1LLMC

Crystal structure of a zif23-gcn4 chimera bound to dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPILEDKVEELLSKNYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a designed dimeric zinc finger protein bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*CP*CP*CP*AP*CP*GP*CP*GP*TP*GP*GP*G)-3'
total genus 35
structure length 87
sequence length 87
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC02
2EOOA 2EN2A 2ELYA 1ZU1A 2EN8A 4R2AA 1NCSA 4M9VC 2EMWA 2EMBA 2LCEA 2EMKA 5KL5A 1TF6A 2LO3A 2EN6A 1Z1BA 1B69A 1UBDC 2EMLA 2YU8A 2ELZA 2EN3A 2DLQA 2MKDA 2WBSA 1TF3A 4IS1C 2BB8A 2I13A 2WBUA 4F6MA 2EPAA 2GLIA 2YTFA 1ZAAC 1JK2A 1ZR9A 1LLMC 2EM2A 2DRPA 2YRMA 1YSAC 2EMYA 1AAYA 4X9JA 2EMCA 2YTIA 1WJPA 2R1FA 2YRHA 2EP3A 1YUIA 2EMHA 2EPRA 4FK5C 3M99B 2LV2A 2EOFA 4R2PA 2EL4A 2WCC3 2YTNA 2JP9A 2NABA 2DGCA 2WBTA 4R2RA 4F2JC 3MHHC 2YU5A 2ENHA 2EM8A 2PRTA 2EM5A 2EM4A 2CSHA 4R2CA 2EMFA 2MKNA 1BB8A 2E72A 4WSGA 2ADRA 2EPPA 5KL2A 2CT1A 1G2DC 1A1KA 2EORA 2EPZA 3VHTB 2EOIA 3EPKA 2J7JA 2EM0A 2EMZA 2YTQA 2EJ4A 1F2IG 2EOMA 2EE8A 3EPHA 1YUJA 1G2FC 2YTEA 1BBOA 3UK3C 2EOSA 2EMAA 1X6EA 2EM3A 2RPCA 2DMIA 4R2SA 2DLKA 1P47A 2EPUA 2YRKA 2VRDA 2YSPA 2YTPA 1KJKA 2EOYA 2EQ0A 4R2EA 3EPLA 2ENCA 2EOHA 2LVHA 1X6HA 2JPAA 2EMIA 1TN9A 5KL3A 1DGCA 5KL6A 2EQ1A 1X6FA 2EQ3A 2EL6A 3EPJA 2A25A 2EPCA 2CTDA 2EOEA 2EOQA 5KL4A 2M9AA 2EM6A 2EMXA 1JK1A 2EM9A 2EOXA 2EM7A 2EPXA 4R2QA 1A1GA 2YSOA 4GZNC 2EOJA 2LT7A 2EL5A 2ENAA 1A1HA 2EN7A 4R2DA 2EN4A 2YTDA 2HGHA 1A1IA 2D9HA 1A1JA 1MEYC 2RSIA 1X5WA 4IJDA 2EOZA 1UN6B 2YTJA 1X3CA 2EMGA 2MDGA 3MHSC 2EN1A 5KL7A 1A1FA 2GHFA 4F6NA 1RMDA 2YTOA 2YTGA 1A1LA
chains in the Genus database with same CATH superfamily
4F9BB 5A2QC 2DIXA 2ELYA 2EN8A 2N8XA 4LFAE 2WZOA 4WSPA 2EMBA 5FLXC 2FGGA 4DR6E 2LTRA 5IT9C 2EN6A 2LTSA 4RH8A 2Q8UA 3ADJA 4DR5E 2YU8A 1RC7A 3ZOQB 2L8TA 2DLQA 2MKDA 4BHCA 1HNZE 3OMLA 2EPAA 4ZYHA 2YTFA 1EH7A 2DRPA 3BIDA 1IMUA 3C4TA 4BBYA 4DMIA 1YSAC 4X9JA 2EMCA 1WJPA 2EPRA 3M99B 2LV2A 4F9CB 2L2NA 1XNRE 2WCC3 1PKPA 5AE3A 4R2RA 3MHHC 2ENHA 3FIGA 4WX9A 4JI0E 2EM5A 2L6MA 2CSHA 4R2CA 2MKNA 3LLHA 2IHR1 1T39A 4OX9E 2EPPA 5KL2A 2CT1A 1G2DC 2KONA 3J80C 5AE2A 1T4NA 1A1KA 2EPZA 2J7JA 3EPHA 2N3HA 5BR8E 1YUJA 2YTEA 4X8WA 1MGTA 4L8NA 2EMAA 1XNQE 2EM3A 1HNXE 4R2SA 2EPUA 2VRDA 4B3SE 3C6KA 2LVHA 5LMUE 1FJGE 5AASA 2JPAA 4DV1E 1UILA 5KL3A 5KL6A 2EQ1A 1X6FA 4BC7A 4LU9A 4BS9A 2M7QA 2A25A 2UXBE 3RMPA 2B9DA 1ZBQA 2EM6A 4J8ZA 1PDAA 2EMXA 3VK6A 2M4IA 1PJSA 4KZSA 1A1GA 4M2ZA 2VQFE 4DR2E 2YSOA 2LT7A 2ENAA 4X66E 3T1HE 2YTDA 3KWRA 4JI3E 2L2KB 1N33E 4WFTA 4BC9A 2RSIA 3EQ1A 1PJTA 4MLVA 2YPNA 4X62E 4NXME 4R03A 2EN1A 2JWOA 2V8QB 2L33A 3BBGA 1RMDA 3C4BA 3OTOE 4F2JC 2L3CA 2KHXA 2EN2A 1XMOE 4DR3E 1NCSA 4M9VC 1WHQA 4O43A 2HHHE 5KL5A 4TUIA 3J7Yp 2V86A 4BCAA 1UBDC 4DR1E 4JI2E 1GZ6A 5T6JA 2ELZA 2EN3A 2JR1A 3JU0A 4DR4E 4Q35B 2WBSA 1EH6A 4MLQA 2N3GA 4F6MA 1WRJA 4JI8E 2GLIA 1ZR9A 2EM2A 4JI4E 3THOB 2EMYA 2V89A 2YTIA 5DNYA 4WYQB 4LF8E 5A6AA 1YUIA 1YYWA 4B3TE 1YFHA 2YTNA 2JP9A 2DGCA 4DKKA 4JI1E 2EM8A 2PRTA 5A6BA 2EMFA 2RQLA 4LF4E 2EPOA 5IWAE 2EORA 2UXCE 1EH8A 1F2IG 3K6QA 2EOSA 1J5EE 1GTKA 1X6EA 2MC5A 2YRKA 4GKJE 2YSPA 1AH5A 2LJHA 4K0KE 4LFBE 2EOYA 2EQ0A 2F8BA 2ENCA 1TN9A 2JXPA 4JI6E 1I94E 2EL6A 4LFCE 3C6MA 2CTDA 5A6BD 1X48A 3ECRA 1O0WA 2B7VA 2EOXA 4KHPE 4N4RB 1YYOA 4NZVA 3THNA 5CFFE 2YT4A 1A1HA 2V87A 4B3ME 2L2MA 4R2DA 4JI5E 2HC5A 2HGHA 2EZ6A 1A1IA 1N34E 1SR9A 1X5WA 2DB2A 1DI2A 2EMGA 3BF2A 3MHSC 4X65E 2ODRC 5TSEA 5KL7A 2BBGA 3VYYA 2YTGA 2JYAA 2LJUA 2EPMX 2EOOA 3IWBA 3DJWA 1ZU1A 4RHBB 4R2AA 2UUAE 5LMNE 3F6HA 2LCEA 2M1SA 1HR0E 3P1XA 1Z1BA 1B69A 2RS7A 2UXDE 3HQ1A 5AC5A 1TF3A 2I13A 4IS1C 1EKZA 5AC4A 4TUGA 3ADLA 1ZAAC 1LLMC 1N3GA 4Q28A 2YRMA 4I8OA 2E5LE 4GKKE 1AAYA 2JOBA 2LRSA 2YRHA 1BBGA 4FK5C 2LE2A 2HJJA 1IQOA 1WHNA 4DUYE 2LUQA 4HTGA 2EM4A 1BB8A 2L3JA 3HPZA 2VQEE 4LF5E 4WSGA 3HPSA 3QG5C 4M30A 2K4VA 1FKAE 4LTYA 5A69A 3IWCA 3VHTB 4GEQB 2YTQA 4O5GA 2EJ4A 2EE8A 4YHHE 2JY9A 4WPYA 1BBOA 1PJQA 3UK3C 1IBLE 2DMIA 2EPNA 2DLKA 4P78A 1P47A 2YTPA 1KJKA 3HXLA 4DV4E 4R2EA 3EPLA 2NUGA 1GQEA 4JYAE 1X6HA 3F6GA 2EPLX 2EMIA 1IQSA 1RQ0A 3EPJA 2L92A 2UUCE 1X49A 4B3RE 5KL4A 2V85A 2V88A 1WXRA 2EM9A 3JAMC 2EM7A 3J81C 5AE1A 2RTXA 4R2QA 4R8OA 4X64E 2UUBE 4GZNC 1NEIA 2ZM6E 5LL6R 2EN7A 2EN4A 4NHRA 1N36E 1DQ3A 2D9HA 2H36X 1A1JA 4LF9E 1MEYC 5F3WA 4F54A 1UN6B 2YTJA 1IBKE 2I9IA 1X3CA 2MDGA 2KOUA 3T1YE 1A1FA 2DMYA 1L4SA 2F4VE 4F6NA 2RS6A 3AUZA 4DV2E 3ADGA 4DR7E 2B3TB 4LF7E 2GPIA 2EMWA 4KWYA 4L5NC 3IWDA 4WXCA 2EMKA 4ZYGA 3JTZA 1YZ9A 1TF6A 2LO3A 3TQMA 2JOXA 2EMLA 2E1MA 1ZBTA 5A6JA 2DSYA 2BB8A 2WBUA 4F9AB 2V83A 3J7AG 1XMQE 2UU9E 1JK2A 4DV6E 2LMZA 1KYQA 3BGHA 2R1FA 2JVAA 2EP3A 1T4LB 2EMHA 4R2PA 1STUA 2EOFA 4ZYEA 2EL4A 2NABA 4LF6E 3LMLA 2WBTA 4DV3E 3HTXA 2YU5A 2RSMA 4HEIA 2E72A 4DUZE 1QU6A 2MC6A 4M0VA 1J26A 2ADRA 5A6KA 2CPNA 3DF6A 2YWQA 2EWLA 2EOIA 4P7DA 2EPKX 2EM0A 2EMZA 3EPKA 2NUFA 2EOMA 2NUEA 3AV0A 1G2FC 4WXDA 1YPNA 5ADZA 4BHBA 2RPCA 4DV0E 2ODRD 1YYKA 4NXNE 3VYXA 2K7IA 2EOHA 1IBME 1X47A 1DGCA 2LUPB 4BMJA 2EQ3A 4YY3E 5LLQA 3KZZA 2EPCA 2EOEA 2EOQA 1QNTA 2M9AA 2NA2A 1HNWE 1JK1A 2FTXB 1N32E 4O24A 1UHZA 2EPXA 2FV4B 4JI7E 4DV5E 2EOJA 2MDRA 2EL5A 4OOGC 1SFEA 2LBSB 2VE7C 3MSWA 2R76A 4DV7E 5IXMB 3L00A 1T4OA 4JV5E 2VF1A 4IJDA 2EOZA 5IV8B 4AQYE 2G7HA 2B7TA 1T38A 3ADIA 3KZYA 2YZTA 2GHFA 4ZYDA 2YTOA 3H09A 1A1LA 4O4KA
chains in the Genus database with same CATH topology
2EOOA 2EN2A 2ELYA 1ZU1A 2EN8A 4R2AA 1NCSA 4M9VC 2EMWA 2EMBA 2LCEA 2EMKA 5KL5A 1TF6A 2LO3A 2EN6A 1Z1BA 1B69A 1UBDC 2EMLA 2YU8A 2ELZA 2EN3A 2DLQA 2MKDA 2WBSA 1TF3A 4IS1C 2BB8A 2I13A 2WBUA 4F6MA 2EPAA 2GLIA 2YTFA 1ZAAC 1JK2A 1ZR9A 1LLMC 2EM2A 2DRPA 2YRMA 1YSAC 2EMYA 1AAYA 4X9JA 2EMCA 2YTIA 1WJPA 2R1FA 2YRHA 2EP3A 1YUIA 2EMHA 2EPRA 4FK5C 3M99B 2LV2A 2EOFA 4R2PA 2EL4A 2WCC3 2YTNA 2JP9A 2NABA 2DGCA 2WBTA 4R2RA 4F2JC 3MHHC 2YU5A 2ENHA 2EM8A 2PRTA 2EM5A 2EM4A 2CSHA 4R2CA 2EMFA 2MKNA 1BB8A 2E72A 4WSGA 2ADRA 2EPPA 5KL2A 2CT1A 1G2DC 1A1KA 2EORA 2EPZA 3VHTB 2EOIA 3EPKA 2J7JA 2EM0A 2EMZA 2YTQA 2EJ4A 1F2IG 2EOMA 2EE8A 3EPHA 1YUJA 1G2FC 2YTEA 1BBOA 3UK3C 2EOSA 2EMAA 1X6EA 2EM3A 2RPCA 2DMIA 4R2SA 2DLKA 1P47A 2EPUA 2YRKA 2VRDA 2YSPA 2YTPA 1KJKA 2EOYA 2EQ0A 4R2EA 3EPLA 2ENCA 2EOHA 2LVHA 1X6HA 2JPAA 2EMIA 1TN9A 5KL3A 1DGCA 5KL6A 2EQ1A 1X6FA 2EQ3A 2EL6A 3EPJA 2A25A 2EPCA 2CTDA 2EOEA 2EOQA 5KL4A 2M9AA 2EM6A 2EMXA 1JK1A 2EM9A 2EOXA 2EM7A 2EPXA 4R2QA 1A1GA 2YSOA 4GZNC 2EOJA 2LT7A 2EL5A 2ENAA 1A1HA 2EN7A 4R2DA 2EN4A 2YTDA 2HGHA 1A1IA 2D9HA 1A1JA 1MEYC 2RSIA 1X5WA 4IJDA 2EOZA 1UN6B 2YTJA 1X3CA 2EMGA 2MDGA 3MHSC 2EN1A 5KL7A 1A1FA 2GHFA 4F6NA 1RMDA 2YTOA 2YTGA 1A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOO A;  2EN2 A;  2ELY A;  1ZU1 A;  2EN8 A;  4R2A A;  1NCS A;  4M9V C;  2EMW A;  2EMB A;  2LCE A;  2EMK A;  5KL5 A;  1TF6 A;  2LO3 A;  2EN6 A;  1Z1B A;  1B69 A;  1UBD C;  2EML A;  2YU8 A;  2ELZ A;  2EN3 A;  2DLQ A;  2MKD A;  2WBS A;  1TF3 A;  4IS1 C;  2BB8 A;  2I13 A;  2WBU A;  4F6M A;  2EPA A;  2GLI A;  2YTF A;  1ZAA C;  1JK2 A;  1ZR9 A;  1LLM C;  2EM2 A;  2DRP A;  2YRM A;  1YSA C;  2EMY A;  1AAY A;  4X9J A;  2EMC A;  2YTI A;  1WJP A;  2R1F A;  2YRH A;  2EP3 A;  1YUI A;  2EMH A;  2EPR A;  4FK5 C;  3M99 B;  2LV2 A;  2EOF A;  4R2P A;  2EL4 A;  2WCC 3;  2YTN A;  2JP9 A;  2NAB A;  2DGC A;  2WBT A;  4R2R A;  4F2J C;  3MHH C;  2YU5 A;  2ENH A;  2EM8 A;  2PRT A;  2EM5 A;  2EM4 A;  2CSH A;  4R2C A;  2EMF A;  2MKN A;  1BB8 A;  2E72 A;  4WSG A;  2ADR A;  2EPP A;  5KL2 A;  2CT1 A;  1G2D C;  1A1K A;  2EOR A;  2EPZ A;  3VHT B;  2EOI A;  3EPK A;  2J7J A;  2EM0 A;  2EMZ A;  2YTQ A;  2EJ4 A;  1F2I G;  2EOM A;  2EE8 A;  3EPH A;  1YUJ A;  1G2F C;  2YTE A;  1BBO A;  3UK3 C;  2EOS A;  2EMA A;  1X6E A;  2EM3 A;  2RPC A;  2DMI A;  4R2S A;  2DLK A;  1P47 A;  2EPU A;  2YRK A;  2VRD A;  2YSP A;  2YTP A;  1KJK A;  2EOY A;  2EQ0 A;  4R2E A;  3EPL A;  2ENC A;  2EOH A;  2LVH A;  1X6H A;  2JPA A;  2EMI A;  1TN9 A;  5KL3 A;  1DGC A;  5KL6 A;  2EQ1 A;  1X6F A;  2EQ3 A;  2EL6 A;  3EPJ A;  2A25 A;  2EPC A;  2CTD A;  2EOE A;  2EOQ A;  5KL4 A;  2M9A A;  2EM6 A;  2EMX A;  1JK1 A;  2EM9 A;  2EOX A;  2EM7 A;  2EPX A;  4R2Q A;  1A1G A;  2YSO A;  4GZN C;  2EOJ A;  2LT7 A;  2EL5 A;  2ENA A;  1A1H A;  2EN7 A;  4R2D A;  2EN4 A;  2YTD A;  2HGH A;  1A1I A;  2D9H A;  1A1J A;  1MEY C;  2RSI A;  1X5W A;  4IJD A;  2EOZ A;  1UN6 B;  2YTJ A;  1X3C A;  2EMG A;  2MDG A;  3MHS C;  2EN1 A;  5KL7 A;  1A1F A;  2GHF A;  4F6N A;  1RMD A;  2YTO A;  2YTG A;  1A1L A; 
#chains in the Genus database with same CATH topology
 4F9B B;  5A2Q C;  2DIX A;  2ELY A;  2EN8 A;  2N8X A;  4LFA E;  2WZO A;  4WSP A;  2EMB A;  5FLX C;  2FGG A;  4DR6 E;  2LTR A;  5IT9 C;  2EN6 A;  2LTS A;  4RH8 A;  2Q8U A;  3ADJ A;  4DR5 E;  2YU8 A;  1RC7 A;  3ZOQ B;  2L8T A;  2DLQ A;  2MKD A;  4BHC A;  1HNZ E;  3OML A;  2EPA A;  4ZYH A;  2YTF A;  1EH7 A;  2DRP A;  3BID A;  1IMU A;  3C4T A;  4BBY A;  4DMI A;  1YSA C;  4X9J A;  2EMC A;  1WJP A;  2EPR A;  3M99 B;  2LV2 A;  4F9C B;  2L2N A;  1XNR E;  2WCC 3;  1PKP A;  5AE3 A;  4R2R A;  3MHH C;  2ENH A;  3FIG A;  4WX9 A;  4JI0 E;  2EM5 A;  2L6M A;  2CSH A;  4R2C A;  2MKN A;  3LLH A;  2IHR 1;  1T39 A;  4OX9 E;  2EPP A;  5KL2 A;  2CT1 A;  1G2D C;  2KON A;  3J80 C;  5AE2 A;  1T4N A;  1A1K A;  2EPZ A;  2J7J A;  3EPH A;  2N3H A;  5BR8 E;  1YUJ A;  2YTE A;  4X8W A;  1MGT A;  4L8N A;  2EMA A;  1XNQ E;  2EM3 A;  1HNX E;  4R2S A;  2EPU A;  2VRD A;  4B3S E;  3C6K A;  2LVH A;  5LMU E;  1FJG E;  5AAS A;  2JPA A;  4DV1 E;  1UIL A;  5KL3 A;  5KL6 A;  2EQ1 A;  1X6F A;  4BC7 A;  4LU9 A;  4BS9 A;  2M7Q A;  2A25 A;  2UXB E;  3RMP A;  2B9D A;  1ZBQ A;  2EM6 A;  4J8Z A;  1PDA A;  2EMX A;  3VK6 A;  2M4I A;  1PJS A;  4KZS A;  1A1G A;  4M2Z A;  2VQF E;  4DR2 E;  2YSO A;  2LT7 A;  2ENA A;  4X66 E;  3T1H E;  2YTD A;  3KWR A;  4JI3 E;  2L2K B;  1N33 E;  4WFT A;  4BC9 A;  2RSI A;  3EQ1 A;  1PJT A;  4MLV A;  2YPN A;  4X62 E;  4NXM E;  4R03 A;  2EN1 A;  2JWO A;  2V8Q B;  2L33 A;  3BBG A;  1RMD A;  3C4B A;  3OTO E;  4F2J C;  2L3C A;  2KHX A;  2EN2 A;  1XMO E;  4DR3 E;  1NCS A;  4M9V C;  1WHQ A;  4O43 A;  2HHH E;  5KL5 A;  4TUI A;  3J7Y p;  2V86 A;  4BCA A;  1UBD C;  4DR1 E;  4JI2 E;  1GZ6 A;  5T6J A;  2ELZ A;  2EN3 A;  2JR1 A;  3JU0 A;  4DR4 E;  4Q35 B;  2WBS A;  1EH6 A;  4MLQ A;  2N3G A;  4F6M A;  1WRJ A;  4JI8 E;  2GLI A;  1ZR9 A;  2EM2 A;  4JI4 E;  3THO B;  2EMY A;  2V89 A;  2YTI A;  5DNY A;  4WYQ B;  4LF8 E;  5A6A A;  1YUI A;  1YYW A;  4B3T E;  1YFH A;  2YTN A;  2JP9 A;  2DGC A;  4DKK A;  4JI1 E;  2EM8 A;  2PRT A;  5A6B A;  2EMF A;  2RQL A;  4LF4 E;  2EPO A;  5IWA E;  2EOR A;  2UXC E;  1EH8 A;  1F2I G;  3K6Q A;  2EOS A;  1J5E E;  1GTK A;  1X6E A;  2MC5 A;  2YRK A;  4GKJ E;  2YSP A;  1AH5 A;  2LJH A;  4K0K E;  4LFB E;  2EOY A;  2EQ0 A;  2F8B A;  2ENC A;  1TN9 A;  2JXP A;  4JI6 E;  1I94 E;  2EL6 A;  4LFC E;  3C6M A;  2CTD A;  5A6B D;  1X48 A;  3ECR A;  1O0W A;  2B7V A;  2EOX A;  4KHP E;  4N4R B;  1YYO A;  4NZV A;  3THN A;  5CFF E;  2YT4 A;  1A1H A;  2V87 A;  4B3M E;  2L2M A;  4R2D A;  4JI5 E;  2HC5 A;  2HGH A;  2EZ6 A;  1A1I A;  1N34 E;  1SR9 A;  1X5W A;  2DB2 A;  1DI2 A;  2EMG A;  3BF2 A;  3MHS C;  4X65 E;  2ODR C;  5TSE A;  5KL7 A;  2BBG A;  3VYY A;  2YTG A;  2JYA A;  2LJU A;  2EPM X;  2EOO A;  3IWB A;  3DJW A;  1ZU1 A;  4RHB B;  4R2A A;  2UUA E;  5LMN E;  3F6H A;  2LCE A;  2M1S A;  1HR0 E;  3P1X A;  1Z1B A;  1B69 A;  2RS7 A;  2UXD E;  3HQ1 A;  5AC5 A;  1TF3 A;  2I13 A;  4IS1 C;  1EKZ A;  5AC4 A;  4TUG A;  3ADL A;  1ZAA C;  1LLM C;  1N3G A;  4Q28 A;  2YRM A;  4I8O A;  2E5L E;  4GKK E;  1AAY A;  2JOB A;  2LRS A;  2YRH A;  1BBG A;  4FK5 C;  2LE2 A;  2HJJ A;  1IQO A;  1WHN A;  4DUY E;  2LUQ A;  4HTG A;  2EM4 A;  1BB8 A;  2L3J A;  3HPZ A;  2VQE E;  4LF5 E;  4WSG A;  3HPS A;  3QG5 C;  4M30 A;  2K4V A;  1FKA E;  4LTY A;  5A69 A;  3IWC A;  3VHT B;  4GEQ B;  2YTQ A;  4O5G A;  2EJ4 A;  2EE8 A;  4YHH E;  2JY9 A;  4WPY A;  1BBO A;  1PJQ A;  3UK3 C;  1IBL E;  2DMI A;  2EPN A;  2DLK A;  4P78 A;  1P47 A;  2YTP A;  1KJK A;  3HXL A;  4DV4 E;  4R2E A;  3EPL A;  2NUG A;  1GQE A;  4JYA E;  1X6H A;  3F6G A;  2EPL X;  2EMI A;  1IQS A;  1RQ0 A;  3EPJ A;  2L92 A;  2UUC E;  1X49 A;  4B3R E;  5KL4 A;  2V85 A;  2V88 A;  1WXR A;  2EM9 A;  3JAM C;  2EM7 A;  3J81 C;  5AE1 A;  2RTX A;  4R2Q A;  4R8O A;  4X64 E;  2UUB E;  4GZN C;  1NEI A;  2ZM6 E;  5LL6 R;  2EN7 A;  2EN4 A;  4NHR A;  1N36 E;  1DQ3 A;  2D9H A;  2H36 X;  1A1J A;  4LF9 E;  1MEY C;  5F3W A;  4F54 A;  1UN6 B;  2YTJ A;  1IBK E;  2I9I A;  1X3C A;  2MDG A;  2KOU A;  3T1Y E;  1A1F A;  2DMY A;  1L4S A;  2F4V E;  4F6N A;  2RS6 A;  3AUZ A;  4DV2 E;  3ADG A;  4DR7 E;  2B3T B;  4LF7 E;  2GPI A;  2EMW A;  4KWY A;  4L5N C;  3IWD A;  4WXC A;  2EMK A;  4ZYG A;  3JTZ A;  1YZ9 A;  1TF6 A;  2LO3 A;  3TQM A;  2JOX A;  2EML A;  2E1M A;  1ZBT A;  5A6J A;  2DSY A;  2BB8 A;  2WBU A;  4F9A B;  2V83 A;  3J7A G;  1XMQ E;  2UU9 E;  1JK2 A;  4DV6 E;  2LMZ A;  1KYQ A;  3BGH A;  2R1F A;  2JVA A;  2EP3 A;  1T4L B;  2EMH A;  4R2P A;  1STU A;  2EOF A;  4ZYE A;  2EL4 A;  2NAB A;  4LF6 E;  3LML A;  2WBT A;  4DV3 E;  3HTX A;  2YU5 A;  2RSM A;  4HEI A;  2E72 A;  4DUZ E;  1QU6 A;  2MC6 A;  4M0V A;  1J26 A;  2ADR A;  5A6K A;  2CPN A;  3DF6 A;  2YWQ A;  2EWL A;  2EOI A;  4P7D A;  2EPK X;  2EM0 A;  2EMZ A;  3EPK A;  2NUF A;  2EOM A;  2NUE A;  3AV0 A;  1G2F C;  4WXD A;  1YPN A;  5ADZ A;  4BHB A;  2RPC A;  4DV0 E;  2ODR D;  1YYK A;  4NXN E;  3VYX A;  2K7I A;  2EOH A;  1IBM E;  1X47 A;  1DGC A;  2LUP B;  4BMJ A;  2EQ3 A;  4YY3 E;  5LLQ A;  3KZZ A;  2EPC A;  2EOE A;  2EOQ A;  1QNT A;  2M9A A;  2NA2 A;  1HNW E;  1JK1 A;  2FTX B;  1N32 E;  4O24 A;  1UHZ A;  2EPX A;  2FV4 B;  4JI7 E;  4DV5 E;  2EOJ A;  2MDR A;  2EL5 A;  4OOG C;  1SFE A;  2LBS B;  2VE7 C;  3MSW A;  2R76 A;  4DV7 E;  5IXM B;  3L00 A;  1T4O A;  4JV5 E;  2VF1 A;  4IJD A;  2EOZ A;  5IV8 B;  4AQY E;  2G7H A;  2B7T A;  1T38 A;  3ADI A;  3KZY A;  2YZT A;  2GHF A;  4ZYD A;  2YTO A;  3H09 A;  1A1L A;  4O4K A; 
#chains in the Genus database with same CATH homology
 2EOO A;  2EN2 A;  2ELY A;  1ZU1 A;  2EN8 A;  4R2A A;  1NCS A;  4M9V C;  2EMW A;  2EMB A;  2LCE A;  2EMK A;  5KL5 A;  1TF6 A;  2LO3 A;  2EN6 A;  1Z1B A;  1B69 A;  1UBD C;  2EML A;  2YU8 A;  2ELZ A;  2EN3 A;  2DLQ A;  2MKD A;  2WBS A;  1TF3 A;  4IS1 C;  2BB8 A;  2I13 A;  2WBU A;  4F6M A;  2EPA A;  2GLI A;  2YTF A;  1ZAA C;  1JK2 A;  1ZR9 A;  1LLM C;  2EM2 A;  2DRP A;  2YRM A;  1YSA C;  2EMY A;  1AAY A;  4X9J A;  2EMC A;  2YTI A;  1WJP A;  2R1F A;  2YRH A;  2EP3 A;  1YUI A;  2EMH A;  2EPR A;  4FK5 C;  3M99 B;  2LV2 A;  2EOF A;  4R2P A;  2EL4 A;  2WCC 3;  2YTN A;  2JP9 A;  2NAB A;  2DGC A;  2WBT A;  4R2R A;  4F2J C;  3MHH C;  2YU5 A;  2ENH A;  2EM8 A;  2PRT A;  2EM5 A;  2EM4 A;  2CSH A;  4R2C A;  2EMF A;  2MKN A;  1BB8 A;  2E72 A;  4WSG A;  2ADR A;  2EPP A;  5KL2 A;  2CT1 A;  1G2D C;  1A1K A;  2EOR A;  2EPZ A;  3VHT B;  2EOI A;  3EPK A;  2J7J A;  2EM0 A;  2EMZ A;  2YTQ A;  2EJ4 A;  1F2I G;  2EOM A;  2EE8 A;  3EPH A;  1YUJ A;  1G2F C;  2YTE A;  1BBO A;  3UK3 C;  2EOS A;  2EMA A;  1X6E A;  2EM3 A;  2RPC A;  2DMI A;  4R2S A;  2DLK A;  1P47 A;  2EPU A;  2YRK A;  2VRD A;  2YSP A;  2YTP A;  1KJK A;  2EOY A;  2EQ0 A;  4R2E A;  3EPL A;  2ENC A;  2EOH A;  2LVH A;  1X6H A;  2JPA A;  2EMI A;  1TN9 A;  5KL3 A;  1DGC A;  5KL6 A;  2EQ1 A;  1X6F A;  2EQ3 A;  2EL6 A;  3EPJ A;  2A25 A;  2EPC A;  2CTD A;  2EOE A;  2EOQ A;  5KL4 A;  2M9A A;  2EM6 A;  2EMX A;  1JK1 A;  2EM9 A;  2EOX A;  2EM7 A;  2EPX A;  4R2Q A;  1A1G A;  2YSO A;  4GZN C;  2EOJ A;  2LT7 A;  2EL5 A;  2ENA A;  1A1H A;  2EN7 A;  4R2D A;  2EN4 A;  2YTD A;  2HGH A;  1A1I A;  2D9H A;  1A1J A;  1MEY C;  2RSI A;  1X5W A;  4IJD A;  2EOZ A;  1UN6 B;  2YTJ A;  1X3C A;  2EMG A;  2MDG A;  3MHS C;  2EN1 A;  5KL7 A;  1A1F A;  2GHF A;  4F6N A;  1RMD A;  2YTO A;  2YTG A;  1A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...