1LLMC

Crystal structure of a zif23-gcn4 chimera bound to dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
b'MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPILEDKVEELLSKNYHLENEVARLKKLVGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*CP*CP*CP*AP*CP*GP*CP*GP*TP*GP*GP*G)-3'
publication title Structure of a designed dimeric zinc finger protein bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 35
structure length 87
sequence length 87
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC02
2EMHA 3EPLA 2EN7A 2DRPA 2EM2A 2EN8A 2EOMA 2EORA 1MEYC 2LO3A 2EPPA 2EM8A 5KL6A 1YUJA 2EOYA 2YSPA 2JPAA 3MHSC 2EMBA 2EMAA 2EN4A 1TF3A 4M9VC 1RMDA 2EOFA 1BBOA 4F6MA 3EPHA 2EPXA 2EMZA 3VHTB 5KL4A 2EQ1A 2LV2A 2LCEA 1YUIA 2EOSA 2YTJA 2WCC3 2EMKA 2M9AA 2EMWA 2YTPA 4GZNC 2EPZA 2DMIA 1BB8A 1JK2A 2DGCA 2WBSA 1ZAAC 2YTIA 2RSIA 2EOOA 2EMGA 2YTOA 1G2FC 1X5WA 5KL5A 4R2AA 2YU5A 4X9JA 2EM3A 3UK3C 1WJPA 1B69A 2EMLA 2EOXA 2D9HA 2CT1A 2A25A 2WBTA 2EPCA 2YTDA 2EE8A 2EOEA 1ZU1A 2EM7A 2EOIA 1X6EA 2CSHA 2EM5A 2EM9A 1DGCA 1A1JA 2EM6A 1AAYA 4IS1C 2EM4A 2EJ4A 3M99B 2VRDA 2EOZA 2RPCA 4R2DA 2EP3A 1A1FA 2YTNA 1X6FA 2EL4A 2NABA 2DLQA 2LT7A 2WBUA 2EOQA 4F6NA 2ELZA 2CTDA 2EQ3A 4R2EA 4R2RA 2PRTA 4R2QA 2BB8A 1TF6A 2EMYA 2EPUA 1F2IG 2EN3A 1UBDC 2DLKA 2E72A 2EMFA 2EM0A 2EN6A 2GHFA 2EN2A 2EN1A 1Z1BA 1X3CA 2EMIA 2ENCA 1A1IA 2HGHA 2ADRA 2EMXA 1G2DC 1LLMC 2GLIA 4FK5C 2EPAA 3EPJA 2EOJA 2YRHA 2YTGA 2YSOA 1ZR9A 2ELYA 2YRKA 3MHHC 5KL2A 2LVHA 2MKNA 1A1GA 2EMCA 1X6HA 2MDGA 2R1FA 1A1KA 2I13A 2EL6A 3EPKA 5KL7A 2EQ0A 1P47A 1NCSA 2EPRA 2J7JA 1A1HA 4F2JC 2ENHA 1YSAC 4R2CA 1A1LA 5KL3A 4WSGA 1KJKA 1UN6B 1TN9A 2JP9A 2YU8A 2YRMA 2EOHA 2YTEA 2EL5A 2YTQA 2MKDA 2YTFA 4R2PA 1JK1A 2ENAA 4R2SA 4IJDA
chains in the Genus database with same CATH superfamily
2EMHA 3DJWA 4JI8E 2EM2A 4Q28A 2LO3A 5KL6A 2YSPA 2EPMX 2EPOA 2L3CA 4JI7E 4BS9A 3IWCA 2EPXA 4DV4E 2HJJA 4ZYGA 5A69A 4MLVA 2N8XA 2DMIA 2LUQA 5TSEA 2WZOA 2WBSA 2NUFA 2RTXA 4X62E 2EOOA 2UXCE 1G2FC 1X5WA 2EM3A 5AE2A 4WFTA 5AASA 4B3SE 5FLXC 2YTDA 1MGTA 4MLQA 1DGCA 4AQYE 2CSHA 3LLHA 1A1JA 2EM6A 3ADIA 3M99B 2G7HA 2VRDA 3HXLA 2KHXA 3KZZA 4BBYA 4DR1E 1T38A 3J80C 1DQ3A 2DLQA 2LT7A 4NXNE 4DR7E 2CTDA 4P7DA 5F3WA 2B9DA 4DR5E 4R2QA 2N3HA 3MSWA 2RQLA 2JOBA 4M30A 4OOGC 5AC5A 4F9CB 2EZ6A 2DLKA 2E72A 2N3GA 2LUPB 2GPIA 2LTSA 4NZVA 2EN2A 4YY3E 4DKKA 2NUEA 2V88A 4WYQB 1NEIA 1EH7A 1LLMC 4BC9A 1HNXE 2RSMA 3TQMA 1ZR9A 4DUZE 3C4BA 2I13A 4DR2E 2EQ0A 4TUIA 1YZ9A 4B3RE 1P47A 2J7JA 4BMJA 1A1HA 1QU6A 1YSAC 1N33E 4R8OA 1ZBTA 1GQEA 4BC7A 5A6AA 2EOHA 2F8BA 3F6GA 3L00A 2MKDA 4LF7E 3JU0A 1L4SA 2ENAA 4GKJE 3THNA 1PJQA 1WXRA 2JWOA 2EN8A 4L5NC 5IT9C 2L6MA 2EM8A 4X65E 4J8ZA 1QNTA 3MHSC 1TF3A 2YPNA 4NHRA 4F6MA 4JI6E 1N32E 2EMZA 4DUYE 5KL4A 2ODRC 2EQ1A 2LV2A 1EH8A 1I94E 2UXDE 2EMKA 2LMZA 3HPSA 5LLQA 4GZNC 2EPZA 2L3JA 1GTKA 4P78A 4F9BB 1JK2A 1T4OA 3HPZA 4ZYDA 3KZYA 5A6JA 1J26A 2DSYA 4DR6E 4DMIA 2RS7A 5KL5A 2LJHA 1WJPA 1B69A 2KOUA 2EMLA 4O43A 2WBTA 1AH5A 1PKPA 1PJTA 3ECRA 1YFHA 2EOEA 1X6EA 2EOIA 5IWAE 3K6QA 3BBGA 2EJ4A 2EOZA 2VE7C 2L92A 4BHBA 4M0VA 2L2KB 1A1FA 2YTNA 2EL4A 2WBUA 2EWLA 4O24A 2FTXB 1EKZA 2ELZA 3ZOQB 4KWYA 2EQ3A 4R2EA 5LMNE 4I8OA 1TF6A 1N34E 2EN3A 1UBDC 2B7TA 4RHBB 3LMLA 4WPYA 2ADRA 2EMXA 5IXMB 4DV2E 2YZTA 2LRSA 4K0KE 2UUBE 4GEQB 2GLIA 2EPAA 2LJUA 1YPNA 1HR0E 2LE2A 2YSOA 2MKNA 4JV5E 3MHHC 1A1GA 4ZYHA 1IBME 2R1FA 4OX9E 3C6MA 4M2ZA 4DV6E 1FKAE 5AE1A 2YU8A 2DMYA 2YTEA 4WXCA 2YTQA 2YTFA 5A6BD 1XMOE 1IBLE 1X49A 4IJDA 5IV8B 2EOMA 2EORA 2EPPA 4O5GA 4WXDA 2M7QA 4B3TE 2H36X 3EQ1A 2EOYA 2JYAA 2JPAA 1FJGE 4LF4E 2EMAA 4M9VC 1RMDA 2EOFA 3EPHA 2JVAA 4F54A 2UXBE 2DIXA 2V89A 2LBSB 1YUIA 2EOSA 2YTJA 2WCC3 2EMWA 2YTPA 4BHCA 2VF1A 2E1MA 2MDRA 2F4VE 1BB8A 4BCAA 3BGHA 1T4LB 3IWBA 2ODRD 5CFFE 1ZAAC 2YTIA 1IQSA 1X48A 2EMGA 2YTOA 2L2NA 2YU5A 4X9JA 4R2AA 2EOXA 2D9HA 2CT1A 2EPCA 1ZU1A 2EM7A 2EPLX 2EM9A 1STUA 4DV3E 4KHPE 3HQ1A 1AAYA 4IS1C 2EM4A 2HHHE 4LTYA 4O4KA 4LFBE 4YHHE 3T1YE 2EP3A 2UUAE 4L8NA 1YYOA 2V83A 4F9AB 1X6FA 2L33A 1PJSA 4GKKE 2B7VA 2MC5A 2NABA 2EOQA 4F6NA 3FIGA 4DV7E 4JI1E 5DNYA 1RC7A 4HTGA 4JI0E 2BB8A 4X66E 3C6KA 1GZ6A 2Q8UA 2EMYA 2LTRA 4TUGA 4ZYEA 2B3TB 3VK6A 2EM0A 5AC4A 2GHFA 2EN1A 2DB2A 1WHNA 1X3CA 2ENCA 1A1IA 3ADJA 1UHZA 3RMPA 1RQ0A 1IBKE 1UILA 4WX9A 2ZM6E 4FK5C 2YRHA 2YTGA 3DF6A 2ELYA 2YRKA 5KL2A 4LU9A 2LVHA 2EMCA 1ZBQA 2MDGA 1A1KA 3EPKA 4KZSA 4DR3E 2V86A 2EPRA 2HC5A 1IQOA 2ENHA 1HNZE 2CPNA 4WSGA 1KJKA 3AUZA 2YRMA 5ADZA 3J7Yp 2V87A 4R2PA 1IMUA 3H09A 1O0WA 3EPLA 2BBGA 5AE3A 2EN7A 3QG5C 3BF2A 2DRPA 1MEYC 1YUJA 5LL6R 3J81C 2UU9E 2VQFE 3ADGA 2EMBA 2EN4A 1BBOA 3KWRA 1N36E 4JI2E 3VHTB 3J7AG 2LCEA 1XMQE 4Q35B 2JY9A 3AV0A 4R03A 1HNWE 2M9AA 1PDAA 3VYXA 3OMLA 4JYAE 1YYWA 1SR9A 5A6BA 2DGCA 3JTZA 3JAMC 2EPNA 2K4VA 1YYKA 2RSIA 3C4TA 2MC6A 2V8QB 4DV1E 2E5LE 3UK3C 1J5EE 5A6KA 4DV5E 2RS6A 3THOB 2NUGA 2K7IA 2A25A 2EE8A 2R76A 4LFCE 2EM5A 2JXPA 2VQEE 2RPCA 1XNQE 4R2DA 2FGGA 4LF8E 1WHQA 3VYYA 3P1XA 4JI5E 5T6JA 2L8TA 2V85A 2YT4A 5A2QC 2UUCE 2KONA 1N3GA 4DR4E 4X8WA 2YWQA 4R2RA 3ADLA 1T4NA 2IHR1 2PRTA 4LF5E 4RH8A 4X64E 2FV4B 2EPUA 4HEIA 4B3ME 4WSPA 1F2IG 2M4IA 2JR1A 2NA2A 2EMFA 2EN6A 2M1SA 4LFAE 1Z1BA 2EMIA 4LF9E 1T39A 2HGHA 4JI4E 1WRJA 1G2DC 1X47A 4LF6E 5BR8E 3BIDA 3F6HA 2L2MA 3EPJA 1KYQA 2EOJA 4NXME 1EH6A 1X6HA 3IWDA 2EL6A 4DV0E 1BBGA 5KL7A 4JI3E 1XNRE 2I9IA 3T1HE 1NCSA 4F2JC 4R2CA 1A1LA 5KL3A 1UN6B 1TN9A 2JP9A 3OTOE 4N4RB 2EL5A 2EPKX 5LMUE 1JK1A 3HTXA 2JOXA 1SFEA 1DI2A 4R2SA
chains in the Genus database with same CATH topology
2EMHA 3EPLA 2EN7A 2DRPA 2EM2A 2EN8A 2EOMA 2EORA 1MEYC 2LO3A 2EPPA 2EM8A 5KL6A 1YUJA 2EOYA 2YSPA 2JPAA 3MHSC 2EMBA 2EMAA 2EN4A 1TF3A 4M9VC 1RMDA 2EOFA 1BBOA 4F6MA 3EPHA 2EPXA 2EMZA 3VHTB 5KL4A 2EQ1A 2LV2A 2LCEA 1YUIA 2EOSA 2YTJA 2WCC3 2EMKA 2M9AA 2EMWA 2YTPA 4GZNC 2EPZA 2DMIA 1BB8A 1JK2A 2DGCA 2WBSA 1ZAAC 2YTIA 2RSIA 2EOOA 2EMGA 2YTOA 1G2FC 1X5WA 5KL5A 4R2AA 2YU5A 4X9JA 2EM3A 3UK3C 1WJPA 1B69A 2EMLA 2EOXA 2D9HA 2CT1A 2A25A 2WBTA 2EPCA 2YTDA 2EE8A 2EOEA 1ZU1A 2EM7A 2EOIA 1X6EA 2CSHA 2EM5A 2EM9A 1DGCA 1A1JA 2EM6A 1AAYA 4IS1C 2EM4A 2EJ4A 3M99B 2VRDA 2EOZA 2RPCA 4R2DA 2EP3A 1A1FA 2YTNA 1X6FA 2EL4A 2NABA 2DLQA 2LT7A 2WBUA 2EOQA 4F6NA 2ELZA 2CTDA 2EQ3A 4R2EA 4R2RA 2PRTA 4R2QA 2BB8A 1TF6A 2EMYA 2EPUA 1F2IG 2EN3A 1UBDC 2DLKA 2E72A 2EMFA 2EM0A 2EN6A 2GHFA 2EN2A 2EN1A 1Z1BA 1X3CA 2EMIA 2ENCA 1A1IA 2HGHA 2ADRA 2EMXA 1G2DC 1LLMC 2GLIA 4FK5C 2EPAA 3EPJA 2EOJA 2YRHA 2YTGA 2YSOA 1ZR9A 2ELYA 2YRKA 3MHHC 5KL2A 2LVHA 2MKNA 1A1GA 2EMCA 1X6HA 2MDGA 2R1FA 1A1KA 2I13A 2EL6A 3EPKA 5KL7A 2EQ0A 1P47A 1NCSA 2EPRA 2J7JA 1A1HA 4F2JC 2ENHA 1YSAC 4R2CA 1A1LA 5KL3A 4WSGA 1KJKA 1UN6B 1TN9A 2JP9A 2YU8A 2YRMA 2EOHA 2YTEA 2EL5A 2YTQA 2MKDA 2YTFA 4R2PA 1JK1A 2ENAA 4R2SA 4IJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMH A;  3EPL A;  2EN7 A;  2DRP A;  2EM2 A;  2EN8 A;  2EOM A;  2EOR A;  1MEY C;  2LO3 A;  2EPP A;  2EM8 A;  5KL6 A;  1YUJ A;  2EOY A;  2YSP A;  2JPA A;  3MHS C;  2EMB A;  2EMA A;  2EN4 A;  1TF3 A;  4M9V C;  1RMD A;  2EOF A;  1BBO A;  4F6M A;  3EPH A;  2EPX A;  2EMZ A;  3VHT B;  5KL4 A;  2EQ1 A;  2LV2 A;  2LCE A;  1YUI A;  2EOS A;  2YTJ A;  2WCC 3;  2EMK A;  2M9A A;  2EMW A;  2YTP A;  4GZN C;  2EPZ A;  2DMI A;  1BB8 A;  1JK2 A;  2DGC A;  2WBS A;  1ZAA C;  2YTI A;  2RSI A;  2EOO A;  2EMG A;  2YTO A;  1G2F C;  1X5W A;  5KL5 A;  4R2A A;  2YU5 A;  4X9J A;  2EM3 A;  3UK3 C;  1WJP A;  1B69 A;  2EML A;  2EOX A;  2D9H A;  2CT1 A;  2A25 A;  2WBT A;  2EPC A;  2YTD A;  2EE8 A;  2EOE A;  1ZU1 A;  2EM7 A;  2EOI A;  1X6E A;  2CSH A;  2EM5 A;  2EM9 A;  1DGC A;  1A1J A;  2EM6 A;  1AAY A;  4IS1 C;  2EM4 A;  2EJ4 A;  3M99 B;  2VRD A;  2EOZ A;  2RPC A;  4R2D A;  2EP3 A;  1A1F A;  2YTN A;  1X6F A;  2EL4 A;  2NAB A;  2DLQ A;  2LT7 A;  2WBU A;  2EOQ A;  4F6N A;  2ELZ A;  2CTD A;  2EQ3 A;  4R2E A;  4R2R A;  2PRT A;  4R2Q A;  2BB8 A;  1TF6 A;  2EMY A;  2EPU A;  1F2I G;  2EN3 A;  1UBD C;  2DLK A;  2E72 A;  2EMF A;  2EM0 A;  2EN6 A;  2GHF A;  2EN2 A;  2EN1 A;  1Z1B A;  1X3C A;  2EMI A;  2ENC A;  1A1I A;  2HGH A;  2ADR A;  2EMX A;  1G2D C;  1LLM C;  2GLI A;  4FK5 C;  2EPA A;  3EPJ A;  2EOJ A;  2YRH A;  2YTG A;  2YSO A;  1ZR9 A;  2ELY A;  2YRK A;  3MHH C;  5KL2 A;  2LVH A;  2MKN A;  1A1G A;  2EMC A;  1X6H A;  2MDG A;  2R1F A;  1A1K A;  2I13 A;  2EL6 A;  3EPK A;  5KL7 A;  2EQ0 A;  1P47 A;  1NCS A;  2EPR A;  2J7J A;  1A1H A;  4F2J C;  2ENH A;  1YSA C;  4R2C A;  1A1L A;  5KL3 A;  4WSG A;  1KJK A;  1UN6 B;  1TN9 A;  2JP9 A;  2YU8 A;  2YRM A;  2EOH A;  2YTE A;  2EL5 A;  2YTQ A;  2MKD A;  2YTF A;  4R2P A;  1JK1 A;  2ENA A;  4R2S A;  4IJD A; 
#chains in the Genus database with same CATH topology
 2EMH A;  3DJW A;  4JI8 E;  2EM2 A;  4Q28 A;  2LO3 A;  5KL6 A;  2YSP A;  2EPM X;  2EPO A;  2L3C A;  4JI7 E;  4BS9 A;  3IWC A;  2EPX A;  4DV4 E;  2HJJ A;  4ZYG A;  5A69 A;  4MLV A;  2N8X A;  2DMI A;  2LUQ A;  5TSE A;  2WZO A;  2WBS A;  2NUF A;  2RTX A;  4X62 E;  2EOO A;  2UXC E;  1G2F C;  1X5W A;  2EM3 A;  5AE2 A;  4WFT A;  5AAS A;  4B3S E;  5FLX C;  2YTD A;  1MGT A;  4MLQ A;  1DGC A;  4AQY E;  2CSH A;  3LLH A;  1A1J A;  2EM6 A;  3ADI A;  3M99 B;  2G7H A;  2VRD A;  3HXL A;  2KHX A;  3KZZ A;  4BBY A;  4DR1 E;  1T38 A;  3J80 C;  1DQ3 A;  2DLQ A;  2LT7 A;  4NXN E;  4DR7 E;  2CTD A;  4P7D A;  5F3W A;  2B9D A;  4DR5 E;  4R2Q A;  2N3H A;  3MSW A;  2RQL A;  2JOB A;  4M30 A;  4OOG C;  5AC5 A;  4F9C B;  2EZ6 A;  2DLK A;  2E72 A;  2N3G A;  2LUP B;  2GPI A;  2LTS A;  4NZV A;  2EN2 A;  4YY3 E;  4DKK A;  2NUE A;  2V88 A;  4WYQ B;  1NEI A;  1EH7 A;  1LLM C;  4BC9 A;  1HNX E;  2RSM A;  3TQM A;  1ZR9 A;  4DUZ E;  3C4B A;  2I13 A;  4DR2 E;  2EQ0 A;  4TUI A;  1YZ9 A;  4B3R E;  1P47 A;  2J7J A;  4BMJ A;  1A1H A;  1QU6 A;  1YSA C;  1N33 E;  4R8O A;  1ZBT A;  1GQE A;  4BC7 A;  5A6A A;  2EOH A;  2F8B A;  3F6G A;  3L00 A;  2MKD A;  4LF7 E;  3JU0 A;  1L4S A;  2ENA A;  4GKJ E;  3THN A;  1PJQ A;  1WXR A;  2JWO A;  2EN8 A;  4L5N C;  5IT9 C;  2L6M A;  2EM8 A;  4X65 E;  4J8Z A;  1QNT A;  3MHS C;  1TF3 A;  2YPN A;  4NHR A;  4F6M A;  4JI6 E;  1N32 E;  2EMZ A;  4DUY E;  5KL4 A;  2ODR C;  2EQ1 A;  2LV2 A;  1EH8 A;  1I94 E;  2UXD E;  2EMK A;  2LMZ A;  3HPS A;  5LLQ A;  4GZN C;  2EPZ A;  2L3J A;  1GTK A;  4P78 A;  4F9B B;  1JK2 A;  1T4O A;  3HPZ A;  4ZYD A;  3KZY A;  5A6J A;  1J26 A;  2DSY A;  4DR6 E;  4DMI A;  2RS7 A;  5KL5 A;  2LJH A;  1WJP A;  1B69 A;  2KOU A;  2EML A;  4O43 A;  2WBT A;  1AH5 A;  1PKP A;  1PJT A;  3ECR A;  1YFH A;  2EOE A;  1X6E A;  2EOI A;  5IWA E;  3K6Q A;  3BBG A;  2EJ4 A;  2EOZ A;  2VE7 C;  2L92 A;  4BHB A;  4M0V A;  2L2K B;  1A1F A;  2YTN A;  2EL4 A;  2WBU A;  2EWL A;  4O24 A;  2FTX B;  1EKZ A;  2ELZ A;  3ZOQ B;  4KWY A;  2EQ3 A;  4R2E A;  5LMN E;  4I8O A;  1TF6 A;  1N34 E;  2EN3 A;  1UBD C;  2B7T A;  4RHB B;  3LML A;  4WPY A;  2ADR A;  2EMX A;  5IXM B;  4DV2 E;  2YZT A;  2LRS A;  4K0K E;  2UUB E;  4GEQ B;  2GLI A;  2EPA A;  2LJU A;  1YPN A;  1HR0 E;  2LE2 A;  2YSO A;  2MKN A;  4JV5 E;  3MHH C;  1A1G A;  4ZYH A;  1IBM E;  2R1F A;  4OX9 E;  3C6M A;  4M2Z A;  4DV6 E;  1FKA E;  5AE1 A;  2YU8 A;  2DMY A;  2YTE A;  4WXC A;  2YTQ A;  2YTF A;  5A6B D;  1XMO E;  1IBL E;  1X49 A;  4IJD A;  5IV8 B;  2EOM A;  2EOR A;  2EPP A;  4O5G A;  4WXD A;  2M7Q A;  4B3T E;  2H36 X;  3EQ1 A;  2EOY A;  2JYA A;  2JPA A;  1FJG E;  4LF4 E;  2EMA A;  4M9V C;  1RMD A;  2EOF A;  3EPH A;  2JVA A;  4F54 A;  2UXB E;  2DIX A;  2V89 A;  2LBS B;  1YUI A;  2EOS A;  2YTJ A;  2WCC 3;  2EMW A;  2YTP A;  4BHC A;  2VF1 A;  2E1M A;  2MDR A;  2F4V E;  1BB8 A;  4BCA A;  3BGH A;  1T4L B;  3IWB A;  2ODR D;  5CFF E;  1ZAA C;  2YTI A;  1IQS A;  1X48 A;  2EMG A;  2YTO A;  2L2N A;  2YU5 A;  4X9J A;  4R2A A;  2EOX A;  2D9H A;  2CT1 A;  2EPC A;  1ZU1 A;  2EM7 A;  2EPL X;  2EM9 A;  1STU A;  4DV3 E;  4KHP E;  3HQ1 A;  1AAY A;  4IS1 C;  2EM4 A;  2HHH E;  4LTY A;  4O4K A;  4LFB E;  4YHH E;  3T1Y E;  2EP3 A;  2UUA E;  4L8N A;  1YYO A;  2V83 A;  4F9A B;  1X6F A;  2L33 A;  1PJS A;  4GKK E;  2B7V A;  2MC5 A;  2NAB A;  2EOQ A;  4F6N A;  3FIG A;  4DV7 E;  4JI1 E;  5DNY A;  1RC7 A;  4HTG A;  4JI0 E;  2BB8 A;  4X66 E;  3C6K A;  1GZ6 A;  2Q8U A;  2EMY A;  2LTR A;  4TUG A;  4ZYE A;  2B3T B;  3VK6 A;  2EM0 A;  5AC4 A;  2GHF A;  2EN1 A;  2DB2 A;  1WHN A;  1X3C A;  2ENC A;  1A1I A;  3ADJ A;  1UHZ A;  3RMP A;  1RQ0 A;  1IBK E;  1UIL A;  4WX9 A;  2ZM6 E;  4FK5 C;  2YRH A;  2YTG A;  3DF6 A;  2ELY A;  2YRK A;  5KL2 A;  4LU9 A;  2LVH A;  2EMC A;  1ZBQ A;  2MDG A;  1A1K A;  3EPK A;  4KZS A;  4DR3 E;  2V86 A;  2EPR A;  2HC5 A;  1IQO A;  2ENH A;  1HNZ E;  2CPN A;  4WSG A;  1KJK A;  3AUZ A;  2YRM A;  5ADZ A;  3J7Y p;  2V87 A;  4R2P A;  1IMU A;  3H09 A;  1O0W A;  3EPL A;  2BBG A;  5AE3 A;  2EN7 A;  3QG5 C;  3BF2 A;  2DRP A;  1MEY C;  1YUJ A;  5LL6 R;  3J81 C;  2UU9 E;  2VQF E;  3ADG A;  2EMB A;  2EN4 A;  1BBO A;  3KWR A;  1N36 E;  4JI2 E;  3VHT B;  3J7A G;  2LCE A;  1XMQ E;  4Q35 B;  2JY9 A;  3AV0 A;  4R03 A;  1HNW E;  2M9A A;  1PDA A;  3VYX A;  3OML A;  4JYA E;  1YYW A;  1SR9 A;  5A6B A;  2DGC A;  3JTZ A;  3JAM C;  2EPN A;  2K4V A;  1YYK A;  2RSI A;  3C4T A;  2MC6 A;  2V8Q B;  4DV1 E;  2E5L E;  3UK3 C;  1J5E E;  5A6K A;  4DV5 E;  2RS6 A;  3THO B;  2NUG A;  2K7I A;  2A25 A;  2EE8 A;  2R76 A;  4LFC E;  2EM5 A;  2JXP A;  2VQE E;  2RPC A;  1XNQ E;  4R2D A;  2FGG A;  4LF8 E;  1WHQ A;  3VYY A;  3P1X A;  4JI5 E;  5T6J A;  2L8T A;  2V85 A;  2YT4 A;  5A2Q C;  2UUC E;  2KON A;  1N3G A;  4DR4 E;  4X8W A;  2YWQ A;  4R2R A;  3ADL A;  1T4N A;  2IHR 1;  2PRT A;  4LF5 E;  4RH8 A;  4X64 E;  2FV4 B;  2EPU A;  4HEI A;  4B3M E;  4WSP A;  1F2I G;  2M4I A;  2JR1 A;  2NA2 A;  2EMF A;  2EN6 A;  2M1S A;  4LFA E;  1Z1B A;  2EMI A;  4LF9 E;  1T39 A;  2HGH A;  4JI4 E;  1WRJ A;  1G2D C;  1X47 A;  4LF6 E;  5BR8 E;  3BID A;  3F6H A;  2L2M A;  3EPJ A;  1KYQ A;  2EOJ A;  4NXM E;  1EH6 A;  1X6H A;  3IWD A;  2EL6 A;  4DV0 E;  1BBG A;  5KL7 A;  4JI3 E;  1XNR E;  2I9I A;  3T1H E;  1NCS A;  4F2J C;  4R2C A;  1A1L A;  5KL3 A;  1UN6 B;  1TN9 A;  2JP9 A;  3OTO E;  4N4R B;  2EL5 A;  2EPK X;  5LMU E;  1JK1 A;  3HTX A;  2JOX A;  1SFE A;  1DI2 A;  4R2S A; 
#chains in the Genus database with same CATH homology
 2EMH A;  3EPL A;  2EN7 A;  2DRP A;  2EM2 A;  2EN8 A;  2EOM A;  2EOR A;  1MEY C;  2LO3 A;  2EPP A;  2EM8 A;  5KL6 A;  1YUJ A;  2EOY A;  2YSP A;  2JPA A;  3MHS C;  2EMB A;  2EMA A;  2EN4 A;  1TF3 A;  4M9V C;  1RMD A;  2EOF A;  1BBO A;  4F6M A;  3EPH A;  2EPX A;  2EMZ A;  3VHT B;  5KL4 A;  2EQ1 A;  2LV2 A;  2LCE A;  1YUI A;  2EOS A;  2YTJ A;  2WCC 3;  2EMK A;  2M9A A;  2EMW A;  2YTP A;  4GZN C;  2EPZ A;  2DMI A;  1BB8 A;  1JK2 A;  2DGC A;  2WBS A;  1ZAA C;  2YTI A;  2RSI A;  2EOO A;  2EMG A;  2YTO A;  1G2F C;  1X5W A;  5KL5 A;  4R2A A;  2YU5 A;  4X9J A;  2EM3 A;  3UK3 C;  1WJP A;  1B69 A;  2EML A;  2EOX A;  2D9H A;  2CT1 A;  2A25 A;  2WBT A;  2EPC A;  2YTD A;  2EE8 A;  2EOE A;  1ZU1 A;  2EM7 A;  2EOI A;  1X6E A;  2CSH A;  2EM5 A;  2EM9 A;  1DGC A;  1A1J A;  2EM6 A;  1AAY A;  4IS1 C;  2EM4 A;  2EJ4 A;  3M99 B;  2VRD A;  2EOZ A;  2RPC A;  4R2D A;  2EP3 A;  1A1F A;  2YTN A;  1X6F A;  2EL4 A;  2NAB A;  2DLQ A;  2LT7 A;  2WBU A;  2EOQ A;  4F6N A;  2ELZ A;  2CTD A;  2EQ3 A;  4R2E A;  4R2R A;  2PRT A;  4R2Q A;  2BB8 A;  1TF6 A;  2EMY A;  2EPU A;  1F2I G;  2EN3 A;  1UBD C;  2DLK A;  2E72 A;  2EMF A;  2EM0 A;  2EN6 A;  2GHF A;  2EN2 A;  2EN1 A;  1Z1B A;  1X3C A;  2EMI A;  2ENC A;  1A1I A;  2HGH A;  2ADR A;  2EMX A;  1G2D C;  1LLM C;  2GLI A;  4FK5 C;  2EPA A;  3EPJ A;  2EOJ A;  2YRH A;  2YTG A;  2YSO A;  1ZR9 A;  2ELY A;  2YRK A;  3MHH C;  5KL2 A;  2LVH A;  2MKN A;  1A1G A;  2EMC A;  1X6H A;  2MDG A;  2R1F A;  1A1K A;  2I13 A;  2EL6 A;  3EPK A;  5KL7 A;  2EQ0 A;  1P47 A;  1NCS A;  2EPR A;  2J7J A;  1A1H A;  4F2J C;  2ENH A;  1YSA C;  4R2C A;  1A1L A;  5KL3 A;  4WSG A;  1KJK A;  1UN6 B;  1TN9 A;  2JP9 A;  2YU8 A;  2YRM A;  2EOH A;  2YTE A;  2EL5 A;  2YTQ A;  2MKD A;  2YTF A;  4R2P A;  1JK1 A;  2ENA A;  4R2S A;  4IJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...