1X49A

Solution structure of the first dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
97
structure length
97
Chain Sequence
GSSGSSGMASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAKGRSKQEARNAAAKLAVDILDNENKVDCHTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Interferon-induced, double-stranded RNA-activated protein ki
publication title Solution structure of the first DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
rcsb
source organism Mus musculus
total genus 18
structure length 97
sequence length 97
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x49A01
1T4LB 1YYWA 2N3HA 4OOGC 1GQEA 2UXBE 1FJGE 2LRSA 4JI4E 4NXNE 1XNRE 1N36E 2LJHA 1N34E 2HHHE 2JVAA 2UXCE 2NUFA 3VYYA 4DR6E 1WHNA 4LF4E 2UU9E 1ZBTA 1I94E 2L2KB 3ADIA 1UILA 1WHQA 1HNXE 4DR5E 2B3TB 4GKKE 2YT4A 3ADJA 2MDRA 5LMUE 2LUPB 4JI8E 1N32E 2L2MA 4JI5E 2L3CA 4JV5E 4OX9E 4B3TE 2F4VE 2B7VA 2ZM6E 2DIXA 4DV6E 3P1XA 3T1YE 1X49A 4K0KE 4DUZE 4JYAE 2L3JA 2LTRA 4LFBE 1UHZA 4YHHE 2CPNA 4LF8E 1STUA 1IBKE 3ADLA 2IHR1 1YYKA 1XMQE 4B3RE 4X65E 3C4TA 2RS7A 2EZ6A 4X8WA 2LTSA 2E5LE 1X48A 2NA2A 4X62E 4JI1E 3C4BA 2LBSB 4X64E 2DMYA 4DR7E 1X47A 1HR0E 4B3SE 4LF7E 4JI3E 4B3ME 4M30A 1RQ0A 3OTOE 4DV5E 4JI6E 2NUEA 2RSMA 4YY3E 4DV0E 2LUQA 4DR3E 1RC7A 1EKZA 2UUAE 2KHXA 2JY9A 1DI2A 4LF6E 1YZ9A 1PKPA 1YYOA 4WFTA 1J5EE 4AQYE 5BR8E 1XNQE 2DB2A 4DV7E 4DV3E 2NUGA 4DV4E 4LFAE 2L2NA 1T4OA 4JI0E 4DV1E 3LLHA 2RTXA 5CFFE 4DR2E 4GKJE 2L33A 4DV2E 1QU6A 1N33E 1HNZE 4LF9E 4X66E 3ADGA 5LMNE 2B7TA 2UUCE 2UXDE 1J26A 2UUBE 3HTXA 1T4NA 1XMOE 4WYQB 4LFCE 5IWAE 4LF5E 2VQFE 4JI7E 2N3GA 4NXME 3J7Yp 1IBME 1O0WA 1IBLE 4DR4E 4DUYE 4DR1E 4M2ZA 1HNWE 1FKAE 2RS6A 4DKKA 3T1HE 3VYXA 4KHPE 2VQEE 4JI2E
chains in the Genus database with same CATH superfamily
3H09A 1GQEA 2EMIA 1FJGE 3MSWA 1YFHA 2JOBA 2YTQA 1ZR9A 1XNRE 2KONA 2WBUA 2EOMA 4LTYA 2HHHE 2EPZA 2EJ4A 4DR6E 1GZ6A 2YPNA 4BBYA 1G2DC 1DQ3A 2GLIA 2HGHA 4DR5E 2B9DA 2NABA 2EOXA 2L2MA 2L6MA 4R2RA 1F2IG 2F8BA 4JV5E 4B3TE 2BB8A 2M7QA 4DV6E 3P1XA 5KL7A 2YTPA 3HPZA 1NEIA 1TF3A 2E1MA 2LTRA 2V8QB 4F9AB 1UHZA 4ZYGA 4TUGA 2MKDA 1STUA 2H36X 3RMPA 2EWLA 1X6FA 1XMQE 4B3RE 1PDAA 4IJDA 4M0VA 2CT1A 2HC5A 2LTSA 1X48A 3F6HA 4X64E 2LE2A 5KL4A 2EL4A 5A6JA 4B3ME 2N8XA 2EM9A 4YY3E 4GEQB 1MGTA 3BBGA 2EM3A 2EMAA 4FK5C 1UBDC 2YTOA 4P78A 1A1JA 4J8ZA 4AQYE 1X5WA 4DV3E 1RMDA 4DV4E 2JR1A 2YTGA 4BMJA 2YRHA 4TUIA 3ECRA 4DR2E 4GKJE 2VF1A 4HEIA 2V83A 2CSHA 2UXDE 1J26A 2WBTA 4ZYDA 1EH6A 2YSPA 3TQMA 3UK3C 2EOZA 2YTDA 1MEYC 2EPOA 4WX9A 2EQ3A 5IT9C 2EM4A 5IWAE 4LF5E 5A69A 4RH8A 2N3GA 1A1GA 3J7Yp 2BBGA 3BGHA 1IBLE 4DR1E 4GZNC 3J7AG 2VQEE 1DGCA 2WBSA 1YYWA 2N3HA 4KZSA 4F2JC 2UXBE 1UN6B 2EMLA 4F9CB 4NXNE 2EP3A 1PJQA 1PJTA 4HTGA 3VK6A 2LJHA 4L8NA 2M4IA 1N34E 2JVAA 1TN9A 2EPXA 4WXDA 2JPAA 1ZBTA 1I94E 2L2KB 1YPNA 4BHCA 2G7HA 2EPKX 1B69A 2YTNA 2B3TB 3C6KA 3OMLA 2RPCA 2YT4A 4X9JA 4R2SA 2EMCA 2LUPB 2LV2A 2DMIA 2I9IA 4JI5E 4R2CA 3C6MA 2L3CA 2E72A 2EN3A 1ZU1A 2EOQA 1X49A 2JYAA 4L5NC 2MC5A 3BF2A 2L3JA 4LFBE 2KOUA 2WCC3 3VHTB 4ZYEA 1PJSA 4Q28A 1YYKA 3C4TA 2ENCA 2RS7A 2YTEA 5ADZA 4F6NA 2EZ6A 2E5LE 2JWOA 3IWBA 2ODRD 2LBSB 1TF6A 2EE8A 2EN6A 2EM6A 1X47A 2EORA 3EPHA 4M30A 2EN7A 3LMLA 2M1SA 2L92A 2LUQA 1EKZA 3AV0A 3BIDA 5A6BD 1X6EA 4R2QA 1YYOA 4WFTA 1XNQE 2DB2A 4DV7E 2EPRA 5KL6A 4NHRA 4LFAE 2EM0A 1T4OA 3HXLA 2EM5A 5LL6R 4R2AA 3LLHA 2RTXA 2EOOA 2L33A 1QU6A 2YSOA 2UUCE 2EOSA 2YWQA 2D9HA 3MHSC 1XMOE 4R2EA 3MHHC 1L4SA 3JU0A 2EPPA 1O0WA 2ELZA 2EMWA 1ZBQA 5IV8B 1HNWE 3FIGA 2RS6A 1FKAE 3T1HE 3VYXA 3KWRA 5IXMB 4JI2E 5A6BA 2RQLA 2JP9A 5DNYA 3IWCA 1T4LB 2EM7A 2YRKA 2DGCA 2J7JA 2EOHA 4R2PA 2EMXA 3DF6A 5KL3A 2EMKA 4BC9A 2EMBA 4P7DA 3EPKA 2DRPA 2NUFA 3VYYA 2LMZA 2LT7A 1WXRA 1LLMC 2UU9E 2ELYA 1T39A 1WRJA 2EL6A 2I13A 3ADIA 3M99B 1HNXE 2EMFA 1A1LA 1BBOA 5KL2A 3ADJA 2MDRA 3J80C 1EH8A 2EM2A 4R03A 4JI8E 1T38A 2LO3A 2DLQA 2B7VA 1BB8A 2V85A 4MLQA 2EPMX 4K0KE 5AASA 2PRTA 2EQ0A 3HQ1A 4R8OA 2EPAA 4WSPA 4MLVA 2CPNA 4LF8E 5F3WA 1IBKE 2FV4B 2YTFA 4WSGA 2IHR1 1SR9A 5A6KA 4X65E 4X8WA 2EPCA 2FGGA 4WXCA 4X62E 4JI1E 4DR7E 1HR0E 4O43A 2HJJA 4F9BB 1RQ0A 5AE2A 4DV5E 1IQOA 4JI6E 2NUEA 5A6AA 2RSMA 4DV0E 4Q35B 4DR3E 2UUAE 5A2QC 2R76A 1QNTA 5FLXC 4LF6E 2EL5A 1YZ9A 2CTDA 2LCEA 2A25A 3QG5C 2EN8A 4NZVA 2L2NA 4KWYA 4DV1E 2GHFA 1X3CA 5CFFE 1N33E 4LF9E 2YU8A 3F6GA 2LVHA 4X66E 2B7TA 3HPSA 4O4KA 2UUBE 2EMYA 1T4NA 3K6QA 5KL5A 3HTXA 4N4RB 2DSYA 3IWDA 1P47A 2VQFE 3EPLA 4NXME 1IBME 2EMZA 4DUYE 4DKKA 5AC4A 5AC5A 4BCAA 2EOYA 3EQ1A 2L8TA 4OOGC 2V86A 1BBGA 2WZOA 2LRSA 2JXPA 4JI4E 1SFEA 2DLKA 1N36E 2EN2A 2EMGA 2UXCE 2EOEA 2EQ1A 1X6HA 1WHNA 2EM8A 4LF4E 1KJKA 2MC6A 1UILA 2K4VA 1WHQA 2MDGA 1A1IA 2GPIA 1A1HA 1AAYA 4GKKE 4BC7A 2YTIA 2ODRC 5LMUE 1A1FA 3THOB 1N32E 4LU9A 4OX9E 1ZAAC 2F4VE 2ZM6E 4F6MA 2DIXA 4I8OA 2V88A 3JTZA 3T1YE 4DUZE 4JYAE 2ENHA 4YHHE 2EOIA 1YSAC 5AE1A 2V89A 3ADLA 2EN1A 2EPLX 4ZYHA 4F54A 1G2FC 2NA2A 3C4BA 1AH5A 3ZOQB 1EH7A 2DMYA 4B3SE 4LF7E 1IQSA 2EPNA 3THNA 4JI3E 4O5GA 2EMHA 3OTOE 4DMIA 3DJWA 1YUIA 1RC7A 2LJUA 2KHXA 2V87A 3J81C 2JY9A 2EPUA 2RSIA 2YZTA 1DI2A 1PKPA 1A1KA 1NCSA 2R1FA 4R2DA 1J5EE 5BR8E 3KZZA 2NUGA 4IS1C 1JK1A 2YRMA 2ENAA 4WPYA 4JI0E 5AE3A 1Z1BA 4DV2E 2M9AA 2EOJA 1HNZE 1KYQA 2ADRA 1N3GA 3ADGA 5LMNE 2FTXB 4BS9A 3AUZA 3L00A 5TSEA 2EN4A 4BHBA 3EPJA 2VE7C 2YU5A 4O24A 2VRDA 2MKNA 4RHBB 5LLQA 4WYQB 1WJPA 2JOXA 4LFCE 4JI7E 1JK2A 1YUJA 1IMUA 2YTJA 4M9VC 4DR4E 2K7IA 1GTKA 3JAMC 4M2ZA 2EOFA 2Q8UA 5T6JA 3KZYA 4KHPE
chains in the Genus database with same CATH topology
5DNYA 3IWCA 1T4LB 2L8TA 3H09A 1YYWA 2N3HA 4KZSA 1GQEA 2V86A 4OOGC 1FJGE 2UXBE 2WZOA 2LRSA 3MSWA 4F9CB 4JI4E 4NXNE 3DF6A 2JOBA 3VK6A 4BC9A 1XNRE 2KONA 1N36E 2LJHA 4L8NA 4P7DA 2M4IA 1N34E 4LTYA 2JVAA 2HHHE 2UXCE 2NUFA 3VYYA 2LMZA 1WHNA 4DR6E 1WXRA 4LF4E 1GZ6A 2UU9E 2MC6A 1ZBTA 1I94E 4BBYA 2L2KB 1UILA 3ADIA 2K4VA 1WHQA 1DQ3A 1HNXE 2G7HA 4DR5E 2B9DA 2B3TB 4GKKE 4BC7A 3OMLA 2YT4A 3ADJA 2MDRA 2ODRC 5LMUE 3J80C 4R03A 2LUPB 4JI8E 1N32E 2L2MA 2L6MA 4JI5E 4LU9A 2F8BA 2L3CA 4JV5E 4OX9E 4B3TE 2F4VE 2B7VA 2ZM6E 2V85A 2DIXA 2M7QA 4DV6E 3P1XA 4I8OA 2V88A 3JTZA 3T1YE 1X49A 5AASA 3HPZA 4K0KE 2MC5A 4L5NC 2E1MA 2LTRA 2V8QB 3HQ1A 4R8OA 2KOUA 4WSPA 4F9AB 1UHZA 4YHHE 2CPNA 4LFBE 4TUGA 4LF8E 5F3WA 1STUA 5AE1A 1IBKE 2FV4B 2H36X 2V89A 3RMPA 3ADLA 2EWLA 2IHR1 4Q28A 1XMQE 1YYKA 4B3RE 1SR9A 4F54A 4M0VA 4X65E 3C4TA 2RS7A 5ADZA 2EZ6A 2LTSA 4X8WA 2E5LE 2JWOA 1X48A 2FGGA 2NA2A 4X62E 3IWBA 2ODRD 3F6HA 3C4BA 4JI1E 2LBSB 4X64E 3ZOQB 2LE2A 2DMYA 4DR7E 1X47A 1HR0E 4B3SE 4LF7E 4JI3E 4F9BB 4B3ME 4M30A 2L3JA 1RQ0A 3OTOE 4DMIA 3LMLA 5AE2A 3DJWA 4DV5E 4JI6E 2M1SA 2NUEA 2RSMA 4YY3E 2L92A 2LUQA 4DV0E 4DR3E 1RC7A 1EKZA 2UUAE 4DUZE 4JYAE 3AV0A 2KHXA 2V87A 4GEQB 3J81C 5A2QC 2JY9A 5FLXC 2YZTA 1DI2A 4LF6E 1YZ9A 1PKPA 4P78A 1YYOA 4WFTA 4J8ZA 1J5EE 4AQYE 5BR8E 1XNQE 2DB2A 4DV7E 4DV3E 2NUGA 4DV4E 4LFAE 2JR1A 2L2NA 1T4OA 4WPYA 3HXLA 5LL6R 4JI0E 4BMJA 5AE3A 4DV1E 3LLHA 4TUIA 2RTXA 5CFFE 4DR2E 4GKJE 2L33A 2VF1A 4DV2E 1QU6A 1N33E 1HNZE 4LF9E 3F6GA 4X66E 3ADGA 5LMNE 2B7TA 2FTXB 2V83A 3HPSA 2UUCE 3J7AG 2UXDE 1J26A 4BS9A 3AUZA 2UUBE 2VE7C 3HTXA 1T4NA 3K6QA 1XMOE 4WYQB 2JOXA 2DSYA 5IT9C 4LFCE 3IWDA 5IWAE 4LF5E 2VQFE 3JU0A 4JI7E 2N3GA 4NXME 3J7Yp 1IBME 1O0WA 1IBLE 4DR4E 4DUYE 4DR1E 1ZBQA 3JAMC 4M2ZA 1HNWE 3FIGA 2RS6A 5T6JA 4DKKA 3T1HE 1FKAE 3VYXA 4KHPE 2VQEE 3KWRA 4JI2E 4BCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4L B;  1YYW A;  2N3H A;  4OOG C;  1GQE A;  2UXB E;  1FJG E;  2LRS A;  4JI4 E;  4NXN E;  1XNR E;  1N36 E;  2LJH A;  1N34 E;  2HHH E;  2JVA A;  2UXC E;  2NUF A;  3VYY A;  4DR6 E;  1WHN A;  4LF4 E;  2UU9 E;  1ZBT A;  1I94 E;  2L2K B;  3ADI A;  1UIL A;  1WHQ A;  1HNX E;  4DR5 E;  2B3T B;  4GKK E;  2YT4 A;  3ADJ A;  2MDR A;  5LMU E;  2LUP B;  4JI8 E;  1N32 E;  2L2M A;  4JI5 E;  2L3C A;  4JV5 E;  4OX9 E;  4B3T E;  2F4V E;  2B7V A;  2ZM6 E;  2DIX A;  4DV6 E;  3P1X A;  3T1Y E;  1X49 A;  4K0K E;  4DUZ E;  4JYA E;  2L3J A;  2LTR A;  4LFB E;  1UHZ A;  4YHH E;  2CPN A;  4LF8 E;  1STU A;  1IBK E;  3ADL A;  2IHR 1;  1YYK A;  1XMQ E;  4B3R E;  4X65 E;  3C4T A;  2RS7 A;  2EZ6 A;  4X8W A;  2LTS A;  2E5L E;  1X48 A;  2NA2 A;  4X62 E;  4JI1 E;  3C4B A;  2LBS B;  4X64 E;  2DMY A;  4DR7 E;  1X47 A;  1HR0 E;  4B3S E;  4LF7 E;  4JI3 E;  4B3M E;  4M30 A;  1RQ0 A;  3OTO E;  4DV5 E;  4JI6 E;  2NUE A;  2RSM A;  4YY3 E;  4DV0 E;  2LUQ A;  4DR3 E;  1RC7 A;  1EKZ A;  2UUA E;  2KHX A;  2JY9 A;  1DI2 A;  4LF6 E;  1YZ9 A;  1PKP A;  1YYO A;  4WFT A;  1J5E E;  4AQY E;  5BR8 E;  1XNQ E;  2DB2 A;  4DV7 E;  4DV3 E;  2NUG A;  4DV4 E;  4LFA E;  2L2N A;  1T4O A;  4JI0 E;  4DV1 E;  3LLH A;  2RTX A;  5CFF E;  4DR2 E;  4GKJ E;  2L33 A;  4DV2 E;  1QU6 A;  1N33 E;  1HNZ E;  4LF9 E;  4X66 E;  3ADG A;  5LMN E;  2B7T A;  2UUC E;  2UXD E;  1J26 A;  2UUB E;  3HTX A;  1T4N A;  1XMO E;  4WYQ B;  4LFC E;  5IWA E;  4LF5 E;  2VQF E;  4JI7 E;  2N3G A;  4NXM E;  3J7Y p;  1IBM E;  1O0W A;  1IBL E;  4DR4 E;  4DUY E;  4DR1 E;  4M2Z A;  1HNW E;  1FKA E;  2RS6 A;  4DKK A;  3T1H E;  3VYX A;  4KHP E;  2VQE E;  4JI2 E; 
#chains in the Genus database with same CATH topology
 3H09 A;  1GQE A;  2EMI A;  1FJG E;  3MSW A;  1YFH A;  2JOB A;  2YTQ A;  1ZR9 A;  1XNR E;  2KON A;  2WBU A;  2EOM A;  4LTY A;  2HHH E;  2EPZ A;  2EJ4 A;  4DR6 E;  1GZ6 A;  2YPN A;  4BBY A;  1G2D C;  1DQ3 A;  2GLI A;  2HGH A;  4DR5 E;  2B9D A;  2NAB A;  2EOX A;  2L2M A;  2L6M A;  4R2R A;  1F2I G;  2F8B A;  4JV5 E;  4B3T E;  2BB8 A;  2M7Q A;  4DV6 E;  3P1X A;  5KL7 A;  2YTP A;  3HPZ A;  1NEI A;  1TF3 A;  2E1M A;  2LTR A;  2V8Q B;  4F9A B;  1UHZ A;  4ZYG A;  4TUG A;  2MKD A;  1STU A;  2H36 X;  3RMP A;  2EWL A;  1X6F A;  1XMQ E;  4B3R E;  1PDA A;  4IJD A;  4M0V A;  2CT1 A;  2HC5 A;  2LTS A;  1X48 A;  3F6H A;  4X64 E;  2LE2 A;  5KL4 A;  2EL4 A;  5A6J A;  4B3M E;  2N8X A;  2EM9 A;  4YY3 E;  4GEQ B;  1MGT A;  3BBG A;  2EM3 A;  2EMA A;  4FK5 C;  1UBD C;  2YTO A;  4P78 A;  1A1J A;  4J8Z A;  4AQY E;  1X5W A;  4DV3 E;  1RMD A;  4DV4 E;  2JR1 A;  2YTG A;  4BMJ A;  2YRH A;  4TUI A;  3ECR A;  4DR2 E;  4GKJ E;  2VF1 A;  4HEI A;  2V83 A;  2CSH A;  2UXD E;  1J26 A;  2WBT A;  4ZYD A;  1EH6 A;  2YSP A;  3TQM A;  3UK3 C;  2EOZ A;  2YTD A;  1MEY C;  2EPO A;  4WX9 A;  2EQ3 A;  5IT9 C;  2EM4 A;  5IWA E;  4LF5 E;  5A69 A;  4RH8 A;  2N3G A;  1A1G A;  3J7Y p;  2BBG A;  3BGH A;  1IBL E;  4DR1 E;  4GZN C;  3J7A G;  2VQE E;  1DGC A;  2WBS A;  1YYW A;  2N3H A;  4KZS A;  4F2J C;  2UXB E;  1UN6 B;  2EML A;  4F9C B;  4NXN E;  2EP3 A;  1PJQ A;  1PJT A;  4HTG A;  3VK6 A;  2LJH A;  4L8N A;  2M4I A;  1N34 E;  2JVA A;  1TN9 A;  2EPX A;  4WXD A;  2JPA A;  1ZBT A;  1I94 E;  2L2K B;  1YPN A;  4BHC A;  2G7H A;  2EPK X;  1B69 A;  2YTN A;  2B3T B;  3C6K A;  3OML A;  2RPC A;  2YT4 A;  4X9J A;  4R2S A;  2EMC A;  2LUP B;  2LV2 A;  2DMI A;  2I9I A;  4JI5 E;  4R2C A;  3C6M A;  2L3C A;  2E72 A;  2EN3 A;  1ZU1 A;  2EOQ A;  1X49 A;  2JYA A;  4L5N C;  2MC5 A;  3BF2 A;  2L3J A;  4LFB E;  2KOU A;  2WCC 3;  3VHT B;  4ZYE A;  1PJS A;  4Q28 A;  1YYK A;  3C4T A;  2ENC A;  2RS7 A;  2YTE A;  5ADZ A;  4F6N A;  2EZ6 A;  2E5L E;  2JWO A;  3IWB A;  2ODR D;  2LBS B;  1TF6 A;  2EE8 A;  2EN6 A;  2EM6 A;  1X47 A;  2EOR A;  3EPH A;  4M30 A;  2EN7 A;  3LML A;  2M1S A;  2L92 A;  2LUQ A;  1EKZ A;  3AV0 A;  3BID A;  5A6B D;  1X6E A;  4R2Q A;  1YYO A;  4WFT A;  1XNQ E;  2DB2 A;  4DV7 E;  2EPR A;  5KL6 A;  4NHR A;  4LFA E;  2EM0 A;  1T4O A;  3HXL A;  2EM5 A;  5LL6 R;  4R2A A;  3LLH A;  2RTX A;  2EOO A;  2L33 A;  1QU6 A;  2YSO A;  2UUC E;  2EOS A;  2YWQ A;  2D9H A;  3MHS C;  1XMO E;  4R2E A;  3MHH C;  1L4S A;  3JU0 A;  2EPP A;  1O0W A;  2ELZ A;  2EMW A;  1ZBQ A;  5IV8 B;  1HNW E;  3FIG A;  2RS6 A;  1FKA E;  3T1H E;  3VYX A;  3KWR A;  5IXM B;  4JI2 E;  5A6B A;  2RQL A;  2JP9 A;  5DNY A;  3IWC A;  1T4L B;  2EM7 A;  2YRK A;  2DGC A;  2J7J A;  2EOH A;  4R2P A;  2EMX A;  3DF6 A;  5KL3 A;  2EMK A;  4BC9 A;  2EMB A;  4P7D A;  3EPK A;  2DRP A;  2NUF A;  3VYY A;  2LMZ A;  2LT7 A;  1WXR A;  1LLM C;  2UU9 E;  2ELY A;  1T39 A;  1WRJ A;  2EL6 A;  2I13 A;  3ADI A;  3M99 B;  1HNX E;  2EMF A;  1A1L A;  1BBO A;  5KL2 A;  3ADJ A;  2MDR A;  3J80 C;  1EH8 A;  2EM2 A;  4R03 A;  4JI8 E;  1T38 A;  2LO3 A;  2DLQ A;  2B7V A;  1BB8 A;  2V85 A;  4MLQ A;  2EPM X;  4K0K E;  5AAS A;  2PRT A;  2EQ0 A;  3HQ1 A;  4R8O A;  2EPA A;  4WSP A;  4MLV A;  2CPN A;  4LF8 E;  5F3W A;  1IBK E;  2FV4 B;  2YTF A;  4WSG A;  2IHR 1;  1SR9 A;  5A6K A;  4X65 E;  4X8W A;  2EPC A;  2FGG A;  4WXC A;  4X62 E;  4JI1 E;  4DR7 E;  1HR0 E;  4O43 A;  2HJJ A;  4F9B B;  1RQ0 A;  5AE2 A;  4DV5 E;  1IQO A;  4JI6 E;  2NUE A;  5A6A A;  2RSM A;  4DV0 E;  4Q35 B;  4DR3 E;  2UUA E;  5A2Q C;  2R76 A;  1QNT A;  5FLX C;  4LF6 E;  2EL5 A;  1YZ9 A;  2CTD A;  2LCE A;  2A25 A;  3QG5 C;  2EN8 A;  4NZV A;  2L2N A;  4KWY A;  4DV1 E;  2GHF A;  1X3C A;  5CFF E;  1N33 E;  4LF9 E;  2YU8 A;  3F6G A;  2LVH A;  4X66 E;  2B7T A;  3HPS A;  4O4K A;  2UUB E;  2EMY A;  1T4N A;  3K6Q A;  5KL5 A;  3HTX A;  4N4R B;  2DSY A;  3IWD A;  1P47 A;  2VQF E;  3EPL A;  4NXM E;  1IBM E;  2EMZ A;  4DUY E;  4DKK A;  5AC4 A;  5AC5 A;  4BCA A;  2EOY A;  3EQ1 A;  2L8T A;  4OOG C;  2V86 A;  1BBG A;  2WZO A;  2LRS A;  2JXP A;  4JI4 E;  1SFE A;  2DLK A;  1N36 E;  2EN2 A;  2EMG A;  2UXC E;  2EOE A;  2EQ1 A;  1X6H A;  1WHN A;  2EM8 A;  4LF4 E;  1KJK A;  2MC6 A;  1UIL A;  2K4V A;  1WHQ A;  2MDG A;  1A1I A;  2GPI A;  1A1H A;  1AAY A;  4GKK E;  4BC7 A;  2YTI A;  2ODR C;  5LMU E;  1A1F A;  3THO B;  1N32 E;  4LU9 A;  4OX9 E;  1ZAA C;  2F4V E;  2ZM6 E;  4F6M A;  2DIX A;  4I8O A;  2V88 A;  3JTZ A;  3T1Y E;  4DUZ E;  4JYA E;  2ENH A;  4YHH E;  2EOI A;  1YSA C;  5AE1 A;  2V89 A;  3ADL A;  2EN1 A;  2EPL X;  4ZYH A;  4F54 A;  1G2F C;  2NA2 A;  3C4B A;  1AH5 A;  3ZOQ B;  1EH7 A;  2DMY A;  4B3S E;  4LF7 E;  1IQS A;  2EPN A;  3THN A;  4JI3 E;  4O5G A;  2EMH A;  3OTO E;  4DMI A;  3DJW A;  1YUI A;  1RC7 A;  2LJU A;  2KHX A;  2V87 A;  3J81 C;  2JY9 A;  2EPU A;  2RSI A;  2YZT A;  1DI2 A;  1PKP A;  1A1K A;  1NCS A;  2R1F A;  4R2D A;  1J5E E;  5BR8 E;  3KZZ A;  2NUG A;  4IS1 C;  1JK1 A;  2YRM A;  2ENA A;  4WPY A;  4JI0 E;  5AE3 A;  1Z1B A;  4DV2 E;  2M9A A;  2EOJ A;  1HNZ E;  1KYQ A;  2ADR A;  1N3G A;  3ADG A;  5LMN E;  2FTX B;  4BS9 A;  3AUZ A;  3L00 A;  5TSE A;  2EN4 A;  4BHB A;  3EPJ A;  2VE7 C;  2YU5 A;  4O24 A;  2VRD A;  2MKN A;  4RHB B;  5LLQ A;  4WYQ B;  1WJP A;  2JOX A;  4LFC E;  4JI7 E;  1JK2 A;  1YUJ A;  1IMU A;  2YTJ A;  4M9V C;  4DR4 E;  2K7I A;  1GTK A;  3JAM C;  4M2Z A;  2EOF A;  2Q8U A;  5T6J A;  3KZY A;  4KHP E; 
#chains in the Genus database with same CATH homology
 5DNY A;  3IWC A;  1T4L B;  2L8T A;  3H09 A;  1YYW A;  2N3H A;  4KZS A;  1GQE A;  2V86 A;  4OOG C;  1FJG E;  2UXB E;  2WZO A;  2LRS A;  3MSW A;  4F9C B;  4JI4 E;  4NXN E;  3DF6 A;  2JOB A;  3VK6 A;  4BC9 A;  1XNR E;  2KON A;  1N36 E;  2LJH A;  4L8N A;  4P7D A;  2M4I A;  1N34 E;  4LTY A;  2JVA A;  2HHH E;  2UXC E;  2NUF A;  3VYY A;  2LMZ A;  1WHN A;  4DR6 E;  1WXR A;  4LF4 E;  1GZ6 A;  2UU9 E;  2MC6 A;  1ZBT A;  1I94 E;  4BBY A;  2L2K B;  1UIL A;  3ADI A;  2K4V A;  1WHQ A;  1DQ3 A;  1HNX E;  2G7H A;  4DR5 E;  2B9D A;  2B3T B;  4GKK E;  4BC7 A;  3OML A;  2YT4 A;  3ADJ A;  2MDR A;  2ODR C;  5LMU E;  3J80 C;  4R03 A;  2LUP B;  4JI8 E;  1N32 E;  2L2M A;  2L6M A;  4JI5 E;  4LU9 A;  2F8B A;  2L3C A;  4JV5 E;  4OX9 E;  4B3T E;  2F4V E;  2B7V A;  2ZM6 E;  2V85 A;  2DIX A;  2M7Q A;  4DV6 E;  3P1X A;  4I8O A;  2V88 A;  3JTZ A;  3T1Y E;  1X49 A;  5AAS A;  3HPZ A;  4K0K E;  2MC5 A;  4L5N C;  2E1M A;  2LTR A;  2V8Q B;  3HQ1 A;  4R8O A;  2KOU A;  4WSP A;  4F9A B;  1UHZ A;  4YHH E;  2CPN A;  4LFB E;  4TUG A;  4LF8 E;  5F3W A;  1STU A;  5AE1 A;  1IBK E;  2FV4 B;  2H36 X;  2V89 A;  3RMP A;  3ADL A;  2EWL A;  2IHR 1;  4Q28 A;  1XMQ E;  1YYK A;  4B3R E;  1SR9 A;  4F54 A;  4M0V A;  4X65 E;  3C4T A;  2RS7 A;  5ADZ A;  2EZ6 A;  2LTS A;  4X8W A;  2E5L E;  2JWO A;  1X48 A;  2FGG A;  2NA2 A;  4X62 E;  3IWB A;  2ODR D;  3F6H A;  3C4B A;  4JI1 E;  2LBS B;  4X64 E;  3ZOQ B;  2LE2 A;  2DMY A;  4DR7 E;  1X47 A;  1HR0 E;  4B3S E;  4LF7 E;  4JI3 E;  4F9B B;  4B3M E;  4M30 A;  2L3J A;  1RQ0 A;  3OTO E;  4DMI A;  3LML A;  5AE2 A;  3DJW A;  4DV5 E;  4JI6 E;  2M1S A;  2NUE A;  2RSM A;  4YY3 E;  2L92 A;  2LUQ A;  4DV0 E;  4DR3 E;  1RC7 A;  1EKZ A;  2UUA E;  4DUZ E;  4JYA E;  3AV0 A;  2KHX A;  2V87 A;  4GEQ B;  3J81 C;  5A2Q C;  2JY9 A;  5FLX C;  2YZT A;  1DI2 A;  4LF6 E;  1YZ9 A;  1PKP A;  4P78 A;  1YYO A;  4WFT A;  4J8Z A;  1J5E E;  4AQY E;  5BR8 E;  1XNQ E;  2DB2 A;  4DV7 E;  4DV3 E;  2NUG A;  4DV4 E;  4LFA E;  2JR1 A;  2L2N A;  1T4O A;  4WPY A;  3HXL A;  5LL6 R;  4JI0 E;  4BMJ A;  5AE3 A;  4DV1 E;  3LLH A;  4TUI A;  2RTX A;  5CFF E;  4DR2 E;  4GKJ E;  2L33 A;  2VF1 A;  4DV2 E;  1QU6 A;  1N33 E;  1HNZ E;  4LF9 E;  3F6G A;  4X66 E;  3ADG A;  5LMN E;  2B7T A;  2FTX B;  2V83 A;  3HPS A;  2UUC E;  3J7A G;  2UXD E;  1J26 A;  4BS9 A;  3AUZ A;  2UUB E;  2VE7 C;  3HTX A;  1T4N A;  3K6Q A;  1XMO E;  4WYQ B;  2JOX A;  2DSY A;  5IT9 C;  4LFC E;  3IWD A;  5IWA E;  4LF5 E;  2VQF E;  3JU0 A;  4JI7 E;  2N3G A;  4NXM E;  3J7Y p;  1IBM E;  1O0W A;  1IBL E;  4DR4 E;  4DUY E;  4DR1 E;  1ZBQ A;  3JAM C;  4M2Z A;  1HNW E;  3FIG A;  2RS6 A;  5T6J A;  4DKK A;  3T1H E;  1FKA E;  3VYX A;  4KHP E;  2VQE E;  3KWR A;  4JI2 E;  4BCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...