1LLMC

Crystal structure of a zif23-gcn4 chimera bound to dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPILEDKVEELLSKNYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*TP*CP*CP*CP*AP*CP*GP*CP*GP*TP*GP*GP*G)-3'
publication title Structure of a designed dimeric zinc finger protein bound to DNA.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 87
sequence length 87
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1llmC02
2CSHA 2EMZA 1G2DC 1NCSA 2A25A 2YTEA 2EN4A 2RPCA 2YTJA 2YRKA 3EPKA 1LLMC 1A1JA 1A1FA 4R2EA 3UK3C 2EOHA 2EJ4A 2EOFA 3VHTB 2GLIA 2EMHA 2EM5A 1KJKA 2NABA 2EN8A 2EPPA 2MDGA 2EN6A 2YTOA 5KL3A 1AAYA 5KL7A 1DGCA 2YTQA 4R2QA 1P47A 2WBSA 2EMXA 1TN9A 2EOSA 1JK1A 4F2JC 2EPXA 2PRTA 2EMWA 1YUIA 2EMYA 1UN6B 2EOIA 1JK2A 2YU5A 1X6HA 1RMDA 4R2DA 2YTIA 3MHHC 1G2FC 2YRMA 1WJPA 2EQ0A 2MKDA 2MKNA 2EM7A 1Z1BA 2ELYA 4GZNC 1A1KA 1ZAAC 2DGCA 1BB8A 2I13A 1X6EA 2LO3A 4R2SA 2R1FA 1TF6A 1A1HA 2YTGA 2EE8A 2EM2A 4F6NA 2LCEA 5KL4A 2D9HA 2EMFA 1ZR9A 2M9AA 2J7JA 2WCC3 4IS1C 1A1IA 2CT1A 1YSAC 2E72A 2EMLA 1UBDC 2EQ3A 1B69A 2EOOA 4WSGA 2ENHA 2EOQA 2EPAA 2EOEA 2ADRA 4F6MA 2WBTA 2EN2A 2YSPA 2DLQA 2RSIA 1X6FA 2EPZA 5KL6A 4IJDA 2WBUA 2JP9A 2EL4A 2EM8A 2YTNA 1MEYC 2EM0A 2VRDA 2GHFA 1X5WA 1A1LA 1ZU1A 5KL5A 1A1GA 1F2IG 2BB8A 2EM9A 2EN1A 2LT7A 1YUJA 2EM3A 2ENAA 2EOMA 2EMIA 2EMCA 2EORA 2LV2A 3M99B 3MHSC 2CTDA 2YSOA 1BBOA 2JPAA 2EQ1A 2YTPA 2EM4A 2HGHA 2EOZA 2DLKA 2EMGA 1TF3A 2EM6A 2DRPA 2EOJA 2EPUA 4X9JA 2YTDA 3EPLA 2EN3A 4R2RA 2EL6A 2EPRA 2LVHA 2EOXA 2YU8A 2EPCA 4R2PA 4FK5C 3EPHA 2ENCA 2ELZA 2EL5A 2EP3A 2EN7A 5KL2A 2YRHA 4M9VC 2DMIA 4R2CA 2YTFA 1X3CA 3EPJA 2EMBA 2EMAA 2EMKA 4R2AA 2EOYA
chains in the Genus database with same CATH superfamily
2N3HA 1HR0E 2HC5A 4R8OA 1NCSA 3JU0A 4O4KA 1FJGE 2YRKA 3EPKA 4BCAA 4P7DA 4JI5E 4JYAE 4R2EA 2RQLA 4AQYE 5A6BD 2EJ4A 2MC5A 2FTXB 4DR4E 4X8WA 3VYYA 2EN6A 1PJSA 2VF1A 4TUIA 4R2QA 2EMXA 2EOSA 1IBME 1T38A 3MSWA 3K6QA 2PRTA 4WPYA 1JK2A 2E5LE 4R2DA 2EPMX 1STUA 1N36E 2JXPA 1ZBQA 2MKDA 4BHBA 2K4VA 5AC4A 1GZ6A 1Z1BA 4B3ME 1MGTA 2B7VA 2UU9E 1XMOE 4GEQB 2LJUA 1BB8A 2LUPB 4R2SA 2G7HA 2R1FA 2UUBE 2JWOA 3JTZA 2RS7A 2HJJA 5FLXC 3DF6A 2D9HA 1UHZA 2LMZA 4JI2E 4YY3E 2EMFA 1PJTA 2UUCE 2M9AA 4ZYHA 2L3JA 5AE1A 2WCC3 1A1IA 2JVAA 1YSAC 3HXLA 4F9CB 2YT4A 2IHR1 4WX9A 4WSGA 1WHNA 2L2MA 4JI3E 1YFHA 2EN2A 2RSIA 2EWLA 2JOXA 2V8QB 2EL4A 2H36X 3C6MA 2EPNA 2L2NA 2GHFA 1ZU1A 5KL5A 3FIGA 5A2QC 2LT7A 2EM3A 1UILA 2GPIA 1EH6A 2EMCA 2LV2A 3J80C 3MHSC 1WHQA 4B3RE 2JPAA 1BBOA 1I94E 4LFAE 3HTXA 2I9IA 4DR5E 2B9DA 4WXCA 1TF3A 2V85A 5ADZA 3EQ1A 2YTDA 2EN3A 4R2RA 1T39A 3EPHA 3VYXA 2DIXA 1N33E 1YYWA 4NXME 4JI6E 1HNXE 2JR1A 2L3CA 2F8BA 2YTFA 4ZYEA 2EMKA 2UXBE 1DQ3A 1X48A 1EH8A 2CSHA 4JV5E 2YTEA 4F9BB 2EN4A 4B3TE 2LBSB 2EZ6A 2MDRA 1LLMC 1WRJA 1A1JA 4OX9E 2BBGA 4O5GA 3VHTB 2EM5A 2LTRA 1QNTA 1N32E 2MDGA 2E1MA 2YTOA 5KL3A 3IWBA 4X62E 1AAYA 2VQFE 5F3WA 2YTQA 2WBSA 2EPKX 4N4RB 1YUIA 2JYAA 1UN6B 1ZBTA 4J8ZA 4LF9E 2YTIA 2V87A 3ZOQB 4DV2E 2LUQA 1IBKE 1G2FC 2YRMA 3KWRA 2EQ0A 2MKNA 4GZNC 1YPNA 4DV7E 2DSYA 2ZM6E 2I13A 2V88A 2LO3A 4B3SE 1XNRE 2YTGA 2EE8A 4F6NA 3BIDA 1ZR9A 4ZYGA 2M4IA 2RSMA 2J7JA 2ODRC 1X49A 2FGGA 2R76A 2E72A 1BBGA 2VE7C 2UUAE 2YWQA 2EQ3A 4F54A 1B69A 4GKJE 2EOEA 2UXCE 4JI4E 4L8NA 4BS9A 1X6FA 4I8OA 1SR9A 1IQSA 5KL6A 4F9AB 4IJDA 2L8TA 2EM8A 2YTNA 1MEYC 4Q28A 5T6JA 4O24A 2VRDA 2RS6A 1X5WA 3TQMA 1GQEA 3J7AG 1WXRA 2EN1A 2ENAA 3IWCA 2EOMA 4WSPA 4LF4E 2EMIA 5LMUE 2EORA 4Q35B 2YSOA 4LF7E 1FKAE 3RMPA 2KOUA 2EM4A 3C4BA 2EOJA 1N3GA 4X65E 4OOGC 3EPLA 1GTKA 3JAMC 2EL6A 5IT9C 4M30A 2EPCA 4JI1E 2ENCA 2ELZA 2EP3A 2EN7A 5KL2A 4M9VC 4BMJA 2DMIA 1SFEA 2LE2A 2NUFA 2EMBA 2B7TA 4JI0E 4R2AA 5AE3A 3AUZA 4DV6E 4P78A 2EMZA 1XMQE 1G2DC 2A25A 1HNZE 1N34E 1KYQA 1X47A 2YTJA 3OMLA 4DV1E 4DR3E 1A1FA 1L4SA 2JOBA 1KJKA 2N8XA 2NABA 2EPPA 5KL7A 1IQOA 2V83A 1P47A 3J7Yp 3BF2A 2DB2A 4MLVA 2EPXA 4F2JC 2YU5A 5LMNE 4LF5E 1X6HA 3LLHA 4WFTA 3F6HA 2F4VE 3F6GA 2EM7A 1RC7A 2ELYA 4X66E 5A6KA 3ECRA 5LLQA 1ZAAC 4NZVA 2DMYA 3BBGA 1T4LB 5AC5A 2L2KB 3AV0A 3ADIA 1A1HA 2EM2A 2B3TB 2MC6A 3ADLA 2CT1A 3THNA 3IWDA 5AE2A 4BBYA 4HTGA 1T4OA 2EOOA 2NA2A 2ENHA 2FV4B 3C4TA 2EPAA 2ADRA 3T1YE 3P1XA 2LTSA 2WBTA 4KHPE 2YSPA 2DLQA 1EH7A 4ZYDA 2CPNA 2JP9A 2EM0A 4K0KE 1A1LA 4DV0E 1F2IG 5IWAE 2EM9A 1YUJA 4R03A 5TSEA 1O0WA 2K7IA 2LRSA 2EQ1A 2YTPA 1YYKA 4DUZE 3DJWA 1QU6A 2EMGA 2ODRD 2DRPA 2YZTA 2EPUA 4X9JA 4KZSA 4DR6E 3OTOE 2LVHA 4NHRA 2JY9A 4FK5C 4O43A 2EL5A 4JI8E 5A69A 5A6JA 1IMUA 5IV8B 1EKZA 4R2CA 1RQ0A 1X3CA 2HHHE 2EMAA 4M2ZA 4X64E 1NEIA 5IXMB 2RPCA 3ADGA 3UK3C 1J5EE 3KZYA 5A6BA 2EOHA 2EOFA 3HPSA 2GLIA 3LMLA 2EMHA 2LJHA 4DMIA 2EN8A 1DI2A 5AASA 4BC9A 1DGCA 4HEIA 4DR1E 1TN9A 1JK1A 2L92A 2NUEA 2EMWA 1IBLE 2EMYA 2M7QA 2EOIA 4LU9A 1RMDA 3THOB 3MHHC 1WJPA 3J81C 2V89A 3HQ1A 2NUGA 4DUYE 2Q8UA 4DKKA 2WZOA 2L33A 1PKPA 5A6AA 1A1KA 2DGCA 4L5NC 1X6EA 1TF6A 4DV5E 4TUGA 1YYOA 2LCEA 5KL4A 4M0VA 2UXDE 3KZZA 4IS1C 4BHCA 4DR2E 4DV4E 2YPNA 2EMLA 1UBDC 3L00A 2RTXA 2L6MA 2EOQA 4LF6E 4F6MA 2KONA 4RH8A 4JI7E 2N3GA 2EPZA 4YHHE 2WBUA 4LTYA 5CFFE 4KWYA 5LL6R 1T4NA 4DR7E 3C6KA 1A1GA 3BGHA 4NXNE 2BB8A 4BC7A 4RHBB 4MLQA 2M1SA 3QG5C 3M99B 2CTDA 3VK6A 5DNYA 4LFCE 2KHXA 2EPLX 2HGHA 4LF8E 2EOZA 2DLKA 4WXDA 1AH5A 2EM6A 3T1HE 1YZ9A 4WYQB 5BR8E 2VQEE 2YU8A 2EPRA 4R2PA 2EOXA 2V86A 1PJQA 4GKKE 1PDAA 2EPOA 2YRHA 3ADJA 4DV3E 3H09A 1J26A 4LFBE 3EPJA 1XNQE 1HNWE 3HPZA 2EOYA
chains in the Genus database with same CATH topology
2CSHA 2EMZA 1G2DC 1NCSA 2A25A 2YTEA 2EN4A 2RPCA 2YTJA 2YRKA 3EPKA 1LLMC 1A1JA 1A1FA 4R2EA 3UK3C 2EOHA 2EJ4A 2EOFA 3VHTB 2GLIA 2EMHA 2EM5A 1KJKA 2NABA 2EN8A 2EPPA 2MDGA 2EN6A 2YTOA 5KL3A 1AAYA 5KL7A 1DGCA 2YTQA 4R2QA 1P47A 2WBSA 2EMXA 1TN9A 2EOSA 1JK1A 4F2JC 2EPXA 2PRTA 2EMWA 1YUIA 2EMYA 1UN6B 2EOIA 1JK2A 2YU5A 1X6HA 1RMDA 4R2DA 2YTIA 3MHHC 1G2FC 2YRMA 1WJPA 2EQ0A 2MKDA 2MKNA 2EM7A 1Z1BA 2ELYA 4GZNC 1A1KA 1ZAAC 2DGCA 1BB8A 2I13A 1X6EA 2LO3A 4R2SA 2R1FA 1TF6A 1A1HA 2YTGA 2EE8A 2EM2A 4F6NA 2LCEA 5KL4A 2D9HA 2EMFA 1ZR9A 2M9AA 2J7JA 2WCC3 4IS1C 1A1IA 2CT1A 1YSAC 2E72A 2EMLA 1UBDC 2EQ3A 1B69A 2EOOA 4WSGA 2ENHA 2EOQA 2EPAA 2EOEA 2ADRA 4F6MA 2WBTA 2EN2A 2YSPA 2DLQA 2RSIA 1X6FA 2EPZA 5KL6A 4IJDA 2WBUA 2JP9A 2EL4A 2EM8A 2YTNA 1MEYC 2EM0A 2VRDA 2GHFA 1X5WA 1A1LA 1ZU1A 5KL5A 1A1GA 1F2IG 2BB8A 2EM9A 2EN1A 2LT7A 1YUJA 2EM3A 2ENAA 2EOMA 2EMIA 2EMCA 2EORA 2LV2A 3M99B 3MHSC 2CTDA 2YSOA 1BBOA 2JPAA 2EQ1A 2YTPA 2EM4A 2HGHA 2EOZA 2DLKA 2EMGA 1TF3A 2EM6A 2DRPA 2EOJA 2EPUA 4X9JA 2YTDA 3EPLA 2EN3A 4R2RA 2EL6A 2EPRA 2LVHA 2EOXA 2YU8A 2EPCA 4R2PA 4FK5C 3EPHA 2ENCA 2ELZA 2EL5A 2EP3A 2EN7A 5KL2A 2YRHA 4M9VC 2DMIA 4R2CA 2YTFA 1X3CA 3EPJA 2EMBA 2EMAA 2EMKA 4R2AA 2EOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSH A;  2EMZ A;  1G2D C;  1NCS A;  2A25 A;  2YTE A;  2EN4 A;  2RPC A;  2YTJ A;  2YRK A;  3EPK A;  1LLM C;  1A1J A;  1A1F A;  4R2E A;  3UK3 C;  2EOH A;  2EJ4 A;  2EOF A;  3VHT B;  2GLI A;  2EMH A;  2EM5 A;  1KJK A;  2NAB A;  2EN8 A;  2EPP A;  2MDG A;  2EN6 A;  2YTO A;  5KL3 A;  1AAY A;  5KL7 A;  1DGC A;  2YTQ A;  4R2Q A;  1P47 A;  2WBS A;  2EMX A;  1TN9 A;  2EOS A;  1JK1 A;  4F2J C;  2EPX A;  2PRT A;  2EMW A;  1YUI A;  2EMY A;  1UN6 B;  2EOI A;  1JK2 A;  2YU5 A;  1X6H A;  1RMD A;  4R2D A;  2YTI A;  3MHH C;  1G2F C;  2YRM A;  1WJP A;  2EQ0 A;  2MKD A;  2MKN A;  2EM7 A;  1Z1B A;  2ELY A;  4GZN C;  1A1K A;  1ZAA C;  2DGC A;  1BB8 A;  2I13 A;  1X6E A;  2LO3 A;  4R2S A;  2R1F A;  1TF6 A;  1A1H A;  2YTG A;  2EE8 A;  2EM2 A;  4F6N A;  2LCE A;  5KL4 A;  2D9H A;  2EMF A;  1ZR9 A;  2M9A A;  2J7J A;  2WCC 3;  4IS1 C;  1A1I A;  2CT1 A;  1YSA C;  2E72 A;  2EML A;  1UBD C;  2EQ3 A;  1B69 A;  2EOO A;  4WSG A;  2ENH A;  2EOQ A;  2EPA A;  2EOE A;  2ADR A;  4F6M A;  2WBT A;  2EN2 A;  2YSP A;  2DLQ A;  2RSI A;  1X6F A;  2EPZ A;  5KL6 A;  4IJD A;  2WBU A;  2JP9 A;  2EL4 A;  2EM8 A;  2YTN A;  1MEY C;  2EM0 A;  2VRD A;  2GHF A;  1X5W A;  1A1L A;  1ZU1 A;  5KL5 A;  1A1G A;  1F2I G;  2BB8 A;  2EM9 A;  2EN1 A;  2LT7 A;  1YUJ A;  2EM3 A;  2ENA A;  2EOM A;  2EMI A;  2EMC A;  2EOR A;  2LV2 A;  3M99 B;  3MHS C;  2CTD A;  2YSO A;  1BBO A;  2JPA A;  2EQ1 A;  2YTP A;  2EM4 A;  2HGH A;  2EOZ A;  2DLK A;  2EMG A;  1TF3 A;  2EM6 A;  2DRP A;  2EOJ A;  2EPU A;  4X9J A;  2YTD A;  3EPL A;  2EN3 A;  4R2R A;  2EL6 A;  2EPR A;  2LVH A;  2EOX A;  2YU8 A;  2EPC A;  4R2P A;  4FK5 C;  3EPH A;  2ENC A;  2ELZ A;  2EL5 A;  2EP3 A;  2EN7 A;  5KL2 A;  2YRH A;  4M9V C;  2DMI A;  4R2C A;  2YTF A;  1X3C A;  3EPJ A;  2EMB A;  2EMA A;  2EMK A;  4R2A A;  2EOY A; 
#chains in the Genus database with same CATH topology
 2N3H A;  1HR0 E;  2HC5 A;  4R8O A;  1NCS A;  3JU0 A;  4O4K A;  1FJG E;  2YRK A;  3EPK A;  4BCA A;  4P7D A;  4JI5 E;  4JYA E;  4R2E A;  2RQL A;  4AQY E;  5A6B D;  2EJ4 A;  2MC5 A;  2FTX B;  4DR4 E;  4X8W A;  3VYY A;  2EN6 A;  1PJS A;  2VF1 A;  4TUI A;  4R2Q A;  2EMX A;  2EOS A;  1IBM E;  1T38 A;  3MSW A;  3K6Q A;  2PRT A;  4WPY A;  1JK2 A;  2E5L E;  4R2D A;  2EPM X;  1STU A;  1N36 E;  2JXP A;  1ZBQ A;  2MKD A;  4BHB A;  2K4V A;  5AC4 A;  1GZ6 A;  1Z1B A;  4B3M E;  1MGT A;  2B7V A;  2UU9 E;  1XMO E;  4GEQ B;  2LJU A;  1BB8 A;  2LUP B;  4R2S A;  2G7H A;  2R1F A;  2UUB E;  2JWO A;  3JTZ A;  2RS7 A;  2HJJ A;  5FLX C;  3DF6 A;  2D9H A;  1UHZ A;  2LMZ A;  4JI2 E;  4YY3 E;  2EMF A;  1PJT A;  2UUC E;  2M9A A;  4ZYH A;  2L3J A;  5AE1 A;  2WCC 3;  1A1I A;  2JVA A;  1YSA C;  3HXL A;  4F9C B;  2YT4 A;  2IHR 1;  4WX9 A;  4WSG A;  1WHN A;  2L2M A;  4JI3 E;  1YFH A;  2EN2 A;  2RSI A;  2EWL A;  2JOX A;  2V8Q B;  2EL4 A;  2H36 X;  3C6M A;  2EPN A;  2L2N A;  2GHF A;  1ZU1 A;  5KL5 A;  3FIG A;  5A2Q C;  2LT7 A;  2EM3 A;  1UIL A;  2GPI A;  1EH6 A;  2EMC A;  2LV2 A;  3J80 C;  3MHS C;  1WHQ A;  4B3R E;  2JPA A;  1BBO A;  1I94 E;  4LFA E;  3HTX A;  2I9I A;  4DR5 E;  2B9D A;  4WXC A;  1TF3 A;  2V85 A;  5ADZ A;  3EQ1 A;  2YTD A;  2EN3 A;  4R2R A;  1T39 A;  3EPH A;  3VYX A;  2DIX A;  1N33 E;  1YYW A;  4NXM E;  4JI6 E;  1HNX E;  2JR1 A;  2L3C A;  2F8B A;  2YTF A;  4ZYE A;  2EMK A;  2UXB E;  1DQ3 A;  1X48 A;  1EH8 A;  2CSH A;  4JV5 E;  2YTE A;  4F9B B;  2EN4 A;  4B3T E;  2LBS B;  2EZ6 A;  2MDR A;  1LLM C;  1WRJ A;  1A1J A;  4OX9 E;  2BBG A;  4O5G A;  3VHT B;  2EM5 A;  2LTR A;  1QNT A;  1N32 E;  2MDG A;  2E1M A;  2YTO A;  5KL3 A;  3IWB A;  4X62 E;  1AAY A;  2VQF E;  5F3W A;  2YTQ A;  2WBS A;  2EPK X;  4N4R B;  1YUI A;  2JYA A;  1UN6 B;  1ZBT A;  4J8Z A;  4LF9 E;  2YTI A;  2V87 A;  3ZOQ B;  4DV2 E;  2LUQ A;  1IBK E;  1G2F C;  2YRM A;  3KWR A;  2EQ0 A;  2MKN A;  4GZN C;  1YPN A;  4DV7 E;  2DSY A;  2ZM6 E;  2I13 A;  2V88 A;  2LO3 A;  4B3S E;  1XNR E;  2YTG A;  2EE8 A;  4F6N A;  3BID A;  1ZR9 A;  4ZYG A;  2M4I A;  2RSM A;  2J7J A;  2ODR C;  1X49 A;  2FGG A;  2R76 A;  2E72 A;  1BBG A;  2VE7 C;  2UUA E;  2YWQ A;  2EQ3 A;  4F54 A;  1B69 A;  4GKJ E;  2EOE A;  2UXC E;  4JI4 E;  4L8N A;  4BS9 A;  1X6F A;  4I8O A;  1SR9 A;  1IQS A;  5KL6 A;  4F9A B;  4IJD A;  2L8T A;  2EM8 A;  2YTN A;  1MEY C;  4Q28 A;  5T6J A;  4O24 A;  2VRD A;  2RS6 A;  1X5W A;  3TQM A;  1GQE A;  3J7A G;  1WXR A;  2EN1 A;  2ENA A;  3IWC A;  2EOM A;  4WSP A;  4LF4 E;  2EMI A;  5LMU E;  2EOR A;  4Q35 B;  2YSO A;  4LF7 E;  1FKA E;  3RMP A;  2KOU A;  2EM4 A;  3C4B A;  2EOJ A;  1N3G A;  4X65 E;  4OOG C;  3EPL A;  1GTK A;  3JAM C;  2EL6 A;  5IT9 C;  4M30 A;  2EPC A;  4JI1 E;  2ENC A;  2ELZ A;  2EP3 A;  2EN7 A;  5KL2 A;  4M9V C;  4BMJ A;  2DMI A;  1SFE A;  2LE2 A;  2NUF A;  2EMB A;  2B7T A;  4JI0 E;  4R2A A;  5AE3 A;  3AUZ A;  4DV6 E;  4P78 A;  2EMZ A;  1XMQ E;  1G2D C;  2A25 A;  1HNZ E;  1N34 E;  1KYQ A;  1X47 A;  2YTJ A;  3OML A;  4DV1 E;  4DR3 E;  1A1F A;  1L4S A;  2JOB A;  1KJK A;  2N8X A;  2NAB A;  2EPP A;  5KL7 A;  1IQO A;  2V83 A;  1P47 A;  3J7Y p;  3BF2 A;  2DB2 A;  4MLV A;  2EPX A;  4F2J C;  2YU5 A;  5LMN E;  4LF5 E;  1X6H A;  3LLH A;  4WFT A;  3F6H A;  2F4V E;  3F6G A;  2EM7 A;  1RC7 A;  2ELY A;  4X66 E;  5A6K A;  3ECR A;  5LLQ A;  1ZAA C;  4NZV A;  2DMY A;  3BBG A;  1T4L B;  5AC5 A;  2L2K B;  3AV0 A;  3ADI A;  1A1H A;  2EM2 A;  2B3T B;  2MC6 A;  3ADL A;  2CT1 A;  3THN A;  3IWD A;  5AE2 A;  4BBY A;  4HTG A;  1T4O A;  2EOO A;  2NA2 A;  2ENH A;  2FV4 B;  3C4T A;  2EPA A;  2ADR A;  3T1Y E;  3P1X A;  2LTS A;  2WBT A;  4KHP E;  2YSP A;  2DLQ A;  1EH7 A;  4ZYD A;  2CPN A;  2JP9 A;  2EM0 A;  4K0K E;  1A1L A;  4DV0 E;  1F2I G;  5IWA E;  2EM9 A;  1YUJ A;  4R03 A;  5TSE A;  1O0W A;  2K7I A;  2LRS A;  2EQ1 A;  2YTP A;  1YYK A;  4DUZ E;  3DJW A;  1QU6 A;  2EMG A;  2ODR D;  2DRP A;  2YZT A;  2EPU A;  4X9J A;  4KZS A;  4DR6 E;  3OTO E;  2LVH A;  4NHR A;  2JY9 A;  4FK5 C;  4O43 A;  2EL5 A;  4JI8 E;  5A69 A;  5A6J A;  1IMU A;  5IV8 B;  1EKZ A;  4R2C A;  1RQ0 A;  1X3C A;  2HHH E;  2EMA A;  4M2Z A;  4X64 E;  1NEI A;  5IXM B;  2RPC A;  3ADG A;  3UK3 C;  1J5E E;  3KZY A;  5A6B A;  2EOH A;  2EOF A;  3HPS A;  2GLI A;  3LML A;  2EMH A;  2LJH A;  4DMI A;  2EN8 A;  1DI2 A;  5AAS A;  4BC9 A;  1DGC A;  4HEI A;  4DR1 E;  1TN9 A;  1JK1 A;  2L92 A;  2NUE A;  2EMW A;  1IBL E;  2EMY A;  2M7Q A;  2EOI A;  4LU9 A;  1RMD A;  3THO B;  3MHH C;  1WJP A;  3J81 C;  2V89 A;  3HQ1 A;  2NUG A;  4DUY E;  2Q8U A;  4DKK A;  2WZO A;  2L33 A;  1PKP A;  5A6A A;  1A1K A;  2DGC A;  4L5N C;  1X6E A;  1TF6 A;  4DV5 E;  4TUG A;  1YYO A;  2LCE A;  5KL4 A;  4M0V A;  2UXD E;  3KZZ A;  4IS1 C;  4BHC A;  4DR2 E;  4DV4 E;  2YPN A;  2EML A;  1UBD C;  3L00 A;  2RTX A;  2L6M A;  2EOQ A;  4LF6 E;  4F6M A;  2KON A;  4RH8 A;  4JI7 E;  2N3G A;  2EPZ A;  4YHH E;  2WBU A;  4LTY A;  5CFF E;  4KWY A;  5LL6 R;  1T4N A;  4DR7 E;  3C6K A;  1A1G A;  3BGH A;  4NXN E;  2BB8 A;  4BC7 A;  4RHB B;  4MLQ A;  2M1S A;  3QG5 C;  3M99 B;  2CTD A;  3VK6 A;  5DNY A;  4LFC E;  2KHX A;  2EPL X;  2HGH A;  4LF8 E;  2EOZ A;  2DLK A;  4WXD A;  1AH5 A;  2EM6 A;  3T1H E;  1YZ9 A;  4WYQ B;  5BR8 E;  2VQE E;  2YU8 A;  2EPR A;  4R2P A;  2EOX A;  2V86 A;  1PJQ A;  4GKK E;  1PDA A;  2EPO A;  2YRH A;  3ADJ A;  4DV3 E;  3H09 A;  1J26 A;  4LFB E;  3EPJ A;  1XNQ E;  1HNW E;  3HPZ A;  2EOY A; 
#chains in the Genus database with same CATH homology
 2CSH A;  2EMZ A;  1G2D C;  1NCS A;  2A25 A;  2YTE A;  2EN4 A;  2RPC A;  2YTJ A;  2YRK A;  3EPK A;  1LLM C;  1A1J A;  1A1F A;  4R2E A;  3UK3 C;  2EOH A;  2EJ4 A;  2EOF A;  3VHT B;  2GLI A;  2EMH A;  2EM5 A;  1KJK A;  2NAB A;  2EN8 A;  2EPP A;  2MDG A;  2EN6 A;  2YTO A;  5KL3 A;  1AAY A;  5KL7 A;  1DGC A;  2YTQ A;  4R2Q A;  1P47 A;  2WBS A;  2EMX A;  1TN9 A;  2EOS A;  1JK1 A;  4F2J C;  2EPX A;  2PRT A;  2EMW A;  1YUI A;  2EMY A;  1UN6 B;  2EOI A;  1JK2 A;  2YU5 A;  1X6H A;  1RMD A;  4R2D A;  2YTI A;  3MHH C;  1G2F C;  2YRM A;  1WJP A;  2EQ0 A;  2MKD A;  2MKN A;  2EM7 A;  1Z1B A;  2ELY A;  4GZN C;  1A1K A;  1ZAA C;  2DGC A;  1BB8 A;  2I13 A;  1X6E A;  2LO3 A;  4R2S A;  2R1F A;  1TF6 A;  1A1H A;  2YTG A;  2EE8 A;  2EM2 A;  4F6N A;  2LCE A;  5KL4 A;  2D9H A;  2EMF A;  1ZR9 A;  2M9A A;  2J7J A;  2WCC 3;  4IS1 C;  1A1I A;  2CT1 A;  1YSA C;  2E72 A;  2EML A;  1UBD C;  2EQ3 A;  1B69 A;  2EOO A;  4WSG A;  2ENH A;  2EOQ A;  2EPA A;  2EOE A;  2ADR A;  4F6M A;  2WBT A;  2EN2 A;  2YSP A;  2DLQ A;  2RSI A;  1X6F A;  2EPZ A;  5KL6 A;  4IJD A;  2WBU A;  2JP9 A;  2EL4 A;  2EM8 A;  2YTN A;  1MEY C;  2EM0 A;  2VRD A;  2GHF A;  1X5W A;  1A1L A;  1ZU1 A;  5KL5 A;  1A1G A;  1F2I G;  2BB8 A;  2EM9 A;  2EN1 A;  2LT7 A;  1YUJ A;  2EM3 A;  2ENA A;  2EOM A;  2EMI A;  2EMC A;  2EOR A;  2LV2 A;  3M99 B;  3MHS C;  2CTD A;  2YSO A;  1BBO A;  2JPA A;  2EQ1 A;  2YTP A;  2EM4 A;  2HGH A;  2EOZ A;  2DLK A;  2EMG A;  1TF3 A;  2EM6 A;  2DRP A;  2EOJ A;  2EPU A;  4X9J A;  2YTD A;  3EPL A;  2EN3 A;  4R2R A;  2EL6 A;  2EPR A;  2LVH A;  2EOX A;  2YU8 A;  2EPC A;  4R2P A;  4FK5 C;  3EPH A;  2ENC A;  2ELZ A;  2EL5 A;  2EP3 A;  2EN7 A;  5KL2 A;  2YRH A;  4M9V C;  2DMI A;  4R2C A;  2YTF A;  1X3C A;  3EPJ A;  2EMB A;  2EMA A;  2EMK A;  4R2A A;  2EOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...