1LLMC

Crystal structure of a zif23-gcn4 chimera bound to dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPILEDKVEELLSKNYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a designed dimeric zinc finger protein bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*CP*CP*CP*AP*CP*GP*CP*GP*TP*GP*GP*G)-3'
total genus 35
structure length 87
sequence length 87
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC02
2EM8A 4R2RA 2YTQA 4F2JC 1RMDA 4X9JA 2M9AA 4IJDA 4R2PA 2GLIA 2EMAA 2YTOA 2WCC3 2EM7A 2ADRA 2EOOA 1X3CA 2EM6A 2YU8A 2EL5A 2ENHA 1KJKA 2EOZA 2A25A 2EMZA 2MDGA 2EMHA 4M9VC 2EPCA 2EMCA 1YUJA 2YTGA 3MHSC 1A1GA 1AAYA 1LLMC 2RSIA 2J7JA 2WBUA 2EPUA 2YTIA 2VRDA 2YRMA 5KL4A 2CT1A 1A1HA 2EQ0A 2WBSA 2EMGA 1A1LA 3EPLA 1A1IA 2EOJA 2EM9A 4IS1C 2EMFA 2YTNA 2EN8A 2YTFA 4WSGA 1TF6A 2YTPA 2EM3A 1JK2A 2DGCA 3UK3C 4R2CA 4R2SA 2EL6A 2R1FA 2DLQA 2EMIA 2PRTA 2EMWA 2EN6A 2CTDA 2EN1A 2YRKA 1BB8A 2EE8A 2EOEA 1MEYC 4R2DA 2DLKA 1WJPA 2HGHA 3EPJA 1DGCA 3VHTB 1BBOA 2MKNA 5KL7A 1X5WA 2EPZA 1X6EA 2CSHA 2EOMA 2JP9A 2EN2A 2BB8A 2YTJA 5KL6A 2EQ3A 1TF3A 2LV2A 1UBDC 2EMYA 3EPHA 2RPCA 2EN7A 2EOYA 1A1JA 2EN3A 1P47A 2YTEA 4F6NA 1YUIA 1NCSA 2EM4A 2EORA 5KL5A 4F6MA 3EPKA 3MHHC 2ENCA 2JPAA 2MKDA 2EL4A 1TN9A 2ELYA 2ELZA 2EJ4A 2EPRA 2EPXA 2EP3A 2LT7A 2EOIA 3M99B 2YSOA 2EOXA 2EQ1A 1X6FA 2EOQA 1ZAAC 2EM0A 4FK5C 2DMIA 2EOSA 1ZR9A 1A1FA 1X6HA 2LVHA 5KL3A 2EMLA 2ENAA 2LO3A 1F2IG 2E72A 2D9HA 2EPPA 1Z1BA 2EMXA 2YRHA 1G2FC 2EN4A 2YU5A 2EM2A 4R2QA 1ZU1A 2DRPA 2NABA 2EOFA 5KL2A 1UN6B 2EMBA 1A1KA 2LCEA 2EOHA 1YSAC 2I13A 1JK1A 4R2EA 2YSPA 2EM5A 4R2AA 1B69A 2GHFA 4GZNC 1G2DC 2EMKA 2YTDA 2WBTA 2EPAA
chains in the Genus database with same CATH superfamily
4DR6E 3K6QA 1QNTA 1PDAA 2EMAA 4O5GA 2ADRA 2MDRA 4Q35B 2EM6A 2YU8A 4DUZE 2EOZA 2N8XA 4K0KE 2A25A 2LTRA 5LMNE 2EPCA 2EMCA 3L00A 1XNRE 1LLMC 1XNQE 2WBUA 5LL6R 2EPUA 5T6JA 1J26A 4B3ME 1UHZA 2VE7C 1N33E 2EMGA 4WYQB 2M1SA 2B7VA 3C4TA 1HNZE 2NUGA 4X66E 2YZTA 2YTNA 3T1HE 5AE2A 1ZBTA 2YTPA 5A69A 1JK2A 4TUIA 2UXBE 1T39A 4GKKE 3HPZA 3BBGA 3VYXA 1N3GA 4GEQB 1BB8A 2KHXA 1UILA 3AV0A 5IV8B 4TUGA 3KZYA 1MEYC 2UUBE 1MGTA 2L8TA 5AC5A 1DGCA 2NUEA 3HQ1A 2MKNA 1X5WA 5AE3A 1WXRA 1YYKA 4KWYA 3RMPA 1FJGE 2LV2A 2V85A 4LF9E 1HR0E 2B7TA 1A1JA 2EN3A 1P47A 1DQ3A 2EORA 4F9AB 2JPAA 2DB2A 1GZ6A 5IXMB 4JI5E 1TN9A 2ELYA 3C4BA 2V88A 3ADJA 4B3RE 3DJWA 3ADIA 2EWLA 2LVHA 4KHPE 4DV7E 3ECRA 4M0VA 2LO3A 5ADZA 4LFBE 2LUQA 5LMUE 3HPSA 1XMQE 1IBKE 2IHR1 2EM2A 4JI6E 1ZU1A 4WPYA 4LFAE 1A1KA 4I8OA 1YSAC 1YYOA 1N32E 1JK1A 4HTGA 4ZYGA 4M2ZA 2EPAA 5LLQA 2EM8A 4R2RA 4DV6E 2YTQA 4JI0E 5BR8E 5A6BD 4X9JA 4IJDA 1EH8A 2F4VE 2YTOA 1PJTA 2EM7A 2E5LE 1X3CA 4DR4E 2EL5A 2ENHA 3ZOQB 4BBYA 3VK6A 2MDGA 2UUCE 1YUJA 2YTGA 1YYWA 4LTYA 2B9DA 2LTSA 4BCAA 4X62E 2YRMA 2FGGA 1PKPA 5KL4A 2LUPB 3KZZA 4DR1E 2EQ0A 2I9IA 4WX9A 1YFHA 4JI1E 3T1YE 3EPLA 3P1XA 5F3WA 4O43A 2JXPA 1YPNA 2EPLX 2ODRC 4JI2E 5A6AA 2L3CA 2EN8A 2LE2A 3KWRA 4WSGA 3ADGA 1QU6A 1TF6A 4JI3E 4R2CA 4R2SA 1FKAE 2R1FA 2NUFA 3IWDA 2PRTA 1PJQA 2EN6A 2V87A 4GKJE 2EN1A 1HNXE 2E1MA 2EPNA 3H09A 4JV5E 1EKZA 4LF7E 1ZBQA 4R2DA 4B3TE 4L5NC 2L2KB 1N36E 2RS6A 1X6EA 2CSHA 2EOMA 1RC7A 1TF3A 3HXLA 2EN7A 1NEIA 2L33A 3JAMC 1YUIA 2EPMX 4JI7E 2ENCA 2L6MA 2MKDA 4KZSA 5DNYA 2EPXA 4DR2E 2EOIA 1I94E 2YSOA 4MLVA 1X6FA 2EOQA 1IMUA 4FK5C 2FTXB 2HJJA 2EOSA 4Q28A 3TQMA 5A6BA 2ENAA 5A2QC 2FV4B 2EPPA 2D9HA 2EMXA 1DI2A 1G2FC 1WRJA 4LU9A 2EN4A 4LF6E 2N3HA 4ZYDA 1X48A 2V86A 5AASA 2UUAE 5IT9C 2EOFA 4RH8A 5KL2A 4X65E 3J7Yp 2RS7A 2LCEA 2EOHA 2LRSA 5A6KA 3VYYA 5FLXC 2YTDA 4R8OA 4DR3E 4YHHE 2LBSB 2JVAA 4F2JC 1RMDA 2RTXA 4R2PA 1WHNA 4F9CB 2WCC3 2EOOA 2JOXA 1KJKA 3BIDA 1GTKA 2EMHA 1HNWE 4J8ZA 3MHSC 1AAYA 2HHHE 5AC4A 2EZ6A 4M30A 2VRDA 1XMOE 2CT1A 1A1HA 2MC6A 2WBSA 1EH7A 4F54A 4DUYE 2R76A 2L2NA 3HTXA 1A1IA 2EOJA 2EM9A 4IS1C 4F9BB 1L4SA 2EMFA 2K4VA 2DGCA 2B3TB 2EM3A 3UK3C 2EL6A 2VQEE 4JYAE 1IQSA 2JWOA 2DLQA 2JR1A 2CTDA 3AUZA 1AH5A 1IBLE 2UU9E 2NA2A 2DLKA 4B3SE 3F6GA 4BHCA 1BBOA 4WSPA 4DKKA 2JP9A 2EN2A 5KL6A 4DR5E 3J7AG 2EQ3A 1UBDC 4X8WA 2CPNA 2YT4A 4WFTA 2RPCA 3BGHA 4X64E 2EOYA 2HC5A 3QG5C 2YTEA 4F6NA 2V8QB 5KL5A 4NZVA 2H36X 2KOUA 2LJHA 2ELZA 4YY3E 2YWQA 1T38A 1T4OA 2EQ1A 1ZAAC 2EM0A 2VQFE 5AE1A 2DMIA 1ZR9A 1A1FA 2MC5A 4DV3E 4WXDA 5KL3A 4N4RB 2EPOA 2ODRD 4MLQA 2E72A 2K7IA 2L3JA 1Z1BA 2DSYA 2GPIA 2G7HA 2YRHA 4JI8E 3THOB 4DMIA 1YZ9A 4BC7A 3BF2A 4OOGC 3JTZA 1RQ0A 2L92A 3LLHA 2ZM6E 2DRPA 1GQEA 2NABA 4NXME 2EMBA 1X47A 2YSPA 1B69A 4R03A 4RHBB 4GZNC 1G2DC 2EMKA 5CFFE 1J5EE 2WZOA 2WBTA 3IWCA 3EQ1A 1KYQA 2M9AA 2GLIA 3OTOE 1SFEA 1STUA 2DMYA 2KONA 3C6MA 3THNA 3C6KA 2EMZA 4JI4E 4M9VC 4O4KA 1A1GA 1EH6A 2RSIA 2J7JA 2YTIA 4NXNE 1SR9A 1O0WA 1A1LA 4DV0E 2UXDE 4NHRA 2VF1A 4DV4E 3J80C 1T4LB 4WXCA 3LMLA 2M7QA 1N34E 3ADLA 2YTFA 1BBGA 4O24A 4BS9A 4AQYE 2UXCE 1IQOA 2EMIA 2V83A 2EMWA 2RSMA 4LF5E 2YPNA 2YRKA 2EE8A 4P7DA 3FIGA 2DIXA 2EOEA 2F8BA 3MSWA 1WJPA 2HGHA 3EPJA 3VHTB 4HEIA 4LF8E 2EPZA 5A6JA 1IBME 2BB8A 2YTJA 5IWAE 2EMYA 3EPHA 2BBGA 2N3GA 3IWBA 4BHBA 2M4IA 4BMJA 2LMZA 1NCSA 2EM4A 4F6MA 2EPKX 3MHHC 3EPKA 2EL4A 4ZYEA 2EJ4A 2EPRA 2EP3A 2LT7A 3M99B 3DF6A 2EOXA 1PJSA 1X6HA 3OMLA 2EMLA 2L2MA 2Q8UA 4BC9A 1F2IG 2JOBA 4ZYHA 3JU0A 2V89A 2RQLA 4L8NA 2YU5A 4OX9E 4R2QA 4LFCE 3F6HA 2JYAA 2JY9A 1X49A 5TSEA 1UN6B 3J81C 2LJUA 4DV1E 4DV2E 4LF4E 4DR7E 1WHQA 2I13A 4DV5E 4R2EA 2EM5A 4R2AA 2GHFA 1T4NA 5KL7A 4P78A
chains in the Genus database with same CATH topology
2EM8A 4R2RA 2YTQA 4F2JC 1RMDA 4X9JA 2M9AA 4IJDA 4R2PA 2GLIA 2EMAA 2YTOA 2WCC3 2EM7A 2ADRA 2EOOA 1X3CA 2EM6A 2YU8A 2EL5A 2ENHA 1KJKA 2EOZA 2A25A 2EMZA 2MDGA 2EMHA 4M9VC 2EPCA 2EMCA 1YUJA 2YTGA 3MHSC 1A1GA 1AAYA 1LLMC 2RSIA 2J7JA 2WBUA 2EPUA 2YTIA 2VRDA 2YRMA 5KL4A 2CT1A 1A1HA 2EQ0A 2WBSA 2EMGA 1A1LA 3EPLA 1A1IA 2EOJA 2EM9A 4IS1C 2EMFA 2YTNA 2EN8A 2YTFA 4WSGA 1TF6A 2YTPA 2EM3A 1JK2A 2DGCA 3UK3C 4R2CA 4R2SA 2EL6A 2R1FA 2DLQA 2EMIA 2PRTA 2EMWA 2EN6A 2CTDA 2EN1A 2YRKA 1BB8A 2EE8A 2EOEA 1MEYC 4R2DA 2DLKA 1WJPA 2HGHA 3EPJA 1DGCA 3VHTB 1BBOA 2MKNA 5KL7A 1X5WA 2EPZA 1X6EA 2CSHA 2EOMA 2JP9A 2EN2A 2BB8A 2YTJA 5KL6A 2EQ3A 1TF3A 2LV2A 1UBDC 2EMYA 3EPHA 2RPCA 2EN7A 2EOYA 1A1JA 2EN3A 1P47A 2YTEA 4F6NA 1YUIA 1NCSA 2EM4A 2EORA 5KL5A 4F6MA 3EPKA 3MHHC 2ENCA 2JPAA 2MKDA 2EL4A 1TN9A 2ELYA 2ELZA 2EJ4A 2EPRA 2EPXA 2EP3A 2LT7A 2EOIA 3M99B 2YSOA 2EOXA 2EQ1A 1X6FA 2EOQA 1ZAAC 2EM0A 4FK5C 2DMIA 2EOSA 1ZR9A 1A1FA 1X6HA 2LVHA 5KL3A 2EMLA 2ENAA 2LO3A 1F2IG 2E72A 2D9HA 2EPPA 1Z1BA 2EMXA 2YRHA 1G2FC 2EN4A 2YU5A 2EM2A 4R2QA 1ZU1A 2DRPA 2NABA 2EOFA 5KL2A 1UN6B 2EMBA 1A1KA 2LCEA 2EOHA 1YSAC 2I13A 1JK1A 4R2EA 2YSPA 2EM5A 4R2AA 1B69A 2GHFA 4GZNC 1G2DC 2EMKA 2YTDA 2WBTA 2EPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM8 A;  4R2R A;  2YTQ A;  4F2J C;  1RMD A;  4X9J A;  2M9A A;  4IJD A;  4R2P A;  2GLI A;  2EMA A;  2YTO A;  2WCC 3;  2EM7 A;  2ADR A;  2EOO A;  1X3C A;  2EM6 A;  2YU8 A;  2EL5 A;  2ENH A;  1KJK A;  2EOZ A;  2A25 A;  2EMZ A;  2MDG A;  2EMH A;  4M9V C;  2EPC A;  2EMC A;  1YUJ A;  2YTG A;  3MHS C;  1A1G A;  1AAY A;  1LLM C;  2RSI A;  2J7J A;  2WBU A;  2EPU A;  2YTI A;  2VRD A;  2YRM A;  5KL4 A;  2CT1 A;  1A1H A;  2EQ0 A;  2WBS A;  2EMG A;  1A1L A;  3EPL A;  1A1I A;  2EOJ A;  2EM9 A;  4IS1 C;  2EMF A;  2YTN A;  2EN8 A;  2YTF A;  4WSG A;  1TF6 A;  2YTP A;  2EM3 A;  1JK2 A;  2DGC A;  3UK3 C;  4R2C A;  4R2S A;  2EL6 A;  2R1F A;  2DLQ A;  2EMI A;  2PRT A;  2EMW A;  2EN6 A;  2CTD A;  2EN1 A;  2YRK A;  1BB8 A;  2EE8 A;  2EOE A;  1MEY C;  4R2D A;  2DLK A;  1WJP A;  2HGH A;  3EPJ A;  1DGC A;  3VHT B;  1BBO A;  2MKN A;  5KL7 A;  1X5W A;  2EPZ A;  1X6E A;  2CSH A;  2EOM A;  2JP9 A;  2EN2 A;  2BB8 A;  2YTJ A;  5KL6 A;  2EQ3 A;  1TF3 A;  2LV2 A;  1UBD C;  2EMY A;  3EPH A;  2RPC A;  2EN7 A;  2EOY A;  1A1J A;  2EN3 A;  1P47 A;  2YTE A;  4F6N A;  1YUI A;  1NCS A;  2EM4 A;  2EOR A;  5KL5 A;  4F6M A;  3EPK A;  3MHH C;  2ENC A;  2JPA A;  2MKD A;  2EL4 A;  1TN9 A;  2ELY A;  2ELZ A;  2EJ4 A;  2EPR A;  2EPX A;  2EP3 A;  2LT7 A;  2EOI A;  3M99 B;  2YSO A;  2EOX A;  2EQ1 A;  1X6F A;  2EOQ A;  1ZAA C;  2EM0 A;  4FK5 C;  2DMI A;  2EOS A;  1ZR9 A;  1A1F A;  1X6H A;  2LVH A;  5KL3 A;  2EML A;  2ENA A;  2LO3 A;  1F2I G;  2E72 A;  2D9H A;  2EPP A;  1Z1B A;  2EMX A;  2YRH A;  1G2F C;  2EN4 A;  2YU5 A;  2EM2 A;  4R2Q A;  1ZU1 A;  2DRP A;  2NAB A;  2EOF A;  5KL2 A;  1UN6 B;  2EMB A;  1A1K A;  2LCE A;  2EOH A;  1YSA C;  2I13 A;  1JK1 A;  4R2E A;  2YSP A;  2EM5 A;  4R2A A;  1B69 A;  2GHF A;  4GZN C;  1G2D C;  2EMK A;  2YTD A;  2WBT A;  2EPA A; 
#chains in the Genus database with same CATH topology
 4DR6 E;  3K6Q A;  1QNT A;  1PDA A;  2EMA A;  4O5G A;  2ADR A;  2MDR A;  4Q35 B;  2EM6 A;  2YU8 A;  4DUZ E;  2EOZ A;  2N8X A;  4K0K E;  2A25 A;  2LTR A;  5LMN E;  2EPC A;  2EMC A;  3L00 A;  1XNR E;  1LLM C;  1XNQ E;  2WBU A;  5LL6 R;  2EPU A;  5T6J A;  1J26 A;  4B3M E;  1UHZ A;  2VE7 C;  1N33 E;  2EMG A;  4WYQ B;  2M1S A;  2B7V A;  3C4T A;  1HNZ E;  2NUG A;  4X66 E;  2YZT A;  2YTN A;  3T1H E;  5AE2 A;  1ZBT A;  2YTP A;  5A69 A;  1JK2 A;  4TUI A;  2UXB E;  1T39 A;  4GKK E;  3HPZ A;  3BBG A;  3VYX A;  1N3G A;  4GEQ B;  1BB8 A;  2KHX A;  1UIL A;  3AV0 A;  5IV8 B;  4TUG A;  3KZY A;  1MEY C;  2UUB E;  1MGT A;  2L8T A;  5AC5 A;  1DGC A;  2NUE A;  3HQ1 A;  2MKN A;  1X5W A;  5AE3 A;  1WXR A;  1YYK A;  4KWY A;  3RMP A;  1FJG E;  2LV2 A;  2V85 A;  4LF9 E;  1HR0 E;  2B7T A;  1A1J A;  2EN3 A;  1P47 A;  1DQ3 A;  2EOR A;  4F9A B;  2JPA A;  2DB2 A;  1GZ6 A;  5IXM B;  4JI5 E;  1TN9 A;  2ELY A;  3C4B A;  2V88 A;  3ADJ A;  4B3R E;  3DJW A;  3ADI A;  2EWL A;  2LVH A;  4KHP E;  4DV7 E;  3ECR A;  4M0V A;  2LO3 A;  5ADZ A;  4LFB E;  2LUQ A;  5LMU E;  3HPS A;  1XMQ E;  1IBK E;  2IHR 1;  2EM2 A;  4JI6 E;  1ZU1 A;  4WPY A;  4LFA E;  1A1K A;  4I8O A;  1YSA C;  1YYO A;  1N32 E;  1JK1 A;  4HTG A;  4ZYG A;  4M2Z A;  2EPA A;  5LLQ A;  2EM8 A;  4R2R A;  4DV6 E;  2YTQ A;  4JI0 E;  5BR8 E;  5A6B D;  4X9J A;  4IJD A;  1EH8 A;  2F4V E;  2YTO A;  1PJT A;  2EM7 A;  2E5L E;  1X3C A;  4DR4 E;  2EL5 A;  2ENH A;  3ZOQ B;  4BBY A;  3VK6 A;  2MDG A;  2UUC E;  1YUJ A;  2YTG A;  1YYW A;  4LTY A;  2B9D A;  2LTS A;  4BCA A;  4X62 E;  2YRM A;  2FGG A;  1PKP A;  5KL4 A;  2LUP B;  3KZZ A;  4DR1 E;  2EQ0 A;  2I9I A;  4WX9 A;  1YFH A;  4JI1 E;  3T1Y E;  3EPL A;  3P1X A;  5F3W A;  4O43 A;  2JXP A;  1YPN A;  2EPL X;  2ODR C;  4JI2 E;  5A6A A;  2L3C A;  2EN8 A;  2LE2 A;  3KWR A;  4WSG A;  3ADG A;  1QU6 A;  1TF6 A;  4JI3 E;  4R2C A;  4R2S A;  1FKA E;  2R1F A;  2NUF A;  3IWD A;  2PRT A;  1PJQ A;  2EN6 A;  2V87 A;  4GKJ E;  2EN1 A;  1HNX E;  2E1M A;  2EPN A;  3H09 A;  4JV5 E;  1EKZ A;  4LF7 E;  1ZBQ A;  4R2D A;  4B3T E;  4L5N C;  2L2K B;  1N36 E;  2RS6 A;  1X6E A;  2CSH A;  2EOM A;  1RC7 A;  1TF3 A;  3HXL A;  2EN7 A;  1NEI A;  2L33 A;  3JAM C;  1YUI A;  2EPM X;  4JI7 E;  2ENC A;  2L6M A;  2MKD A;  4KZS A;  5DNY A;  2EPX A;  4DR2 E;  2EOI A;  1I94 E;  2YSO A;  4MLV A;  1X6F A;  2EOQ A;  1IMU A;  4FK5 C;  2FTX B;  2HJJ A;  2EOS A;  4Q28 A;  3TQM A;  5A6B A;  2ENA A;  5A2Q C;  2FV4 B;  2EPP A;  2D9H A;  2EMX A;  1DI2 A;  1G2F C;  1WRJ A;  4LU9 A;  2EN4 A;  4LF6 E;  2N3H A;  4ZYD A;  1X48 A;  2V86 A;  5AAS A;  2UUA E;  5IT9 C;  2EOF A;  4RH8 A;  5KL2 A;  4X65 E;  3J7Y p;  2RS7 A;  2LCE A;  2EOH A;  2LRS A;  5A6K A;  3VYY A;  5FLX C;  2YTD A;  4R8O A;  4DR3 E;  4YHH E;  2LBS B;  2JVA A;  4F2J C;  1RMD A;  2RTX A;  4R2P A;  1WHN A;  4F9C B;  2WCC 3;  2EOO A;  2JOX A;  1KJK A;  3BID A;  1GTK A;  2EMH A;  1HNW E;  4J8Z A;  3MHS C;  1AAY A;  2HHH E;  5AC4 A;  2EZ6 A;  4M30 A;  2VRD A;  1XMO E;  2CT1 A;  1A1H A;  2MC6 A;  2WBS A;  1EH7 A;  4F54 A;  4DUY E;  2R76 A;  2L2N A;  3HTX A;  1A1I A;  2EOJ A;  2EM9 A;  4IS1 C;  4F9B B;  1L4S A;  2EMF A;  2K4V A;  2DGC A;  2B3T B;  2EM3 A;  3UK3 C;  2EL6 A;  2VQE E;  4JYA E;  1IQS A;  2JWO A;  2DLQ A;  2JR1 A;  2CTD A;  3AUZ A;  1AH5 A;  1IBL E;  2UU9 E;  2NA2 A;  2DLK A;  4B3S E;  3F6G A;  4BHC A;  1BBO A;  4WSP A;  4DKK A;  2JP9 A;  2EN2 A;  5KL6 A;  4DR5 E;  3J7A G;  2EQ3 A;  1UBD C;  4X8W A;  2CPN A;  2YT4 A;  4WFT A;  2RPC A;  3BGH A;  4X64 E;  2EOY A;  2HC5 A;  3QG5 C;  2YTE A;  4F6N A;  2V8Q B;  5KL5 A;  4NZV A;  2H36 X;  2KOU A;  2LJH A;  2ELZ A;  4YY3 E;  2YWQ A;  1T38 A;  1T4O A;  2EQ1 A;  1ZAA C;  2EM0 A;  2VQF E;  5AE1 A;  2DMI A;  1ZR9 A;  1A1F A;  2MC5 A;  4DV3 E;  4WXD A;  5KL3 A;  4N4R B;  2EPO A;  2ODR D;  4MLQ A;  2E72 A;  2K7I A;  2L3J A;  1Z1B A;  2DSY A;  2GPI A;  2G7H A;  2YRH A;  4JI8 E;  3THO B;  4DMI A;  1YZ9 A;  4BC7 A;  3BF2 A;  4OOG C;  3JTZ A;  1RQ0 A;  2L92 A;  3LLH A;  2ZM6 E;  2DRP A;  1GQE A;  2NAB A;  4NXM E;  2EMB A;  1X47 A;  2YSP A;  1B69 A;  4R03 A;  4RHB B;  4GZN C;  1G2D C;  2EMK A;  5CFF E;  1J5E E;  2WZO A;  2WBT A;  3IWC A;  3EQ1 A;  1KYQ A;  2M9A A;  2GLI A;  3OTO E;  1SFE A;  1STU A;  2DMY A;  2KON A;  3C6M A;  3THN A;  3C6K A;  2EMZ A;  4JI4 E;  4M9V C;  4O4K A;  1A1G A;  1EH6 A;  2RSI A;  2J7J A;  2YTI A;  4NXN E;  1SR9 A;  1O0W A;  1A1L A;  4DV0 E;  2UXD E;  4NHR A;  2VF1 A;  4DV4 E;  3J80 C;  1T4L B;  4WXC A;  3LML A;  2M7Q A;  1N34 E;  3ADL A;  2YTF A;  1BBG A;  4O24 A;  4BS9 A;  4AQY E;  2UXC E;  1IQO A;  2EMI A;  2V83 A;  2EMW A;  2RSM A;  4LF5 E;  2YPN A;  2YRK A;  2EE8 A;  4P7D A;  3FIG A;  2DIX A;  2EOE A;  2F8B A;  3MSW A;  1WJP A;  2HGH A;  3EPJ A;  3VHT B;  4HEI A;  4LF8 E;  2EPZ A;  5A6J A;  1IBM E;  2BB8 A;  2YTJ A;  5IWA E;  2EMY A;  3EPH A;  2BBG A;  2N3G A;  3IWB A;  4BHB A;  2M4I A;  4BMJ A;  2LMZ A;  1NCS A;  2EM4 A;  4F6M A;  2EPK X;  3MHH C;  3EPK A;  2EL4 A;  4ZYE A;  2EJ4 A;  2EPR A;  2EP3 A;  2LT7 A;  3M99 B;  3DF6 A;  2EOX A;  1PJS A;  1X6H A;  3OML A;  2EML A;  2L2M A;  2Q8U A;  4BC9 A;  1F2I G;  2JOB A;  4ZYH A;  3JU0 A;  2V89 A;  2RQL A;  4L8N A;  2YU5 A;  4OX9 E;  4R2Q A;  4LFC E;  3F6H A;  2JYA A;  2JY9 A;  1X49 A;  5TSE A;  1UN6 B;  3J81 C;  2LJU A;  4DV1 E;  4DV2 E;  4LF4 E;  4DR7 E;  1WHQ A;  2I13 A;  4DV5 E;  4R2E A;  2EM5 A;  4R2A A;  2GHF A;  1T4N A;  5KL7 A;  4P78 A; 
#chains in the Genus database with same CATH homology
 2EM8 A;  4R2R A;  2YTQ A;  4F2J C;  1RMD A;  4X9J A;  2M9A A;  4IJD A;  4R2P A;  2GLI A;  2EMA A;  2YTO A;  2WCC 3;  2EM7 A;  2ADR A;  2EOO A;  1X3C A;  2EM6 A;  2YU8 A;  2EL5 A;  2ENH A;  1KJK A;  2EOZ A;  2A25 A;  2EMZ A;  2MDG A;  2EMH A;  4M9V C;  2EPC A;  2EMC A;  1YUJ A;  2YTG A;  3MHS C;  1A1G A;  1AAY A;  1LLM C;  2RSI A;  2J7J A;  2WBU A;  2EPU A;  2YTI A;  2VRD A;  2YRM A;  5KL4 A;  2CT1 A;  1A1H A;  2EQ0 A;  2WBS A;  2EMG A;  1A1L A;  3EPL A;  1A1I A;  2EOJ A;  2EM9 A;  4IS1 C;  2EMF A;  2YTN A;  2EN8 A;  2YTF A;  4WSG A;  1TF6 A;  2YTP A;  2EM3 A;  1JK2 A;  2DGC A;  3UK3 C;  4R2C A;  4R2S A;  2EL6 A;  2R1F A;  2DLQ A;  2EMI A;  2PRT A;  2EMW A;  2EN6 A;  2CTD A;  2EN1 A;  2YRK A;  1BB8 A;  2EE8 A;  2EOE A;  1MEY C;  4R2D A;  2DLK A;  1WJP A;  2HGH A;  3EPJ A;  1DGC A;  3VHT B;  1BBO A;  2MKN A;  5KL7 A;  1X5W A;  2EPZ A;  1X6E A;  2CSH A;  2EOM A;  2JP9 A;  2EN2 A;  2BB8 A;  2YTJ A;  5KL6 A;  2EQ3 A;  1TF3 A;  2LV2 A;  1UBD C;  2EMY A;  3EPH A;  2RPC A;  2EN7 A;  2EOY A;  1A1J A;  2EN3 A;  1P47 A;  2YTE A;  4F6N A;  1YUI A;  1NCS A;  2EM4 A;  2EOR A;  5KL5 A;  4F6M A;  3EPK A;  3MHH C;  2ENC A;  2JPA A;  2MKD A;  2EL4 A;  1TN9 A;  2ELY A;  2ELZ A;  2EJ4 A;  2EPR A;  2EPX A;  2EP3 A;  2LT7 A;  2EOI A;  3M99 B;  2YSO A;  2EOX A;  2EQ1 A;  1X6F A;  2EOQ A;  1ZAA C;  2EM0 A;  4FK5 C;  2DMI A;  2EOS A;  1ZR9 A;  1A1F A;  1X6H A;  2LVH A;  5KL3 A;  2EML A;  2ENA A;  2LO3 A;  1F2I G;  2E72 A;  2D9H A;  2EPP A;  1Z1B A;  2EMX A;  2YRH A;  1G2F C;  2EN4 A;  2YU5 A;  2EM2 A;  4R2Q A;  1ZU1 A;  2DRP A;  2NAB A;  2EOF A;  5KL2 A;  1UN6 B;  2EMB A;  1A1K A;  2LCE A;  2EOH A;  1YSA C;  2I13 A;  1JK1 A;  4R2E A;  2YSP A;  2EM5 A;  4R2A A;  1B69 A;  2GHF A;  4GZN C;  1G2D C;  2EMK A;  2YTD A;  2WBT A;  2EPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...