1X49A

Solution structure of the first dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
97
structure length
97
Chain Sequence
GSSGSSGMASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAKGRSKQEARNAAAKLAVDILDNENKVDCHTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-induced, double-stranded RNA-activated protein ki
publication title Solution structure of the first DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 18
structure length 97
sequence length 97
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x49A01
3T1HE 2EZ6A 1I94E 2N3GA 4LF8E 5IWAE 2UU9E 3ADGA 1YYOA 1IBLE 4YHHE 4JI3E 2RS7A 3P1XA 4AQYE 1XNRE 1RQ0A 1N33E 4OOGC 2LTSA 1HNZE 1XMQE 4DUYE 2YT4A 4GKJE 2NA2A 4DR5E 1HR0E 2L2KB 1FKAE 4X8WA 4B3ME 4DV4E 1IBME 2F4VE 4DR4E 4DV0E 4DV7E 2KHXA 2LUQA 4JI2E 2CPNA 2L2MA 4JI5E 4X65E 3T1YE 2LTRA 4X66E 3J7Yp 1YYKA 1YYWA 2LJHA 2RS6A 2B7VA 2VQEE 1RC7A 2JVAA 2RSMA 4YY3E 4DV2E 2UXBE 2L33A 1XNQE 1DI2A 2L3JA 4X62E 2B3TB 4LF6E 4B3RE 2L2NA 2LBSB 1T4NA 4DR6E 4DR2E 1N36E 2IHR1 2JY9A 4DV5E 4B3TE 1GQEA 1UHZA 2HHHE 4LF5E 1XMOE 4JI4E 2NUGA 5LMNE 4NXME 1N32E 2VQFE 1QU6A 4DV3E 2E5LE 1STUA 1UILA 4DUZE 4M2ZA 1IBKE 4LFAE 4LF7E 1WHNA 4OX9E 3HTXA 1HNWE 4KHPE 4DR3E 2LUPB 4B3SE 4K0KE 3VYXA 1HNXE 4GKKE 3ADLA 4LF9E 2NUEA 3ADJA 4NXNE 1FJGE 1X49A 2MDRA 4JI8E 1T4LB 4X64E 4WFTA 4WYQB 4JI6E 1PKPA 2LRSA 2DMYA 1EKZA 4DV1E 2RTXA 3ADIA 2DIXA 4DV6E 1J5EE 3C4TA 5CFFE 5BR8E 1WHQA 2UUCE 4DR7E 2UXDE 4LFBE 4M30A 4JYAE 3C4BA 4JI0E 1YZ9A 3VYYA 4LF4E 2N3HA 2UUBE 3OTOE 1X48A 1N34E 2NUFA 2ZM6E 2DB2A 2UXCE 2L3CA 1X47A 4JI1E 4JV5E 1J26A 1ZBTA 4LFCE 2B7TA 4DKKA 1O0WA 2UUAE 4DR1E 4JI7E 5LMUE 3LLHA 1T4OA
chains in the Genus database with same CATH superfamily
4O4KA 5KL4A 4R2EA 3T1HE 1A1KA 4Q28A 5A69A 3AUZA 2EOMA 5IT9C 2EM2A 2EPZA 2HC5A 1YPNA 1GTKA 2LTSA 1KYQA 2DMIA 1XMQE 2F8BA 2DSYA 2VE7C 4DR5E 2EJ4A 3F6HA 2EMZA 2RSIA 2CSHA 2YTGA 4B3ME 2YSPA 2LVHA 4DV0E 4DV7E 1DGCA 1X5WA 2KHXA 2LUQA 3BIDA 4JI2E 2CPNA 2YWQA 3LMLA 2V85A 1YFHA 2L8TA 2JR1A 5LL6R 3IWBA 2ODRC 4F9BB 2VF1A 2LTRA 3TQMA 3J7Yp 1BBOA 2EPMX 2B7VA 2BB8A 2VQEE 1RC7A 2RSMA 3HPSA 5LLQA 2EOQA 4RHBB 4X62E 3BF2A 1X3CA 4DV5E 2EN8A 2EMBA 4R2CA 2EMGA 2EM8A 4X9JA 4LF5E 2EM0A 2JOBA 2LE2A 1XMOE 5ADZA 4NXME 3H09A 4LU9A 2HJJA 2MC6A 1QU6A 5F3WA 2EMAA 2EMXA 4DUZE 2ODRD 4ZYHA 5AE3A 1WJPA 1WHNA 2EOXA 5DNYA 4L5NC 1WRJA 2EM5A 4DR3E 4B3SE 4GKKE 4I8OA 2MDGA 2NUEA 4M9VC 2LV2A 1FJGE 2MDRA 1PDAA 2ENAA 4WXDA 2JYAA 2V86A 1PKPA 2EPPA 2LRSA 3MHHC 4DV1E 2GPIA 3AV0A 2V88A 5CFFE 2CTDA 3ZOQB 2UUCE 1PJQA 4DR7E 2UXDE 4J8ZA 1GZ6A 2EM4A 2YTJA 1NEIA 2YTEA 2YTPA 1YZ9A 2YRMA 3M99B 1G2DC 3DJWA 1X48A 4TUIA 5A6JA 1NCSA 2D9HA 2LO3A 1ZBTA 2WCC3 4LFCE 4MLQA 4GEQB 3LLHA 1T4OA 2N3GA 5IWAE 2UU9E 3ADGA 2M4IA 4WPYA 2EOEA 1IBLE 4YHHE 4Q35B 5IV8B 2EM7A 4BS9A 2EOOA 4AQYE 1RQ0A 4OOGC 1SFEA 3FIGA 4GKJE 5AASA 1YSAC 4DR4E 4O43A 1PJTA 4BBYA 1X6HA 3JU0A 1X6EA 2ADRA 2EOYA 4WSGA 4N4RB 4X65E 2EQ0A 1A1JA 2M1SA 1UBDC 2A25A 2EPAA 2RS6A 4IJDA 2JVAA 2EWLA 5KL5A 4F6NA 4RH8A 3QG5C 4YY3E 4F9CB 2UXBE 1N3GA 2L33A 1XNQE 2JP9A 4F2JC 1T4NA 1G2FC 2L6MA 1N36E 2JY9A 5KL3A 4B3TE 1ZR9A 3MHSC 2V8QB 3IWDA 4BCAA 4JI4E 2NUGA 4NZVA 2PRTA 2LMZA 1UILA 2K7IA 2RQLA 2JXPA 1IMUA 2VRDA 4WX9A 1EH6A 2LUPB 4K0KE 3K6QA 3J81C 4ZYDA 2L92A 2I9IA 4R2QA 3J7AG 3ADJA 2EPLX 2EQ1A 3VK6A 3L00A 3EPKA 3MSWA 2EPNA 2ELZA 4WSPA 4WYQB 2EN6A 2EOSA 2EPRA 4F6MA 4F9AB 2DIXA 4DV6E 3C4TA 3BBGA 1WXRA 1BB8A 4M30A 4JYAE 3C4BA 2YTDA 5AC4A 4KWYA 4IS1C 5TSEA 4LTYA 5AE2A 2M7QA 2GHFA 2I13A 3THNA 1J26A 5A6BD 1AH5A 2B7TA 1ZU1A 4JI7E 4DMIA 4HEIA 2EMYA 4DR6E 2YSOA 4R8OA 3J80C 2YPNA 3EPLA 3EQ1A 2V87A 2DLKA 1YYOA 2WBSA 4R2PA 3OMLA 1XNRE 4R2AA 2YZTA 4DUYE 5A6AA 3HXLA 2BBGA 2NA2A 2EL6A 1TF3A 1HR0E 2L2KB 2EN7A 2EMWA 4DV4E 1IQSA 2EOJA 2LJUA 2EMHA 1SR9A 2EPUA 2DLQA 4JI5E 3T1YE 2YRHA 1YUIA 1YYWA 1YYKA 2FGGA 5A2QC 4FK5C 2EOFA 1JK1A 2LCEA 4DV2E 3BGHA 4R2RA 2RPCA 4B3RE 2B3TB 1MEYC 2LBSB 4GZNC 2IHR1 4BC7A 2WZOA 2EL4A 1EH7A 1GQEA 1UHZA 2EM9A 2HHHE 2EN2A 2EOHA 2Q8UA 2YTIA 1T38A 3HQ1A 2HGHA 4BHCA 3DF6A 3UK3C 1A1FA 3EPJA 2JWOA 2CT1A 1N32E 2EMKA 4KZSA 3F6GA 4DV3E 2E5LE 1B69A 4OX9E 4R2DA 3HTXA 3EPHA 1HNWE 2EMIA 3VYXA 1P47A 3ADLA 2EN1A 4LF9E 2E1MA 2EMLA 2EM6A 4NXNE 5AE1A 1X49A 2WBTA 4JI8E 2EM3A 1EH8A 4X64E 4JI6E 3C6KA 4BMJA 2DRPA 2DMYA 2EOZA 1EKZA 3ADIA 1J5EE 2YTNA 2R76A 1LLMC 4F54A 1YUJA 1WHQA 1QNTA 3ECRA 4LFBE 3JTZA 1A1HA 2EPOA 3VYYA 3KZZA 2EQ3A 4LF4E 2N3HA 2UUBE 3OTOE 1N34E 2NUFA 5FLXC 2UXCE 4JV5E 1JK2A 3HPZA 1RMDA 3VHTB 1Z1BA 1TN9A 1O0WA 1IQOA 1KJKA 4DR1E 5LMUE 2EZ6A 1I94E 2KOUA 4LF8E 5AC5A 1DQ3A 2YU8A 1X6FA 5A6BA 4JI3E 2RS7A 2LT7A 3P1XA 1ZAAC 1N33E 2NABA 5A6KA 1HNZE 4BC9A 2V89A 4ZYGA 2YT4A 3C6MA 2EMFA 2MC5A 1FKAE 4X8WA 1IBME 1TF6A 2F4VE 2JOXA 2GLIA 5KL6A 4MLVA 1BBGA 2L2MA 4WXCA 2YU5A 2ENCA 2EE8A 4HTGA 5KL2A 4X66E 2FTXB 3THOB 2EN3A 2EPCA 2LJHA 4P78A 2M9AA 2EPXA 4TUGA 2R1FA 4O5GA 2B9DA 1DI2A 2L3JA 4LF6E 2G7HA 2L2NA 1UN6B 2YRKA 4R2SA 4DR2E 3KWRA 2YTQA 2EL5A 1PJSA 4R03A 4M0VA 4BHBA 5LMNE 2N8XA 5IXMB 2VQFE 2YTFA 4O24A 2KONA 1STUA 2FV4B 4M2ZA 1IBKE 4LFAE 4LF7E 4KHPE 2DGCA 1F2IG 2H36X 2EP3A 1HNXE 3RMPA 4NHRA 4ZYEA 3JAMC 1A1LA 1T4LB 2EOIA 4WFTA 2EORA 4L8NA 2EPKX 2RTXA 3IWCA 1A1IA 2EN4A 5BR8E 2MKDA 2K4VA 2WBUA 3KZYA 2J7JA 1A1GA 5KL7A 1ZBQA 4JI0E 2MKNA 2ENHA 2JPAA 2EMCA 1T39A 1L4SA 2ZM6E 2DB2A 2YTOA 1X47A 2L3CA 4JI1E 1MGTA 2E72A 5T6JA 2ELYA 2V83A 4P7DA 4DKKA 2UUAE 1AAYA
chains in the Genus database with same CATH topology
4R8OA 4DMIA 3J80C 3T1HE 1I94E 4Q28A 2EZ6A 2N3GA 2KOUA 4LF8E 2V87A 3AUZA 5IWAE 3ADGA 2UU9E 1YYOA 1DQ3A 2M4IA 5IT9C 4WPYA 1IBLE 4YHHE 4JI3E 2RS7A 3OMLA 3P1XA 4BS9A 4AQYE 1XNRE 1RQ0A 1N33E 4OOGC 2YZTA 2LTSA 1HNZE 4BC9A 2V89A 1XMQE 4DUYE 3FIGA 2F8BA 2DSYA 3HXLA 2VE7C 2YT4A 2NA2A 4GKJE 4DR5E 3F6HA 5AASA 1HR0E 2L2KB 2MC5A 1FKAE 4X8WA 4B3ME 4DV4E 1IBME 2F4VE 4DR4E 2JOXA 4DV0E 4BBYA 4DV7E 2KHXA 3JU0A 2LUQA 4JI2E 2CPNA 2L2MA 1SR9A 2V85A 3LMLA 2L8TA 2JR1A 5LL6R 3IWBA 2ODRC 4F9BB 4JI5E 4X65E 2VF1A 3T1YE 2LTRA 2M1SA 4X66E 2FTXB 3J7Yp 1YYKA 1YYWA 2LJHA 4P78A 2RS6A 2B7VA 2FGGA 2VQEE 5A2QC 1RC7A 2JVAA 2RSMA 2EWLA 3HPSA 4TUGA 4YY3E 4DV2E 4F9CB 2UXBE 2L33A 2B9DA 1XNQE 1DI2A 2L3JA 4X62E 2B3TB 4LF6E 2G7HA 2L2NA 2LBSB 1T4NA 4B3RE 4DR6E 2L6MA 4DR2E 1N36E 2IHR1 4BC7A 3KWRA 2JY9A 2WZOA 4DV5E 4R03A 4B3TE 1GQEA 1UHZA 2HHHE 3HQ1A 2V8QB 4M0VA 4LF5E 2JOBA 2LE2A 3DF6A 1XMOE 3IWDA 5ADZA 4BCAA 2JWOA 4JI4E 2NUGA 5LMNE 4NXME 3H09A 1N32E 2VQFE 2LMZA 4LU9A 2MC6A 4KZSA 1QU6A 5F3WA 3F6GA 4DV3E 2E5LE 2KONA 1STUA 1UILA 2FV4B 4DUZE 2ODRD 4M2ZA 5AE3A 1IBKE 4LFAE 4LF7E 1WHNA 4OX9E 5DNYA 3HTXA 4L5NC 1HNWE 4KHPE 4DR3E 2LUPB 2H36X 4B3SE 3VYXA 3K6QA 3J81C 1HNXE 4K0KE 3RMPA 4GKKE 2L92A 4I8OA 3ADLA 4LF9E 2NUEA 2E1MA 3J7AG 3ADJA 4NXNE 3VK6A 5AE1A 1FJGE 1X49A 2MDRA 3JAMC 3MSWA 4JI8E 1T4LB 4WSPA 4X64E 4WFTA 4WYQB 4JI6E 2V86A 4BMJA 1PKPA 2LRSA 2DMYA 4L8NA 1EKZA 4DV1E 2RTXA 3AV0A 3IWCA 2DIXA 4F9AB 2V88A 4DV6E 1J5EE 3C4TA 3ADIA 5CFFE 4F54A 5BR8E 1WHQA 3ZOQB 1WXRA 2UUCE 4J8ZA 1GZ6A 4DR7E 2K4VA 2UXDE 4LFBE 4M30A 4JYAE 3C4BA 1ZBQA 3JTZA 4JI0E 1YZ9A 3VYYA 3DJWA 4LF4E 2N3HA 2UUBE 4LTYA 1X48A 4TUIA 3OTOE 1N34E 5AE2A 2NUFA 2ZM6E 2DB2A 2M7QA 5FLXC 2UXCE 2L3CA 1X47A 4JI1E 4JV5E 3HPZA 1J26A 1ZBTA 5T6JA 4LFCE 2B7TA 2V83A 4P7DA 1O0WA 4DKKA 4GEQB 4DR1E 2UUAE 4JI7E 5LMUE 3LLHA 1T4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H E;  2EZ6 A;  1I94 E;  2N3G A;  4LF8 E;  5IWA E;  2UU9 E;  3ADG A;  1YYO A;  1IBL E;  4YHH E;  4JI3 E;  2RS7 A;  3P1X A;  4AQY E;  1XNR E;  1RQ0 A;  1N33 E;  4OOG C;  2LTS A;  1HNZ E;  1XMQ E;  4DUY E;  2YT4 A;  4GKJ E;  2NA2 A;  4DR5 E;  1HR0 E;  2L2K B;  1FKA E;  4X8W A;  4B3M E;  4DV4 E;  1IBM E;  2F4V E;  4DR4 E;  4DV0 E;  4DV7 E;  2KHX A;  2LUQ A;  4JI2 E;  2CPN A;  2L2M A;  4JI5 E;  4X65 E;  3T1Y E;  2LTR A;  4X66 E;  3J7Y p;  1YYK A;  1YYW A;  2LJH A;  2RS6 A;  2B7V A;  2VQE E;  1RC7 A;  2JVA A;  2RSM A;  4YY3 E;  4DV2 E;  2UXB E;  2L33 A;  1XNQ E;  1DI2 A;  2L3J A;  4X62 E;  2B3T B;  4LF6 E;  4B3R E;  2L2N A;  2LBS B;  1T4N A;  4DR6 E;  4DR2 E;  1N36 E;  2IHR 1;  2JY9 A;  4DV5 E;  4B3T E;  1GQE A;  1UHZ A;  2HHH E;  4LF5 E;  1XMO E;  4JI4 E;  2NUG A;  5LMN E;  4NXM E;  1N32 E;  2VQF E;  1QU6 A;  4DV3 E;  2E5L E;  1STU A;  1UIL A;  4DUZ E;  4M2Z A;  1IBK E;  4LFA E;  4LF7 E;  1WHN A;  4OX9 E;  3HTX A;  1HNW E;  4KHP E;  4DR3 E;  2LUP B;  4B3S E;  4K0K E;  3VYX A;  1HNX E;  4GKK E;  3ADL A;  4LF9 E;  2NUE A;  3ADJ A;  4NXN E;  1FJG E;  1X49 A;  2MDR A;  4JI8 E;  1T4L B;  4X64 E;  4WFT A;  4WYQ B;  4JI6 E;  1PKP A;  2LRS A;  2DMY A;  1EKZ A;  4DV1 E;  2RTX A;  3ADI A;  2DIX A;  4DV6 E;  1J5E E;  3C4T A;  5CFF E;  5BR8 E;  1WHQ A;  2UUC E;  4DR7 E;  2UXD E;  4LFB E;  4M30 A;  4JYA E;  3C4B A;  4JI0 E;  1YZ9 A;  3VYY A;  4LF4 E;  2N3H A;  2UUB E;  3OTO E;  1X48 A;  1N34 E;  2NUF A;  2ZM6 E;  2DB2 A;  2UXC E;  2L3C A;  1X47 A;  4JI1 E;  4JV5 E;  1J26 A;  1ZBT A;  4LFC E;  2B7T A;  4DKK A;  1O0W A;  2UUA E;  4DR1 E;  4JI7 E;  5LMU E;  3LLH A;  1T4O A; 
#chains in the Genus database with same CATH topology
 4O4K A;  5KL4 A;  4R2E A;  3T1H E;  1A1K A;  4Q28 A;  5A69 A;  3AUZ A;  2EOM A;  5IT9 C;  2EM2 A;  2EPZ A;  2HC5 A;  1YPN A;  1GTK A;  2LTS A;  1KYQ A;  2DMI A;  1XMQ E;  2F8B A;  2DSY A;  2VE7 C;  4DR5 E;  2EJ4 A;  3F6H A;  2EMZ A;  2RSI A;  2CSH A;  2YTG A;  4B3M E;  2YSP A;  2LVH A;  4DV0 E;  4DV7 E;  1DGC A;  1X5W A;  2KHX A;  2LUQ A;  3BID A;  4JI2 E;  2CPN A;  2YWQ A;  3LML A;  2V85 A;  1YFH A;  2L8T A;  2JR1 A;  5LL6 R;  3IWB A;  2ODR C;  4F9B B;  2VF1 A;  2LTR A;  3TQM A;  3J7Y p;  1BBO A;  2EPM X;  2B7V A;  2BB8 A;  2VQE E;  1RC7 A;  2RSM A;  3HPS A;  5LLQ A;  2EOQ A;  4RHB B;  4X62 E;  3BF2 A;  1X3C A;  4DV5 E;  2EN8 A;  2EMB A;  4R2C A;  2EMG A;  2EM8 A;  4X9J A;  4LF5 E;  2EM0 A;  2JOB A;  2LE2 A;  1XMO E;  5ADZ A;  4NXM E;  3H09 A;  4LU9 A;  2HJJ A;  2MC6 A;  1QU6 A;  5F3W A;  2EMA A;  2EMX A;  4DUZ E;  2ODR D;  4ZYH A;  5AE3 A;  1WJP A;  1WHN A;  2EOX A;  5DNY A;  4L5N C;  1WRJ A;  2EM5 A;  4DR3 E;  4B3S E;  4GKK E;  4I8O A;  2MDG A;  2NUE A;  4M9V C;  2LV2 A;  1FJG E;  2MDR A;  1PDA A;  2ENA A;  4WXD A;  2JYA A;  2V86 A;  1PKP A;  2EPP A;  2LRS A;  3MHH C;  4DV1 E;  2GPI A;  3AV0 A;  2V88 A;  5CFF E;  2CTD A;  3ZOQ B;  2UUC E;  1PJQ A;  4DR7 E;  2UXD E;  4J8Z A;  1GZ6 A;  2EM4 A;  2YTJ A;  1NEI A;  2YTE A;  2YTP A;  1YZ9 A;  2YRM A;  3M99 B;  1G2D C;  3DJW A;  1X48 A;  4TUI A;  5A6J A;  1NCS A;  2D9H A;  2LO3 A;  1ZBT A;  2WCC 3;  4LFC E;  4MLQ A;  4GEQ B;  3LLH A;  1T4O A;  2N3G A;  5IWA E;  2UU9 E;  3ADG A;  2M4I A;  4WPY A;  2EOE A;  1IBL E;  4YHH E;  4Q35 B;  5IV8 B;  2EM7 A;  4BS9 A;  2EOO A;  4AQY E;  1RQ0 A;  4OOG C;  1SFE A;  3FIG A;  4GKJ E;  5AAS A;  1YSA C;  4DR4 E;  4O43 A;  1PJT A;  4BBY A;  1X6H A;  3JU0 A;  1X6E A;  2ADR A;  2EOY A;  4WSG A;  4N4R B;  4X65 E;  2EQ0 A;  1A1J A;  2M1S A;  1UBD C;  2A25 A;  2EPA A;  2RS6 A;  4IJD A;  2JVA A;  2EWL A;  5KL5 A;  4F6N A;  4RH8 A;  3QG5 C;  4YY3 E;  4F9C B;  2UXB E;  1N3G A;  2L33 A;  1XNQ E;  2JP9 A;  4F2J C;  1T4N A;  1G2F C;  2L6M A;  1N36 E;  2JY9 A;  5KL3 A;  4B3T E;  1ZR9 A;  3MHS C;  2V8Q B;  3IWD A;  4BCA A;  4JI4 E;  2NUG A;  4NZV A;  2PRT A;  2LMZ A;  1UIL A;  2K7I A;  2RQL A;  2JXP A;  1IMU A;  2VRD A;  4WX9 A;  1EH6 A;  2LUP B;  4K0K E;  3K6Q A;  3J81 C;  4ZYD A;  2L92 A;  2I9I A;  4R2Q A;  3J7A G;  3ADJ A;  2EPL X;  2EQ1 A;  3VK6 A;  3L00 A;  3EPK A;  3MSW A;  2EPN A;  2ELZ A;  4WSP A;  4WYQ B;  2EN6 A;  2EOS A;  2EPR A;  4F6M A;  4F9A B;  2DIX A;  4DV6 E;  3C4T A;  3BBG A;  1WXR A;  1BB8 A;  4M30 A;  4JYA E;  3C4B A;  2YTD A;  5AC4 A;  4KWY A;  4IS1 C;  5TSE A;  4LTY A;  5AE2 A;  2M7Q A;  2GHF A;  2I13 A;  3THN A;  1J26 A;  5A6B D;  1AH5 A;  2B7T A;  1ZU1 A;  4JI7 E;  4DMI A;  4HEI A;  2EMY A;  4DR6 E;  2YSO A;  4R8O A;  3J80 C;  2YPN A;  3EPL A;  3EQ1 A;  2V87 A;  2DLK A;  1YYO A;  2WBS A;  4R2P A;  3OML A;  1XNR E;  4R2A A;  2YZT A;  4DUY E;  5A6A A;  3HXL A;  2BBG A;  2NA2 A;  2EL6 A;  1TF3 A;  1HR0 E;  2L2K B;  2EN7 A;  2EMW A;  4DV4 E;  1IQS A;  2EOJ A;  2LJU A;  2EMH A;  1SR9 A;  2EPU A;  2DLQ A;  4JI5 E;  3T1Y E;  2YRH A;  1YUI A;  1YYW A;  1YYK A;  2FGG A;  5A2Q C;  4FK5 C;  2EOF A;  1JK1 A;  2LCE A;  4DV2 E;  3BGH A;  4R2R A;  2RPC A;  4B3R E;  2B3T B;  1MEY C;  2LBS B;  4GZN C;  2IHR 1;  4BC7 A;  2WZO A;  2EL4 A;  1EH7 A;  1GQE A;  1UHZ A;  2EM9 A;  2HHH E;  2EN2 A;  2EOH A;  2Q8U A;  2YTI A;  1T38 A;  3HQ1 A;  2HGH A;  4BHC A;  3DF6 A;  3UK3 C;  1A1F A;  3EPJ A;  2JWO A;  2CT1 A;  1N32 E;  2EMK A;  4KZS A;  3F6G A;  4DV3 E;  2E5L E;  1B69 A;  4OX9 E;  4R2D A;  3HTX A;  3EPH A;  1HNW E;  2EMI A;  3VYX A;  1P47 A;  3ADL A;  2EN1 A;  4LF9 E;  2E1M A;  2EML A;  2EM6 A;  4NXN E;  5AE1 A;  1X49 A;  2WBT A;  4JI8 E;  2EM3 A;  1EH8 A;  4X64 E;  4JI6 E;  3C6K A;  4BMJ A;  2DRP A;  2DMY A;  2EOZ A;  1EKZ A;  3ADI A;  1J5E E;  2YTN A;  2R76 A;  1LLM C;  4F54 A;  1YUJ A;  1WHQ A;  1QNT A;  3ECR A;  4LFB E;  3JTZ A;  1A1H A;  2EPO A;  3VYY A;  3KZZ A;  2EQ3 A;  4LF4 E;  2N3H A;  2UUB E;  3OTO E;  1N34 E;  2NUF A;  5FLX C;  2UXC E;  4JV5 E;  1JK2 A;  3HPZ A;  1RMD A;  3VHT B;  1Z1B A;  1TN9 A;  1O0W A;  1IQO A;  1KJK A;  4DR1 E;  5LMU E;  2EZ6 A;  1I94 E;  2KOU A;  4LF8 E;  5AC5 A;  1DQ3 A;  2YU8 A;  1X6F A;  5A6B A;  4JI3 E;  2RS7 A;  2LT7 A;  3P1X A;  1ZAA C;  1N33 E;  2NAB A;  5A6K A;  1HNZ E;  4BC9 A;  2V89 A;  4ZYG A;  2YT4 A;  3C6M A;  2EMF A;  2MC5 A;  1FKA E;  4X8W A;  1IBM E;  1TF6 A;  2F4V E;  2JOX A;  2GLI A;  5KL6 A;  4MLV A;  1BBG A;  2L2M A;  4WXC A;  2YU5 A;  2ENC A;  2EE8 A;  4HTG A;  5KL2 A;  4X66 E;  2FTX B;  3THO B;  2EN3 A;  2EPC A;  2LJH A;  4P78 A;  2M9A A;  2EPX A;  4TUG A;  2R1F A;  4O5G A;  2B9D A;  1DI2 A;  2L3J A;  4LF6 E;  2G7H A;  2L2N A;  1UN6 B;  2YRK A;  4R2S A;  4DR2 E;  3KWR A;  2YTQ A;  2EL5 A;  1PJS A;  4R03 A;  4M0V A;  4BHB A;  5LMN E;  2N8X A;  5IXM B;  2VQF E;  2YTF A;  4O24 A;  2KON A;  1STU A;  2FV4 B;  4M2Z A;  1IBK E;  4LFA E;  4LF7 E;  4KHP E;  2DGC A;  1F2I G;  2H36 X;  2EP3 A;  1HNX E;  3RMP A;  4NHR A;  4ZYE A;  3JAM C;  1A1L A;  1T4L B;  2EOI A;  4WFT A;  2EOR A;  4L8N A;  2EPK X;  2RTX A;  3IWC A;  1A1I A;  2EN4 A;  5BR8 E;  2MKD A;  2K4V A;  2WBU A;  3KZY A;  2J7J A;  1A1G A;  5KL7 A;  1ZBQ A;  4JI0 E;  2MKN A;  2ENH A;  2JPA A;  2EMC A;  1T39 A;  1L4S A;  2ZM6 E;  2DB2 A;  2YTO A;  1X47 A;  2L3C A;  4JI1 E;  1MGT A;  2E72 A;  5T6J A;  2ELY A;  2V83 A;  4P7D A;  4DKK A;  2UUA E;  1AAY A; 
#chains in the Genus database with same CATH homology
 4R8O A;  4DMI A;  3J80 C;  3T1H E;  1I94 E;  4Q28 A;  2EZ6 A;  2N3G A;  2KOU A;  4LF8 E;  2V87 A;  3AUZ A;  5IWA E;  3ADG A;  2UU9 E;  1YYO A;  1DQ3 A;  2M4I A;  5IT9 C;  4WPY A;  1IBL E;  4YHH E;  4JI3 E;  2RS7 A;  3OML A;  3P1X A;  4BS9 A;  4AQY E;  1XNR E;  1RQ0 A;  1N33 E;  4OOG C;  2YZT A;  2LTS A;  1HNZ E;  4BC9 A;  2V89 A;  1XMQ E;  4DUY E;  3FIG A;  2F8B A;  2DSY A;  3HXL A;  2VE7 C;  2YT4 A;  2NA2 A;  4GKJ E;  4DR5 E;  3F6H A;  5AAS A;  1HR0 E;  2L2K B;  2MC5 A;  1FKA E;  4X8W A;  4B3M E;  4DV4 E;  1IBM E;  2F4V E;  4DR4 E;  2JOX A;  4DV0 E;  4BBY A;  4DV7 E;  2KHX A;  3JU0 A;  2LUQ A;  4JI2 E;  2CPN A;  2L2M A;  1SR9 A;  2V85 A;  3LML A;  2L8T A;  2JR1 A;  5LL6 R;  3IWB A;  2ODR C;  4F9B B;  4JI5 E;  4X65 E;  2VF1 A;  3T1Y E;  2LTR A;  2M1S A;  4X66 E;  2FTX B;  3J7Y p;  1YYK A;  1YYW A;  2LJH A;  4P78 A;  2RS6 A;  2B7V A;  2FGG A;  2VQE E;  5A2Q C;  1RC7 A;  2JVA A;  2RSM A;  2EWL A;  3HPS A;  4TUG A;  4YY3 E;  4DV2 E;  4F9C B;  2UXB E;  2L33 A;  2B9D A;  1XNQ E;  1DI2 A;  2L3J A;  4X62 E;  2B3T B;  4LF6 E;  2G7H A;  2L2N A;  2LBS B;  1T4N A;  4B3R E;  4DR6 E;  2L6M A;  4DR2 E;  1N36 E;  2IHR 1;  4BC7 A;  3KWR A;  2JY9 A;  2WZO A;  4DV5 E;  4R03 A;  4B3T E;  1GQE A;  1UHZ A;  2HHH E;  3HQ1 A;  2V8Q B;  4M0V A;  4LF5 E;  2JOB A;  2LE2 A;  3DF6 A;  1XMO E;  3IWD A;  5ADZ A;  4BCA A;  2JWO A;  4JI4 E;  2NUG A;  5LMN E;  4NXM E;  3H09 A;  1N32 E;  2VQF E;  2LMZ A;  4LU9 A;  2MC6 A;  4KZS A;  1QU6 A;  5F3W A;  3F6G A;  4DV3 E;  2E5L E;  2KON A;  1STU A;  1UIL A;  2FV4 B;  4DUZ E;  2ODR D;  4M2Z A;  5AE3 A;  1IBK E;  4LFA E;  4LF7 E;  1WHN A;  4OX9 E;  5DNY A;  3HTX A;  4L5N C;  1HNW E;  4KHP E;  4DR3 E;  2LUP B;  2H36 X;  4B3S E;  3VYX A;  3K6Q A;  3J81 C;  1HNX E;  4K0K E;  3RMP A;  4GKK E;  2L92 A;  4I8O A;  3ADL A;  4LF9 E;  2NUE A;  2E1M A;  3J7A G;  3ADJ A;  4NXN E;  3VK6 A;  5AE1 A;  1FJG E;  1X49 A;  2MDR A;  3JAM C;  3MSW A;  4JI8 E;  1T4L B;  4WSP A;  4X64 E;  4WFT A;  4WYQ B;  4JI6 E;  2V86 A;  4BMJ A;  1PKP A;  2LRS A;  2DMY A;  4L8N A;  1EKZ A;  4DV1 E;  2RTX A;  3AV0 A;  3IWC A;  2DIX A;  4F9A B;  2V88 A;  4DV6 E;  1J5E E;  3C4T A;  3ADI A;  5CFF E;  4F54 A;  5BR8 E;  1WHQ A;  3ZOQ B;  1WXR A;  2UUC E;  4J8Z A;  1GZ6 A;  4DR7 E;  2K4V A;  2UXD E;  4LFB E;  4M30 A;  4JYA E;  3C4B A;  1ZBQ A;  3JTZ A;  4JI0 E;  1YZ9 A;  3VYY A;  3DJW A;  4LF4 E;  2N3H A;  2UUB E;  4LTY A;  1X48 A;  4TUI A;  3OTO E;  1N34 E;  5AE2 A;  2NUF A;  2ZM6 E;  2DB2 A;  2M7Q A;  5FLX C;  2UXC E;  2L3C A;  1X47 A;  4JI1 E;  4JV5 E;  3HPZ A;  1J26 A;  1ZBT A;  5T6J A;  4LFC E;  2B7T A;  2V83 A;  4P7D A;  1O0W A;  4DKK A;  4GEQ B;  4DR1 E;  2UUA E;  4JI7 E;  5LMU E;  3LLH A;  1T4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...