1X49A

Solution structure of the first dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
97
structure length
97
Chain Sequence
b'GSSGSSGMASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAKGRSKQEARNAAAKLAVDILDNENKVDCHTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-induced, double-stranded RNA-activated protein ki
publication title Solution structure of the first DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 18
structure length 97
sequence length 97
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x49A01
2RS7A 1T4LB 1IBLE 4X8WA 4JI2E 4NXNE 2RS6A 2KHXA 2UUAE 2LRSA 2L3CA 1UILA 2NUEA 1HNXE 4DR2E 4DV1E 4LF9E 1DI2A 2DMYA 1WHNA 4DR4E 1PKPA 4DUZE 4X64E 1UHZA 4X66E 1EKZA 4LF5E 4JI3E 4X62E 1XNRE 1IBKE 1STUA 4DV6E 4JYAE 4YHHE 1N33E 2UXDE 4OOGC 4GKJE 1XNQE 5CFFE 1IBME 2N3GA 5LMUE 4DR7E 4LFBE 1X48A 3C4TA 4JI7E 1ZBTA 1RC7A 2DB2A 1T4OA 3T1YE 2LTRA 1N32E 4GKKE 2N3HA 4DR3E 1O0WA 4NXME 4JI8E 4DV3E 4M30A 2DIXA 4AQYE 4B3ME 1N36E 4B3RE 2E5LE 4DR1E 3T1HE 2L2NA 2VQFE 4DUYE 2UUCE 2EZ6A 2RSMA 5IWAE 1FKAE 3C4BA 1T4NA 4DV2E 2B3TB 3VYYA 4LF6E 4DV7E 4JI0E 1J5EE 1J26A 3VYXA 2B7TA 1XMQE 1I94E 2F4VE 2NA2A 4K0KE 4OX9E 2LBSB 4DV0E 4X65E 1HNWE 3LLHA 1X47A 5LMNE 4LFAE 2L2KB 2L3JA 1HNZE 2UU9E 4JI6E 2LTSA 1FJGE 1WHQA 1YYOA 4YY3E 3ADLA 3OTOE 1N34E 2VQEE 4LF8E 1RQ0A 5BR8E 2NUFA 4B3TE 4JI5E 4LF7E 1YYKA 2CPNA 2UXBE 2UXCE 4JI4E 2JY9A 1HR0E 2JVAA 4LFCE 4DV4E 2HHHE 4JV5E 2ZM6E 2L2MA 4WFTA 2YT4A 2LUQA 2RTXA 4LF4E 1YYWA 2MDRA 1GQEA 4B3SE 3J7Yp 2B7VA 4WYQB 2LJHA 4DKKA 3ADJA 4DR5E 4DV5E 1X49A 4JI1E 3P1XA 2LUPB 2UUBE 2L33A 1QU6A 4M2ZA 2NUGA 2IHR1 3ADGA 4KHPE 1XMOE 3ADIA 1YZ9A 4DR6E 3HTXA
chains in the Genus database with same CATH superfamily
2RPCA 2YWQA 1T4LB 1IBLE 3L00A 3THOB 4R03A 4DV1E 3IWBA 2EOIA 2K4VA 4RHBB 3TQMA 4DR4E 2EMFA 3ZOQB 2CT1A 4X64E 2EMBA 3F6GA 4TUIA 2EN1A 1EKZA 3ECRA 4LF5E 1LLMC 4ZYDA 2CTDA 1IBKE 2DLKA 4RH8A 4DV6E 1JK1A 4GKJE 4F54A 2WCC3 5F3WA 2YTEA 1A1GA 2EMIA 4MLQA 1L4SA 2EOEA 5AE1A 2EPNA 3OMLA 2EL6A 2EMGA 1X6HA 4NXME 1Z1BA 2KOUA 2LVHA 2YSOA 4DR1E 1BBGA 2EM3A 2RSMA 3C4BA 3MHHC 2EM6A 1NCSA 3EPLA 3J7AG 4JI0E 2EPOA 4R2CA 4R2SA 2B7TA 1A1FA 2JOBA 2HC5A 2KONA 2EPRA 4OX9E 4X65E 3RMPA 2DSYA 3LLHA 1UN6B 2MKDA 2L3JA 1YYOA 3ADLA 4BS9A 4F9BB 5BR8E 2YTFA 4JI5E 3AV0A 5IXMB 2GLIA 1T39A 2UXCE 2G7HA 2EM4A 4BC7A 2LO3A 2JVAA 3BF2A 2EOHA 1YZ9A 2JR1A 2EM2A 3BBGA 3EQ1A 2EOSA 1SFEA 4LF4E 1YYWA 4Q35B 1GQEA 5FLXC 4F6MA 5A6AA 3J80C 2WZOA 2YU8A 2E72A 2B7VA 2V83A 3ADJA 1A1LA 1X49A 4KZSA 2V87A 1T38A 5KL4A 3JAMC 1KJKA 2UUBE 3JU0A 2PRTA 1WJPA 3ADGA 2EPZA 4N4RB 1XMOE 2WBSA 1F2IG 1A1JA 3ADIA 4DR6E 2CSHA 2RS7A 3C6KA 2EOFA 2YU5A 4X8WA 2EPLX 2KHXA 3DF6A 5ADZA 4MLVA 2NUEA 1HNXE 2R76A 5LLQA 2V8QB 4DUZE 4F6NA 2EOXA 2JYAA 3KWRA 2LE2A 3VHTB 4BCAA 5A2QC 2EPXA 2EPCA 2EOOA 1YSAC 4OOGC 5IT9C 1TF6A 5A6BD 2M1SA 2N3GA 5LMUE 4LFBE 2EOYA 4R2QA 1PDAA 3C4TA 1ZBQA 2JP9A 2DB2A 1GZ6A 2YTPA 2YTJA 2DGCA 1X6EA 4KWYA 1O0WA 4ZYHA 4JI8E 4M30A 4AQYE 2F8BA 2E5LE 2EPUA 2VQFE 2EZ6A 4WPYA 1ZU1A 2FV4B 2EMKA 4Q28A 5AC4A 1J26A 5AASA 3K6QA 3F6HA 4K0KE 1MGTA 4R2RA 2D9HA 1A1HA 1MEYC 4DV0E 1HNWE 2RSIA 5LMNE 2YRKA 2L2KB 2EQ3A 1HNZE 4JI6E 3BIDA 1PJTA 2LCEA 1ZAAC 3OTOE 1N34E 1PJQA 4LF8E 2GHFA 4B3TE 2YTDA 1YYKA 2EMWA 1X5WA 2JY9A 2M7QA 3HXLA 2ENHA 3H09A 3FIGA 2GPIA 4P7DA 4DV4E 2EM9A 2ZM6E 2L2MA 2V88A 3BGHA 2RTXA 4L8NA 3EPKA 4BHCA 2ADRA 2EOJA 2N8XA 4X9JA 4GZNC 2HGHA 4B3SE 2L8TA 1X3CA 2LJHA 2V86A 4O4KA 2K7IA 4R2PA 2LMZA 2NUGA 2ELYA 5KL7A 2YTNA 4KHPE 2EQ0A 2EORA 4F2JC 5AE3A 2EN2A 4JI2E 4NXNE 2EOZA 2YTGA 3J81C 3QG5C 2UUAE 2H36X 2ODRD 4LF9E 1UHZA 2ELZA 5A6BA 2Q8UA 1XNRE 4X62E 2FTXB 3UK3C 2LJUA 4YHHE 2WBTA 2EE8A 1N33E 1YUJA 2UXDE 1IQOA 2B9DA 2YPNA 4DR7E 4WXDA 4JI7E 2MKNA 2ODRC 3KZYA 1G2FC 1T4OA 2EPAA 2NABA 2A25A 3T1YE 4GKKE 2RQLA 5IV8B 2DLQA 3DJWA 4R2EA 4DV3E 3C6MA 2DIXA 1N36E 3T1HE 2L2NA 4DUYE 4GEQB 2UUCE 1YUIA 4WXCA 3LMLA 2EM7A 1T4NA 2JWOA 4LF6E 5AE2A 5KL3A 2JXPA 1J5EE 3VYXA 1XMQE 2J7JA 4ZYEA 1A1IA 2F4VE 1X6FA 4IJDA 2LT7A 2BB8A 1P47A 1JK2A 1RMDA 2LBSB 2I13A 1KYQA 4LFAE 2EN8A 2MC5A 2L92A 4I8OA 1FJGE 2LTSA 1WHQA 1N3GA 1RQ0A 2NUFA 2CPNA 2EM5A 1G2DC 2M4IA 5T6JA 3M99B 4IS1C 2EN7A 3HPSA 4LU9A 2HHHE 4JV5E 2YT4A 2LV2A 4HEIA 1EH6A 2LUQA 3IWDA 2EPPA 2EPKX 2EPMX 3HQ1A 4DMIA 2MDRA 2EMYA 2VRDA 1IQSA 2EP3A 2EN4A 2DRPA 2EMXA 2MDGA 3J7Yp 2YSPA 1SR9A 3HPZA 1IMUA 4DV5E 2ENCA 4BMJA 2DMIA 5A69A 3P1XA 2LUPB 3AUZA 2YZTA 3THNA 5A6KA 1NEIA 1YPNA 4J8ZA 2EM8A 4NZVA 2VF1A 1WXRA 2UXBE 2V85A 4F9CB 3HTXA 1BB8A 1TF3A 1ZR9A 2EOMA 2RS6A 2WBUA 1EH8A 2LRSA 2L3CA 2JOXA 1UILA 4DR2E 2EM0A 2VE7C 1DI2A 2DMYA 5TSEA 1WHNA 1PKPA 2L6MA 4X66E 1AH5A 5DNYA 4JI3E 1DQ3A 1STUA 2EOQA 4JYAE 4WX9A 4L5NC 1XNQE 5CFFE 1IBME 1AAYA 4WSPA 1X48A 4WSGA 1ZBTA 3KZZA 1RC7A 4BBYA 5AC5A 4ZYGA 2LTRA 1N32E 2N3HA 5KL5A 2E1MA 4DR3E 4O5GA 2YTOA 1A1KA 1DGCA 2JPAA 2MC6A 5KL2A 1YFHA 4FK5C 2ENAA 4LTYA 4B3ME 4B3RE 2EQ1A 2YRHA 3EPHA 4NHRA 5IWAE 1FKAE 2R1FA 4DV2E 2B3TB 3VYYA 2YRMA 4HTGA 4DV7E 1I94E 1TN9A 2NA2A 1UBDC 4O24A 4R2AA 1PJSA 1X47A 2YTIA 2EWLA 2EMZA 2EJ4A 2UU9E 1EH7A 3MHSC 4YY3E 5A6JA 3VK6A 2YTQA 2VQEE 4LF7E 4O43A 4JI4E 1HR0E 4BC9A 3IWCA 5KL6A 3MSWA 2EMCA 4LFCE 2HJJA 1QNTA 2V89A 4WFTA 2FGGA 2EN3A 2EMAA 1WRJA 4M9VC 2EN6A 4R2DA 4TUGA 2I9IA 2M9AA 2EL5A 2EMHA 1GTKA 2EMLA 4WYQB 4DKKA 4DR5E 3EPJA 4JI1E 5LL6R 4F9AB 4R8OA 2EL4A 4M0VA 2L33A 1QU6A 2BBGA 3JTZA 4M2ZA 2IHR1 4BHBA 1BBOA 1B69A 4P78A
chains in the Genus database with same CATH topology
2RS7A 1T4LB 1IBLE 5AE3A 4X8WA 4JI2E 4NXNE 2RS6A 3J81C 2KHXA 2UUAE 2H36X 3DF6A 2LRSA 2L3CA 2JOXA 5ADZA 1UILA 2ODRD 4R03A 2NUEA 1HNXE 4DR2E 4DV1E 2VE7C 3IWBA 4LF9E 2DMYA 2K4VA 1DI2A 1WHNA 2V8QB 4DR4E 1PKPA 2L6MA 3ZOQB 4DUZE 4X64E 3KWRA 3F6GA 1UHZA 2LE2A 4BCAA 4X66E 5A2QC 4TUIA 1EKZA 4LF5E 5DNYA 4JI3E 4X62E 1XNRE 2FTXB 1IBKE 1DQ3A 1STUA 4DV6E 4JYAE 4YHHE 1N33E 2UXDE 2B9DA 4OOGC 5IT9C 4GKJE 2M1SA 4L5NC 5CFFE 1IBME 2N3GA 5LMUE 1XNQE 4DR7E 4F54A 4LFBE 5F3WA 4WSPA 1X48A 3C4TA 4JI7E 1ZBTA 1RC7A 4BBYA 1ZBQA 2ODRC 2DB2A 1T4OA 1GZ6A 2LTRA 3T1YE 1N32E 5AE1A 4GKKE 2N3HA 2E1MA 4DR3E 1O0WA 3OMLA 4NXME 4JI8E 3DJWA 2MC6A 1XMOE 4DV3E 4M30A 2DIXA 2KOUA 4LTYA 4AQYE 1N36E 2F8BA 4B3ME 2E5LE 4DR1E 3T1HE 4B3RE 2L2NA 2VQFE 4GEQB 4DUYE 2UUCE 2RSMA 4WPYA 5IWAE 3C4BA 1FKAE 2EZ6A 3LMLA 1T4NA 2FV4B 2B3TB 2JWOA 3VYYA 4Q28A 4DV2E 4LF6E 5AE2A 3J7AG 4DV7E 4JI0E 1J5EE 5AASA 1J26A 3VYXA 2B7TA 1XMQE 3K6QA 1I94E 2JOBA 2F4VE 2NA2A 3F6HA 4K0KE 2KONA 4OX9E 2LBSB 4DV0E 4X65E 3RMPA 2DSYA 3LLHA 1X47A 5LMNE 4LFAE 2MC5A 1HNWE 2L2KB 2EWLA 2L92A 2L3JA 1HNZE 4I8OA 2UU9E 2LTSA 4JI6E 1WHQA 1FJGE 1YYOA 4YY3E 3ADLA 3VK6A 4BS9A 3OTOE 1N34E 4F9BB 2VQEE 4LF8E 1RQ0A 5BR8E 2NUFA 4B3TE 4JI5E 4LF7E 1YYKA 2CPNA 2UXBE 3AV0A 2UXCE 4JI4E 2JY9A 2M7QA 2G7HA 3HXLA 3H09A 2M4IA 4BC7A 4BC9A 3FIGA 3IWCA 3MSWA 1HR0E 2JVAA 4P7DA 3HTXA 4LFCE 5T6JA 4DV4E 2HHHE 4JV5E 3HPSA 4LU9A 2ZM6E 2L2MA 2V89A 4WFTA 2FGGA 2JR1A 2YT4A 2V88A 2LUQA 2RTXA 3IWDA 3HQ1A 4L8NA 4DMIA 4LF4E 1YYWA 2MDRA 4TUGA 1GQEA 5FLXC 3J80C 2WZOA 4B3SE 2L8TA 3J7Yp 1SR9A 2B7VA 2LJHA 3HPZA 2V83A 3ADJA 4WYQB 4DKKA 4DV5E 4DR5E 1X49A 4JI1E 4BMJA 2V86A 4KZSA 5LL6R 4F9AB 2V87A 4R8OA 3P1XA 2LUPB 3JAMC 3AUZA 2YZTA 4M0VA 2UUBE 2L33A 1QU6A 3JU0A 2LMZA 3JTZA 4J8ZA 4M2ZA 1WXRA 2VF1A 2NUGA 2IHR1 3ADGA 4KHPE 2V85A 4F9CB 3ADIA 1YZ9A 4DR6E 4P78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS7 A;  1T4L B;  1IBL E;  4X8W A;  4JI2 E;  4NXN E;  2RS6 A;  2KHX A;  2UUA E;  2LRS A;  2L3C A;  1UIL A;  2NUE A;  1HNX E;  4DR2 E;  4DV1 E;  4LF9 E;  1DI2 A;  2DMY A;  1WHN A;  4DR4 E;  1PKP A;  4DUZ E;  4X64 E;  1UHZ A;  4X66 E;  1EKZ A;  4LF5 E;  4JI3 E;  4X62 E;  1XNR E;  1IBK E;  1STU A;  4DV6 E;  4JYA E;  4YHH E;  1N33 E;  2UXD E;  4OOG C;  4GKJ E;  1XNQ E;  5CFF E;  1IBM E;  2N3G A;  5LMU E;  4DR7 E;  4LFB E;  1X48 A;  3C4T A;  4JI7 E;  1ZBT A;  1RC7 A;  2DB2 A;  1T4O A;  3T1Y E;  2LTR A;  1N32 E;  4GKK E;  2N3H A;  4DR3 E;  1O0W A;  4NXM E;  4JI8 E;  4DV3 E;  4M30 A;  2DIX A;  4AQY E;  4B3M E;  1N36 E;  4B3R E;  2E5L E;  4DR1 E;  3T1H E;  2L2N A;  2VQF E;  4DUY E;  2UUC E;  2EZ6 A;  2RSM A;  5IWA E;  1FKA E;  3C4B A;  1T4N A;  4DV2 E;  2B3T B;  3VYY A;  4LF6 E;  4DV7 E;  4JI0 E;  1J5E E;  1J26 A;  3VYX A;  2B7T A;  1XMQ E;  1I94 E;  2F4V E;  2NA2 A;  4K0K E;  4OX9 E;  2LBS B;  4DV0 E;  4X65 E;  1HNW E;  3LLH A;  1X47 A;  5LMN E;  4LFA E;  2L2K B;  2L3J A;  1HNZ E;  2UU9 E;  4JI6 E;  2LTS A;  1FJG E;  1WHQ A;  1YYO A;  4YY3 E;  3ADL A;  3OTO E;  1N34 E;  2VQE E;  4LF8 E;  1RQ0 A;  5BR8 E;  2NUF A;  4B3T E;  4JI5 E;  4LF7 E;  1YYK A;  2CPN A;  2UXB E;  2UXC E;  4JI4 E;  2JY9 A;  1HR0 E;  2JVA A;  4LFC E;  4DV4 E;  2HHH E;  4JV5 E;  2ZM6 E;  2L2M A;  4WFT A;  2YT4 A;  2LUQ A;  2RTX A;  4LF4 E;  1YYW A;  2MDR A;  1GQE A;  4B3S E;  3J7Y p;  2B7V A;  4WYQ B;  2LJH A;  4DKK A;  3ADJ A;  4DR5 E;  4DV5 E;  1X49 A;  4JI1 E;  3P1X A;  2LUP B;  2UUB E;  2L33 A;  1QU6 A;  4M2Z A;  2NUG A;  2IHR 1;  3ADG A;  4KHP E;  1XMO E;  3ADI A;  1YZ9 A;  4DR6 E;  3HTX A; 
#chains in the Genus database with same CATH topology
 2RPC A;  2YWQ A;  1T4L B;  1IBL E;  3L00 A;  3THO B;  4R03 A;  4DV1 E;  3IWB A;  2EOI A;  2K4V A;  4RHB B;  3TQM A;  4DR4 E;  2EMF A;  3ZOQ B;  2CT1 A;  4X64 E;  2EMB A;  3F6G A;  4TUI A;  2EN1 A;  1EKZ A;  3ECR A;  4LF5 E;  1LLM C;  4ZYD A;  2CTD A;  1IBK E;  2DLK A;  4RH8 A;  4DV6 E;  1JK1 A;  4GKJ E;  4F54 A;  2WCC 3;  5F3W A;  2YTE A;  1A1G A;  2EMI A;  4MLQ A;  1L4S A;  2EOE A;  5AE1 A;  2EPN A;  3OML A;  2EL6 A;  2EMG A;  1X6H A;  4NXM E;  1Z1B A;  2KOU A;  2LVH A;  2YSO A;  4DR1 E;  1BBG A;  2EM3 A;  2RSM A;  3C4B A;  3MHH C;  2EM6 A;  1NCS A;  3EPL A;  3J7A G;  4JI0 E;  2EPO A;  4R2C A;  4R2S A;  2B7T A;  1A1F A;  2JOB A;  2HC5 A;  2KON A;  2EPR A;  4OX9 E;  4X65 E;  3RMP A;  2DSY A;  3LLH A;  1UN6 B;  2MKD A;  2L3J A;  1YYO A;  3ADL A;  4BS9 A;  4F9B B;  5BR8 E;  2YTF A;  4JI5 E;  3AV0 A;  5IXM B;  2GLI A;  1T39 A;  2UXC E;  2G7H A;  2EM4 A;  4BC7 A;  2LO3 A;  2JVA A;  3BF2 A;  2EOH A;  1YZ9 A;  2JR1 A;  2EM2 A;  3BBG A;  3EQ1 A;  2EOS A;  1SFE A;  4LF4 E;  1YYW A;  4Q35 B;  1GQE A;  5FLX C;  4F6M A;  5A6A A;  3J80 C;  2WZO A;  2YU8 A;  2E72 A;  2B7V A;  2V83 A;  3ADJ A;  1A1L A;  1X49 A;  4KZS A;  2V87 A;  1T38 A;  5KL4 A;  3JAM C;  1KJK A;  2UUB E;  3JU0 A;  2PRT A;  1WJP A;  3ADG A;  2EPZ A;  4N4R B;  1XMO E;  2WBS A;  1F2I G;  1A1J A;  3ADI A;  4DR6 E;  2CSH A;  2RS7 A;  3C6K A;  2EOF A;  2YU5 A;  4X8W A;  2EPL X;  2KHX A;  3DF6 A;  5ADZ A;  4MLV A;  2NUE A;  1HNX E;  2R76 A;  5LLQ A;  2V8Q B;  4DUZ E;  4F6N A;  2EOX A;  2JYA A;  3KWR A;  2LE2 A;  3VHT B;  4BCA A;  5A2Q C;  2EPX A;  2EPC A;  2EOO A;  1YSA C;  4OOG C;  5IT9 C;  1TF6 A;  5A6B D;  2M1S A;  2N3G A;  5LMU E;  4LFB E;  2EOY A;  4R2Q A;  1PDA A;  3C4T A;  1ZBQ A;  2JP9 A;  2DB2 A;  1GZ6 A;  2YTP A;  2YTJ A;  2DGC A;  1X6E A;  4KWY A;  1O0W A;  4ZYH A;  4JI8 E;  4M30 A;  4AQY E;  2F8B A;  2E5L E;  2EPU A;  2VQF E;  2EZ6 A;  4WPY A;  1ZU1 A;  2FV4 B;  2EMK A;  4Q28 A;  5AC4 A;  1J26 A;  5AAS A;  3K6Q A;  3F6H A;  4K0K E;  1MGT A;  4R2R A;  2D9H A;  1A1H A;  1MEY C;  4DV0 E;  1HNW E;  2RSI A;  5LMN E;  2YRK A;  2L2K B;  2EQ3 A;  1HNZ E;  4JI6 E;  3BID A;  1PJT A;  2LCE A;  1ZAA C;  3OTO E;  1N34 E;  1PJQ A;  4LF8 E;  2GHF A;  4B3T E;  2YTD A;  1YYK A;  2EMW A;  1X5W A;  2JY9 A;  2M7Q A;  3HXL A;  2ENH A;  3H09 A;  3FIG A;  2GPI A;  4P7D A;  4DV4 E;  2EM9 A;  2ZM6 E;  2L2M A;  2V88 A;  3BGH A;  2RTX A;  4L8N A;  3EPK A;  4BHC A;  2ADR A;  2EOJ A;  2N8X A;  4X9J A;  4GZN C;  2HGH A;  4B3S E;  2L8T A;  1X3C A;  2LJH A;  2V86 A;  4O4K A;  2K7I A;  4R2P A;  2LMZ A;  2NUG A;  2ELY A;  5KL7 A;  2YTN A;  4KHP E;  2EQ0 A;  2EOR A;  4F2J C;  5AE3 A;  2EN2 A;  4JI2 E;  4NXN E;  2EOZ A;  2YTG A;  3J81 C;  3QG5 C;  2UUA E;  2H36 X;  2ODR D;  4LF9 E;  1UHZ A;  2ELZ A;  5A6B A;  2Q8U A;  1XNR E;  4X62 E;  2FTX B;  3UK3 C;  2LJU A;  4YHH E;  2WBT A;  2EE8 A;  1N33 E;  1YUJ A;  2UXD E;  1IQO A;  2B9D A;  2YPN A;  4DR7 E;  4WXD A;  4JI7 E;  2MKN A;  2ODR C;  3KZY A;  1G2F C;  1T4O A;  2EPA A;  2NAB A;  2A25 A;  3T1Y E;  4GKK E;  2RQL A;  5IV8 B;  2DLQ A;  3DJW A;  4R2E A;  4DV3 E;  3C6M A;  2DIX A;  1N36 E;  3T1H E;  2L2N A;  4DUY E;  4GEQ B;  2UUC E;  1YUI A;  4WXC A;  3LML A;  2EM7 A;  1T4N A;  2JWO A;  4LF6 E;  5AE2 A;  5KL3 A;  2JXP A;  1J5E E;  3VYX A;  1XMQ E;  2J7J A;  4ZYE A;  1A1I A;  2F4V E;  1X6F A;  4IJD A;  2LT7 A;  2BB8 A;  1P47 A;  1JK2 A;  1RMD A;  2LBS B;  2I13 A;  1KYQ A;  4LFA E;  2EN8 A;  2MC5 A;  2L92 A;  4I8O A;  1FJG E;  2LTS A;  1WHQ A;  1N3G A;  1RQ0 A;  2NUF A;  2CPN A;  2EM5 A;  1G2D C;  2M4I A;  5T6J A;  3M99 B;  4IS1 C;  2EN7 A;  3HPS A;  4LU9 A;  2HHH E;  4JV5 E;  2YT4 A;  2LV2 A;  4HEI A;  1EH6 A;  2LUQ A;  3IWD A;  2EPP A;  2EPK X;  2EPM X;  3HQ1 A;  4DMI A;  2MDR A;  2EMY A;  2VRD A;  1IQS A;  2EP3 A;  2EN4 A;  2DRP A;  2EMX A;  2MDG A;  3J7Y p;  2YSP A;  1SR9 A;  3HPZ A;  1IMU A;  4DV5 E;  2ENC A;  4BMJ A;  2DMI A;  5A69 A;  3P1X A;  2LUP B;  3AUZ A;  2YZT A;  3THN A;  5A6K A;  1NEI A;  1YPN A;  4J8Z A;  2EM8 A;  4NZV A;  2VF1 A;  1WXR A;  2UXB E;  2V85 A;  4F9C B;  3HTX A;  1BB8 A;  1TF3 A;  1ZR9 A;  2EOM A;  2RS6 A;  2WBU A;  1EH8 A;  2LRS A;  2L3C A;  2JOX A;  1UIL A;  4DR2 E;  2EM0 A;  2VE7 C;  1DI2 A;  2DMY A;  5TSE A;  1WHN A;  1PKP A;  2L6M A;  4X66 E;  1AH5 A;  5DNY A;  4JI3 E;  1DQ3 A;  1STU A;  2EOQ A;  4JYA E;  4WX9 A;  4L5N C;  1XNQ E;  5CFF E;  1IBM E;  1AAY A;  4WSP A;  1X48 A;  4WSG A;  1ZBT A;  3KZZ A;  1RC7 A;  4BBY A;  5AC5 A;  4ZYG A;  2LTR A;  1N32 E;  2N3H A;  5KL5 A;  2E1M A;  4DR3 E;  4O5G A;  2YTO A;  1A1K A;  1DGC A;  2JPA A;  2MC6 A;  5KL2 A;  1YFH A;  4FK5 C;  2ENA A;  4LTY A;  4B3M E;  4B3R E;  2EQ1 A;  2YRH A;  3EPH A;  4NHR A;  5IWA E;  1FKA E;  2R1F A;  4DV2 E;  2B3T B;  3VYY A;  2YRM A;  4HTG A;  4DV7 E;  1I94 E;  1TN9 A;  2NA2 A;  1UBD C;  4O24 A;  4R2A A;  1PJS A;  1X47 A;  2YTI A;  2EWL A;  2EMZ A;  2EJ4 A;  2UU9 E;  1EH7 A;  3MHS C;  4YY3 E;  5A6J A;  3VK6 A;  2YTQ A;  2VQE E;  4LF7 E;  4O43 A;  4JI4 E;  1HR0 E;  4BC9 A;  3IWC A;  5KL6 A;  3MSW A;  2EMC A;  4LFC E;  2HJJ A;  1QNT A;  2V89 A;  4WFT A;  2FGG A;  2EN3 A;  2EMA A;  1WRJ A;  4M9V C;  2EN6 A;  4R2D A;  4TUG A;  2I9I A;  2M9A A;  2EL5 A;  2EMH A;  1GTK A;  2EML A;  4WYQ B;  4DKK A;  4DR5 E;  3EPJ A;  4JI1 E;  5LL6 R;  4F9A B;  4R8O A;  2EL4 A;  4M0V A;  2L33 A;  1QU6 A;  2BBG A;  3JTZ A;  4M2Z A;  2IHR 1;  4BHB A;  1BBO A;  1B69 A;  4P78 A; 
#chains in the Genus database with same CATH homology
 2RS7 A;  1T4L B;  1IBL E;  5AE3 A;  4X8W A;  4JI2 E;  4NXN E;  2RS6 A;  3J81 C;  2KHX A;  2UUA E;  2H36 X;  3DF6 A;  2LRS A;  2L3C A;  2JOX A;  5ADZ A;  1UIL A;  2ODR D;  4R03 A;  2NUE A;  1HNX E;  4DR2 E;  4DV1 E;  2VE7 C;  3IWB A;  4LF9 E;  2DMY A;  2K4V A;  1DI2 A;  1WHN A;  2V8Q B;  4DR4 E;  1PKP A;  2L6M A;  3ZOQ B;  4DUZ E;  4X64 E;  3KWR A;  3F6G A;  1UHZ A;  2LE2 A;  4BCA A;  4X66 E;  5A2Q C;  4TUI A;  1EKZ A;  4LF5 E;  5DNY A;  4JI3 E;  4X62 E;  1XNR E;  2FTX B;  1IBK E;  1DQ3 A;  1STU A;  4DV6 E;  4JYA E;  4YHH E;  1N33 E;  2UXD E;  2B9D A;  4OOG C;  5IT9 C;  4GKJ E;  2M1S A;  4L5N C;  5CFF E;  1IBM E;  2N3G A;  5LMU E;  1XNQ E;  4DR7 E;  4F54 A;  4LFB E;  5F3W A;  4WSP A;  1X48 A;  3C4T A;  4JI7 E;  1ZBT A;  1RC7 A;  4BBY A;  1ZBQ A;  2ODR C;  2DB2 A;  1T4O A;  1GZ6 A;  2LTR A;  3T1Y E;  1N32 E;  5AE1 A;  4GKK E;  2N3H A;  2E1M A;  4DR3 E;  1O0W A;  3OML A;  4NXM E;  4JI8 E;  3DJW A;  2MC6 A;  1XMO E;  4DV3 E;  4M30 A;  2DIX A;  2KOU A;  4LTY A;  4AQY E;  1N36 E;  2F8B A;  4B3M E;  2E5L E;  4DR1 E;  3T1H E;  4B3R E;  2L2N A;  2VQF E;  4GEQ B;  4DUY E;  2UUC E;  2RSM A;  4WPY A;  5IWA E;  3C4B A;  1FKA E;  2EZ6 A;  3LML A;  1T4N A;  2FV4 B;  2B3T B;  2JWO A;  3VYY A;  4Q28 A;  4DV2 E;  4LF6 E;  5AE2 A;  3J7A G;  4DV7 E;  4JI0 E;  1J5E E;  5AAS A;  1J26 A;  3VYX A;  2B7T A;  1XMQ E;  3K6Q A;  1I94 E;  2JOB A;  2F4V E;  2NA2 A;  3F6H A;  4K0K E;  2KON A;  4OX9 E;  2LBS B;  4DV0 E;  4X65 E;  3RMP A;  2DSY A;  3LLH A;  1X47 A;  5LMN E;  4LFA E;  2MC5 A;  1HNW E;  2L2K B;  2EWL A;  2L92 A;  2L3J A;  1HNZ E;  4I8O A;  2UU9 E;  2LTS A;  4JI6 E;  1WHQ A;  1FJG E;  1YYO A;  4YY3 E;  3ADL A;  3VK6 A;  4BS9 A;  3OTO E;  1N34 E;  4F9B B;  2VQE E;  4LF8 E;  1RQ0 A;  5BR8 E;  2NUF A;  4B3T E;  4JI5 E;  4LF7 E;  1YYK A;  2CPN A;  2UXB E;  3AV0 A;  2UXC E;  4JI4 E;  2JY9 A;  2M7Q A;  2G7H A;  3HXL A;  3H09 A;  2M4I A;  4BC7 A;  4BC9 A;  3FIG A;  3IWC A;  3MSW A;  1HR0 E;  2JVA A;  4P7D A;  3HTX A;  4LFC E;  5T6J A;  4DV4 E;  2HHH E;  4JV5 E;  3HPS A;  4LU9 A;  2ZM6 E;  2L2M A;  2V89 A;  4WFT A;  2FGG A;  2JR1 A;  2YT4 A;  2V88 A;  2LUQ A;  2RTX A;  3IWD A;  3HQ1 A;  4L8N A;  4DMI A;  4LF4 E;  1YYW A;  2MDR A;  4TUG A;  1GQE A;  5FLX C;  3J80 C;  2WZO A;  4B3S E;  2L8T A;  3J7Y p;  1SR9 A;  2B7V A;  2LJH A;  3HPZ A;  2V83 A;  3ADJ A;  4WYQ B;  4DKK A;  4DV5 E;  4DR5 E;  1X49 A;  4JI1 E;  4BMJ A;  2V86 A;  4KZS A;  5LL6 R;  4F9A B;  2V87 A;  4R8O A;  3P1X A;  2LUP B;  3JAM C;  3AUZ A;  2YZT A;  4M0V A;  2UUB E;  2L33 A;  1QU6 A;  3JU0 A;  2LMZ A;  3JTZ A;  4J8Z A;  4M2Z A;  1WXR A;  2VF1 A;  2NUG A;  2IHR 1;  3ADG A;  4KHP E;  2V85 A;  4F9C B;  3ADI A;  1YZ9 A;  4DR6 E;  4P78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...