F C;  2EL4 A;  1A1H A;  3EPH A;  2EE8 A;  2EL5 A;  2E72 A;  2EMX A;  4R2D A;  2EMY A;  2VRD A;  2EOF A;  5KL6 A;  2EQ1 A;  2EMC A;  2RSI A;  1ZR9 A;  1RMD A;  2DMI A;  2ENA A;  5KL3 A;  2LCE A;  2HGH A;  2EOM A;  2JPA A;  2EOO A;  2NAB A;  2YTJ A;  3EPL A;  1P47 A;  3UK3 C;  1ZU1 A;  2EMH A;  2EN7 A;  5KL7 A;  2YTQ A;  2YTD A;  1WJP A;  2RPC A;  1X6E A;  2PRT A;  1A1J A;  1BB8 A;  2EP3 A;  1ZAA C;  4FK5 C;  2A25 A;  2EN8 A;  2J7J A;  2D9H A;  2EMB A;  1X5W A;  5KL2 A;  2I13 A;  2CT1 A;  3EPJ A;  1TF6 A;  2LT7 A;  2EM4 A;  2YTF A;  1X6F A;  2EMF A;  4IJD A;  2EOH A;  2EMI A;  4F6N A;  1X6H A;  2EOS A;  1UBD C;  2EM7 A;  2LO3 A;  2CTD A;  3VHT B;  2EN2 A;  4GZN C;  2EMG A;  1JK2 A;  4R2R A;  1UN6 B;  2GHF A;  1A1F A;  2EM9 A;  2EQ3 A;  1YUJ A;  2WBT A;  2YRK A;  1KJK A;  2EOY A;  2BB8 A;  2EOI A;  4R2Q A;  1A1G A;  2ADR A;  2EOX A;  2YSP A;  1B69 A;  2YTO A;  2EMW A;  2EN1 A;  2EM6 A;  2WBS A;  1AAY A;  1NCS A;  2EPC A;  2EPA A;  1TF3 A;  4R2P A;  1F2I G;  2DGC A;  1TN9 A;  2ENC A;  2MKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...