1X49A

Solution structure of the first dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
97
structure length
97
Chain Sequence
GSSGSSGMASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAKGRSKQEARNAAAKLAVDILDNENKVDCHTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Interferon-induced, double-stranded RNA-activated protein ki
total genus 18
structure length 97
sequence length 97
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x49A01
5LMNE 4DR3E 2UXCE 4LF6E 2ZM6E 1GQEA 4B3TE 4K0KE 2JY9A 1FJGE 1YYOA 4B3SE 4DV0E 2DIXA 2DB2A 3ADGA 4DKKA 1J26A 2DMYA 2B7VA 4LFBE 1X48A 1RC7A 4NXNE 1X49A 4DR1E 1XMQE 3T1HE 2E5LE 1IBLE 2UXDE 1HNXE 3VYYA 4DUZE 1O0WA 3C4TA 2L2KB 4LF7E 2MDRA 4OX9E 2LUQA 1I94E 4YHHE 4DR7E 4JI5E 1QU6A 4DV7E 1T4OA 2NA2A 4DV6E 1HR0E 1XNRE 1ZBTA 5LMUE 1YZ9A 5BR8E 1T4NA 1X47A 2LBSB 4JI7E 2LJHA 1RQ0A 5IWAE 4LF4E 2LRSA 4X64E 4JI3E 3ADLA 2CPNA 1WHNA 4JI0E 1N36E 2IHR1 2L3JA 2NUGA 4DR6E 4WFTA 4X66E 2YT4A 1UILA 4M30A 2B7TA 2LUPB 1HNZE 2RTXA 4NXME 2NUEA 4KHPE 4LF8E 1HNWE 3HTXA 2RS6A 2L3CA 1UHZA 2N3HA 4DV5E 2VQFE 1J5EE 2UUCE 4JI6E 1YYWA 1PKPA 2EZ6A 3C4BA 3LLHA 4DV4E 2LTSA 1XNQE 2RS7A 4DUYE 3T1YE 4AQYE 3ADIA 2KHXA 2B3TB 2F4VE 4JI8E 2UUAE 1XMOE 4DV3E 4DR2E 4DV2E 4YY3E 1IBME 4GKJE 3OTOE 4LFAE 4M2ZA 1N33E 4OOGC 2JVAA 1WHQA 2L2NA 4JI4E 1EKZA 2N3GA 2UUBE 4LF9E 4JI1E 2LTRA 2UXBE 3P1XA 2L33A 4JV5E 1YYKA 4GKKE 3VYXA 4DR4E 1T4LB 4LF5E 2NUFA 1FKAE 2HHHE 3J7Yp 4JYAE 4DV1E 4X8WA 4WYQB 1IBKE 4B3ME 4DR5E 4LFCE 1N34E 2L2MA 1N32E 4JI2E 3ADJA 1DI2A 4B3RE 5CFFE 2VQEE 2UU9E 1STUA 2RSMA 4X65E 4X62E
chains in the Genus database with same CATH superfamily
4DR3E 2DGCA 1MEYC 2WBSA 2J7JA 5DNYA 2EM8A 2YSOA 2DSYA 1GQEA 3TQMA 4K0KE 2EPPA 1FJGE 1YYOA 4DV0E 2DIXA 2K4VA 2EMCA 4O5GA 4BMJA 5A69A 4LFBE 1SR9A 2EM7A 5IXMB 2VE7C 1IBLE 2EMWA 2EE8A 3VYYA 2YPNA 4F9CB 2M1SA 4LF7E 4OX9E 2EMZA 1I94E 4YHHE 2CT1A 2WZOA 4DV7E 2JWOA 1T4OA 1HR0E 4DV6E 5LLQA 4HTGA 5T6JA 2YTNA 4ZYDA 5BR8E 1LLMC 2YTPA 2FTXB 1UBDC 3DJWA 4MLQA 2EQ1A 2YTQA 2GPIA 3ADLA 2EPKX 2EPZA 1N36E 1AAYA 4NZVA 4R2AA 3THNA 4RHBB 4F9BB 5A6BD 4O43A 1YUJA 1GZ6A 2B7TA 2LUPB 4NXME 2ELYA 5A6JA 2RS6A 4F2JC 2L3CA 2N3HA 4DV5E 2EPMX 1B69A 4LU9A 3JAMC 1A1KA 5AC5A 2K7IA 3K6QA 2JOBA 2ENHA 2M7QA 3C4BA 2EM5A 2ADRA 2EL5A 2ODRC 2LTSA 1F2IG 2RS7A 4DUYE 1RMDA 2EOIA 4AQYE 2KHXA 4R2SA 1YPNA 2L92A 2KONA 2YTJA 4DV2E 4YY3E 4GKJE 3ZOQB 4M2ZA 2ELZA 2MC6A 2JR1A 1N33E 2EM3A 4BC7A 1A1LA 1EKZA 2EOZA 2N3GA 1NEIA 4JI1E 2LTRA 5KL4A 3C6KA 4GKKE 4R2CA 1A1IA 1G2DC 4JYAE 5F3WA 4WSGA 4RH8A 3OMLA 3BBGA 2EMAA 4TUGA 1N34E 4M9VC 2EQ0A 1EH7A 1DI2A 3HXLA 2UU9E 1STUA 2RSMA 1YUIA 1YFHA 4LF6E 1NCSA 2V88A 2EM6A 4B3TE 2JY9A 2EMFA 4B3SE 2YTFA 2CSHA 2DB2A 3ADGA 4DKKA 2WBUA 1J26A 1WRJA 1MGTA 2DMYA 2DRPA 4HEIA 2UXDE 4I8OA 4FK5C 2YWQA 4R2RA 4DUZE 1O0WA 3L00A 4R2DA 2H36X 1TF3A 1TF6A 2JXPA 2LJUA 3MSWA 4JI5E 1XNRE 5A2QC 1ZBTA 2PRTA 2V85A 5LMUE 1YZ9A 2EM9A 2EOSA 3AUZA 1T4NA 3HQ1A 1A1GA 1KJKA 1X47A 2RPCA 4F6NA 4Q35B 4X64E 2YTGA 2EM0A 1Z1BA 2YRMA 2EPOA 4JI0E 2L3JA 2EPCA 2MKNA 2YTIA 4X66E 1A1JA 5IT9C 4KHPE 1HNZE 2RTXA 3ECRA 2HJJA 4LF8E 2FV4B 3BF2A 3MHHC 1X6FA 1UHZA 4TUIA 3EPLA 2EOJA 2DLKA 2BBGA 2EOXA 2UUCE 4JI6E 3IWBA 2V89A 1YYWA 1PKPA 4N4RB 2EMBA 2MKDA 3LLHA 4R03A 2LCEA 3BGHA 5TSEA 3EPHA 2YRKA 2L8TA 4GZNC 2V83A 2WCC3 2EOMA 1T39A 2F4VE 2UUAE 4DV3E 4DR2E 2EOHA 4GEQB 2EN3A 4LFAE 4F54A 2JYAA 2JVAA 4KWYA 5AE3A 1PJQA 2GHFA 2UUBE 2I9IA 2EM4A 2MDGA 2UXBE 2EPXA 3P1XA 3J80C 1TN9A 4JV5E 4DR4E 2NUFA 1FKAE 2L6MA 2F8BA 2ENCA 3RMPA 2KOUA 2EPAA 1IBKE 4B3ME 2FGGA 4BC9A 4LFCE 1G2FC 3KZYA 2EOFA 3EQ1A 2YTEA 4BHBA 1WXRA 3LMLA 5A6KA 2A25A 3VHTB 5LMNE 4BHCA 3JTZA 1ZAAC 2ZM6E 2R1FA 4L5NC 2EPRA 2EQ3A 2MC5A 4BCAA 1XMQE 1EH6A 2RSIA 3T1HE 2E5LE 1HNXE 2EN8A 3F6HA 5KL3A 3IWCA 5LL6R 4R2QA 3C4TA 2EOQA 2MDRA 2YU5A 5ADZA 2LUQA 2LV2A 4DR7E 5AC4A 4M0VA 2DMIA 1QU6A 2NA2A 3UK3C 2EMLA 2CTDA 2V86A 4ZYEA 2V87A 3KZZA 2LJHA 1RQ0A 4JI3E 2CPNA 1WHNA 1EH8A 2EPUA 2EOOA 2NUGA 4WFTA 2YT4A 3AV0A 1UILA 4M30A 2NUEA 3HPSA 1T38A 2JP9A 2EMHA 4WSPA 1J5EE 1L4SA 2EL6A 2R76A 1YSAC 4WXCA 1BB8A 4DV4E 2YSPA 3T1YE 3ADIA 2B3TB 1GTKA 3IWDA 2M4IA 5AE2A 1IBME 3OTOE 2EMXA 1P47A 5AASA 4OOGC 1WHQA 2L2NA 4R2EA 2EM2A 2YZTA 4LF9E 1BBOA 2L33A 1PDAA 2EMGA 1YYKA 2Q8UA 1T4LB 5AE1A 4P7DA 2V8QB 4O4KA 4DV1E 2DLQA 2HC5A 2D9HA 4WYQB 1IQOA 2LT7A 2EN2A 1X3CA 1A1HA 2EMYA 4Q28A 3J7AG 3KWRA 3C6MA 2BB8A 2M9AA 2YRHA 2ENAA 3VK6A 1ZR9A 5CFFE 1BBGA 4X65E 3DF6A 2N8XA 2UXCE 3HPZA 2YU8A 2EL4A 1WJPA 3BIDA 1PJSA 1KYQA 2VRDA 1UN6B 2B7VA 1X48A 1DQ3A 2LE2A 1RC7A 4NXNE 1X49A 4DR1E 4J8ZA 2EWLA 3MHSC 2EORA 2YTDA 2L2KB 3JU0A 3H09A 4NHRA 1IQSA 4DMIA 3QG5C 4WPYA 2YTOA 5KL2A 1X5WA 2G7HA 2LO3A 2EOYA 2EMIA 4MLVA 2LBSB 4JI7E 5IWAE 4LF4E 3FIGA 4ZYGA 2LRSA 4IS1C 2RQLA 2IHR1 4DR6E 2I13A 4X9JA 2EPLX 5A6AA 2B9DA 2EOEA 3J81C 4P78A 1JK2A 5KL7A 2EP3A 2EJ4A 1HNWE 3HTXA 4F6MA 1X6EA 3EPJA 2VQFE 2LMZA 1SFEA 1PJTA 2EZ6A 2LVHA 1N3GA 4BS9A 1XNQE 2EN7A 2E1MA 1ZBQA 2VF1A 4JI8E 4L8NA 1XMOE 1X6HA 1IMUA 1ZU1A 4LTYA 2ODRD 4BBYA 4WXDA 3M99B 4IJDA 4R8OA 4R2PA 4JI4E 2EMKA 2EN4A 2EPNA 2EN1A 2JOXA 3THOB 1JK1A 1QNTA 4ZYHA 2E72A 4WX9A 2GLIA 4O24A 3F6GA 3VYXA 2EN6A 4LF5E 2HHHE 3J7Yp 2JPAA 1AH5A 5A6BA 4X8WA 5KL5A 2HGHA 1DGCA 4KZSA 5KL6A 4DR5E 2L2MA 1N32E 4JI2E 2NABA 3ADJA 4F9AB 3EPKA 4B3RE 2VQEE 1A1FA 2WBTA 5IV8B 5FLXC 4X62E
chains in the Genus database with same CATH topology
5LMNE 4DR3E 2UXCE 4LF6E 3HPZA 3JTZA 5DNYA 2V88A 2DSYA 2ZM6E 1GQEA 4B3TE 4K0KE 2JY9A 1FJGE 1YYOA 4L5NC 4B3SE 4DV0E 2DIXA 2K4VA 2DB2A 3ADGA 4DKKA 1J26A 4BMJA 2DMYA 2B7VA 4LFBE 1SR9A 1X48A 2MC5A 1DQ3A 2LE2A 1RC7A 4NXNE 1X49A 4I8OA 2VE7C 4BCAA 4DR1E 3T1HE 1XMQE 4J8ZA 1IBLE 2E5LE 1HNXE 3VYYA 3F6HA 2EWLA 4DUZE 1O0WA 3IWCA 5LL6R 4F9CB 2M1SA 3C4TA 2H36X 2L2KB 2MDRA 5ADZA 4LF7E 2LUQA 4OX9E 3JU0A 3H09A 4YHHE 1I94E 4DR7E 4M0VA 2WZOA 3MSWA 4JI5E 1QU6A 2JWOA 4DMIA 4DV7E 4WPYA 1T4OA 2NA2A 4DV6E 1HR0E 5A2QC 1XNRE 1ZBTA 5T6JA 2G7HA 2V85A 5LMUE 1YZ9A 2V86A 5BR8E 3AUZA 1T4NA 3HQ1A 2V87A 1X47A 2LBSB 4JI7E 2LJHA 1RQ0A 2FTXB 3FIGA 5IWAE 3DJWA 4LF4E 2LRSA 4X64E 4JI3E 3ADLA 2CPNA 1WHNA 4JI0E 1N36E 2IHR1 2L3JA 2NUGA 4DR6E 4WFTA 2B9DA 4F9BB 3J81C 4P78A 4X66E 2YT4A 3AV0A 5IT9C 1UILA 4M30A 1GZ6A 2B7TA 2LUPB 2RTXA 1HNZE 4NXME 2NUEA 4KHPE 3HPSA 4LF8E 2FV4B 3HTXA 1HNWE 2RS6A 4TUIA 2L3CA 1UHZA 2N3HA 2UXDE 4DV5E 4WSPA 4LU9A 3JAMC 2VQFE 1J5EE 2LMZA 2UUCE 3K6QA 4JI6E 2JOBA 3IWBA 2V89A 2M7QA 1PKPA 1YYWA 3C4BA 3LLHA 4R03A 2EZ6A 4DV4E 2ODRC 2LTSA 4BS9A 1XNQE 2L8TA 2RS7A 4DUYE 2E1MA 2V83A 3T1YE 4AQYE 3ADIA 1ZBQA 2KHXA 2VF1A 2B3TB 2F4VE 2L92A 3IWDA 4JI8E 2M4IA 4L8NA 2KONA 4DV3E 4DR2E 1XMOE 2UUAE 5AE2A 4DV2E 4GEQB 4YY3E 1IBME 4GKJE 3OTOE 4LTYA 2ODRD 3ZOQB 4BBYA 4LFAE 4M2ZA 2MC6A 2JR1A 4F54A 5AASA 4OOGC 1N33E 2JVAA 4R8OA 1WHQA 2L2NA 4BC7A 4JI4E 1EKZA 5AE3A 2N3GA 2UUBE 2YZTA 4LF9E 4JI1E 2JOXA 2LTRA 2UXBE 3J80C 3P1XA 2L33A 4JV5E 1YYKA 4GKKE 3VYXA 4DR4E 3F6GA 1T4LB 4LF5E 2NUFA 1FKAE 2HHHE 3J7Yp 2L6MA 4JYAE 2F8BA 5AE1A 4P7DA 2V8QB 3RMPA 4DV1E 4X8WA 5F3WA 2KOUA 3OMLA 4WYQB 1IBKE 4B3ME 4KZSA 4TUGA 2FGGA 4BC9A 4DR5E 4LFCE 4Q28A 3J7AG 1N34E 2L2MA 1N32E 3KWRA 4JI2E 3VK6A 3ADJA 1DI2A 4F9AB 4B3RE 5CFFE 1WXRA 3HXLA 3LMLA 1STUA 2RSMA 4X65E 2VQEE 2UU9E 5FLXC 3DF6A 4X62E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN E;  4DR3 E;  2UXC E;  4LF6 E;  2ZM6 E;  1GQE A;  4B3T E;  4K0K E;  2JY9 A;  1FJG E;  1YYO A;  4B3S E;  4DV0 E;  2DIX A;  2DB2 A;  3ADG A;  4DKK A;  1J26 A;  2DMY A;  2B7V A;  4LFB E;  1X48 A;  1RC7 A;  4NXN E;  1X49 A;  4DR1 E;  1XMQ E;  3T1H E;  2E5L E;  1IBL E;  2UXD E;  1HNX E;  3VYY A;  4DUZ E;  1O0W A;  3C4T A;  2L2K B;  4LF7 E;  2MDR A;  4OX9 E;  2LUQ A;  1I94 E;  4YHH E;  4DR7 E;  4JI5 E;  1QU6 A;  4DV7 E;  1T4O A;  2NA2 A;  4DV6 E;  1HR0 E;  1XNR E;  1ZBT A;  5LMU E;  1YZ9 A;  5BR8 E;  1T4N A;  1X47 A;  2LBS B;  4JI7 E;  2LJH A;  1RQ0 A;  5IWA E;  4LF4 E;  2LRS A;  4X64 E;  4JI3 E;  3ADL A;  2CPN A;  1WHN A;  4JI0 E;  1N36 E;  2IHR 1;  2L3J A;  2NUG A;  4DR6 E;  4WFT A;  4X66 E;  2YT4 A;  1UIL A;  4M30 A;  2B7T A;  2LUP B;  1HNZ E;  2RTX A;  4NXM E;  2NUE A;  4KHP E;  4LF8 E;  1HNW E;  3HTX A;  2RS6 A;  2L3C A;  1UHZ A;  2N3H A;  4DV5 E;  2VQF E;  1J5E E;  2UUC E;  4JI6 E;  1YYW A;  1PKP A;  2EZ6 A;  3C4B A;  3LLH A;  4DV4 E;  2LTS A;  1XNQ E;  2RS7 A;  4DUY E;  3T1Y E;  4AQY E;  3ADI A;  2KHX A;  2B3T B;  2F4V E;  4JI8 E;  2UUA E;  1XMO E;  4DV3 E;  4DR2 E;  4DV2 E;  4YY3 E;  1IBM E;  4GKJ E;  3OTO E;  4LFA E;  4M2Z A;  1N33 E;  4OOG C;  2JVA A;  1WHQ A;  2L2N A;  4JI4 E;  1EKZ A;  2N3G A;  2UUB E;  4LF9 E;  4JI1 E;  2LTR A;  2UXB E;  3P1X A;  2L33 A;  4JV5 E;  1YYK A;  4GKK E;  3VYX A;  4DR4 E;  1T4L B;  4LF5 E;  2NUF A;  1FKA E;  2HHH E;  3J7Y p;  4JYA E;  4DV1 E;  4X8W A;  4WYQ B;  1IBK E;  4B3M E;  4DR5 E;  4LFC E;  1N34 E;  2L2M A;  1N32 E;  4JI2 E;  3ADJ A;  1DI2 A;  4B3R E;  5CFF E;  2VQE E;  2UU9 E;  1STU A;  2RSM A;  4X65 E;  4X62 E; 
#chains in the Genus database with same CATH topology
 4DR3 E;  2DGC A;  1MEY C;  2WBS A;  2J7J A;  5DNY A;  2EM8 A;  2YSO A;  2DSY A;  1GQE A;  3TQM A;  4K0K E;  2EPP A;  1FJG E;  1YYO A;  4DV0 E;  2DIX A;  2K4V A;  2EMC A;  4O5G A;  4BMJ A;  5A69 A;  4LFB E;  1SR9 A;  2EM7 A;  5IXM B;  2VE7 C;  1IBL E;  2EMW A;  2EE8 A;  3VYY A;  2YPN A;  4F9C B;  2M1S A;  4LF7 E;  4OX9 E;  2EMZ A;  1I94 E;  4YHH E;  2CT1 A;  2WZO A;  4DV7 E;  2JWO A;  1T4O A;  1HR0 E;  4DV6 E;  5LLQ A;  4HTG A;  5T6J A;  2YTN A;  4ZYD A;  5BR8 E;  1LLM C;  2YTP A;  2FTX B;  1UBD C;  3DJW A;  4MLQ A;  2EQ1 A;  2YTQ A;  2GPI A;  3ADL A;  2EPK X;  2EPZ A;  1N36 E;  1AAY A;  4NZV A;  4R2A A;  3THN A;  4RHB B;  4F9B B;  5A6B D;  4O43 A;  1YUJ A;  1GZ6 A;  2B7T A;  2LUP B;  4NXM E;  2ELY A;  5A6J A;  2RS6 A;  4F2J C;  2L3C A;  2N3H A;  4DV5 E;  2EPM X;  1B69 A;  4LU9 A;  3JAM C;  1A1K A;  5AC5 A;  2K7I A;  3K6Q A;  2JOB A;  2ENH A;  2M7Q A;  3C4B A;  2EM5 A;  2ADR A;  2EL5 A;  2ODR C;  2LTS A;  1F2I G;  2RS7 A;  4DUY E;  1RMD A;  2EOI A;  4AQY E;  2KHX A;  4R2S A;  1YPN A;  2L92 A;  2KON A;  2YTJ A;  4DV2 E;  4YY3 E;  4GKJ E;  3ZOQ B;  4M2Z A;  2ELZ A;  2MC6 A;  2JR1 A;  1N33 E;  2EM3 A;  4BC7 A;  1A1L A;  1EKZ A;  2EOZ A;  2N3G A;  1NEI A;  4JI1 E;  2LTR A;  5KL4 A;  3C6K A;  4GKK E;  4R2C A;  1A1I A;  1G2D C;  4JYA E;  5F3W A;  4WSG A;  4RH8 A;  3OML A;  3BBG A;  2EMA A;  4TUG A;  1N34 E;  4M9V C;  2EQ0 A;  1EH7 A;  1DI2 A;  3HXL A;  2UU9 E;  1STU A;  2RSM A;  1YUI A;  1YFH A;  4LF6 E;  1NCS A;  2V88 A;  2EM6 A;  4B3T E;  2JY9 A;  2EMF A;  4B3S E;  2YTF A;  2CSH A;  2DB2 A;  3ADG A;  4DKK A;  2WBU A;  1J26 A;  1WRJ A;  1MGT A;  2DMY A;  2DRP A;  4HEI A;  2UXD E;  4I8O A;  4FK5 C;  2YWQ A;  4R2R A;  4DUZ E;  1O0W A;  3L00 A;  4R2D A;  2H36 X;  1TF3 A;  1TF6 A;  2JXP A;  2LJU A;  3MSW A;  4JI5 E;  1XNR E;  5A2Q C;  1ZBT A;  2PRT A;  2V85 A;  5LMU E;  1YZ9 A;  2EM9 A;  2EOS A;  3AUZ A;  1T4N A;  3HQ1 A;  1A1G A;  1KJK A;  1X47 A;  2RPC A;  4F6N A;  4Q35 B;  4X64 E;  2YTG A;  2EM0 A;  1Z1B A;  2YRM A;  2EPO A;  4JI0 E;  2L3J A;  2EPC A;  2MKN A;  2YTI A;  4X66 E;  1A1J A;  5IT9 C;  4KHP E;  1HNZ E;  2RTX A;  3ECR A;  2HJJ A;  4LF8 E;  2FV4 B;  3BF2 A;  3MHH C;  1X6F A;  1UHZ A;  4TUI A;  3EPL A;  2EOJ A;  2DLK A;  2BBG A;  2EOX A;  2UUC E;  4JI6 E;  3IWB A;  2V89 A;  1YYW A;  1PKP A;  4N4R B;  2EMB A;  2MKD A;  3LLH A;  4R03 A;  2LCE A;  3BGH A;  5TSE A;  3EPH A;  2YRK A;  2L8T A;  4GZN C;  2V83 A;  2WCC 3;  2EOM A;  1T39 A;  2F4V E;  2UUA E;  4DV3 E;  4DR2 E;  2EOH A;  4GEQ B;  2EN3 A;  4LFA E;  4F54 A;  2JYA A;  2JVA A;  4KWY A;  5AE3 A;  1PJQ A;  2GHF A;  2UUB E;  2I9I A;  2EM4 A;  2MDG A;  2UXB E;  2EPX A;  3P1X A;  3J80 C;  1TN9 A;  4JV5 E;  4DR4 E;  2NUF A;  1FKA E;  2L6M A;  2F8B A;  2ENC A;  3RMP A;  2KOU A;  2EPA A;  1IBK E;  4B3M E;  2FGG A;  4BC9 A;  4LFC E;  1G2F C;  3KZY A;  2EOF A;  3EQ1 A;  2YTE A;  4BHB A;  1WXR A;  3LML A;  5A6K A;  2A25 A;  3VHT B;  5LMN E;  4BHC A;  3JTZ A;  1ZAA C;  2ZM6 E;  2R1F A;  4L5N C;  2EPR A;  2EQ3 A;  2MC5 A;  4BCA A;  1XMQ E;  1EH6 A;  2RSI A;  3T1H E;  2E5L E;  1HNX E;  2EN8 A;  3F6H A;  5KL3 A;  3IWC A;  5LL6 R;  4R2Q A;  3C4T A;  2EOQ A;  2MDR A;  2YU5 A;  5ADZ A;  2LUQ A;  2LV2 A;  4DR7 E;  5AC4 A;  4M0V A;  2DMI A;  1QU6 A;  2NA2 A;  3UK3 C;  2EML A;  2CTD A;  2V86 A;  4ZYE A;  2V87 A;  3KZZ A;  2LJH A;  1RQ0 A;  4JI3 E;  2CPN A;  1WHN A;  1EH8 A;  2EPU A;  2EOO A;  2NUG A;  4WFT A;  2YT4 A;  3AV0 A;  1UIL A;  4M30 A;  2NUE A;  3HPS A;  1T38 A;  2JP9 A;  2EMH A;  4WSP A;  1J5E E;  1L4S A;  2EL6 A;  2R76 A;  1YSA C;  4WXC A;  1BB8 A;  4DV4 E;  2YSP A;  3T1Y E;  3ADI A;  2B3T B;  1GTK A;  3IWD A;  2M4I A;  5AE2 A;  1IBM E;  3OTO E;  2EMX A;  1P47 A;  5AAS A;  4OOG C;  1WHQ A;  2L2N A;  4R2E A;  2EM2 A;  2YZT A;  4LF9 E;  1BBO A;  2L33 A;  1PDA A;  2EMG A;  1YYK A;  2Q8U A;  1T4L B;  5AE1 A;  4P7D A;  2V8Q B;  4O4K A;  4DV1 E;  2DLQ A;  2HC5 A;  2D9H A;  4WYQ B;  1IQO A;  2LT7 A;  2EN2 A;  1X3C A;  1A1H A;  2EMY A;  4Q28 A;  3J7A G;  3KWR A;  3C6M A;  2BB8 A;  2M9A A;  2YRH A;  2ENA A;  3VK6 A;  1ZR9 A;  5CFF E;  1BBG A;  4X65 E;  3DF6 A;  2N8X A;  2UXC E;  3HPZ A;  2YU8 A;  2EL4 A;  1WJP A;  3BID A;  1PJS A;  1KYQ A;  2VRD A;  1UN6 B;  2B7V A;  1X48 A;  1DQ3 A;  2LE2 A;  1RC7 A;  4NXN E;  1X49 A;  4DR1 E;  4J8Z A;  2EWL A;  3MHS C;  2EOR A;  2YTD A;  2L2K B;  3JU0 A;  3H09 A;  4NHR A;  1IQS A;  4DMI A;  3QG5 C;  4WPY A;  2YTO A;  5KL2 A;  1X5W A;  2G7H A;  2LO3 A;  2EOY A;  2EMI A;  4MLV A;  2LBS B;  4JI7 E;  5IWA E;  4LF4 E;  3FIG A;  4ZYG A;  2LRS A;  4IS1 C;  2RQL A;  2IHR 1;  4DR6 E;  2I13 A;  4X9J A;  2EPL X;  5A6A A;  2B9D A;  2EOE A;  3J81 C;  4P78 A;  1JK2 A;  5KL7 A;  2EP3 A;  2EJ4 A;  1HNW E;  3HTX A;  4F6M A;  1X6E A;  3EPJ A;  2VQF E;  2LMZ A;  1SFE A;  1PJT A;  2EZ6 A;  2LVH A;  1N3G A;  4BS9 A;  1XNQ E;  2EN7 A;  2E1M A;  1ZBQ A;  2VF1 A;  4JI8 E;  4L8N A;  1XMO E;  1X6H A;  1IMU A;  1ZU1 A;  4LTY A;  2ODR D;  4BBY A;  4WXD A;  3M99 B;  4IJD A;  4R8O A;  4R2P A;  4JI4 E;  2EMK A;  2EN4 A;  2EPN A;  2EN1 A;  2JOX A;  3THO B;  1JK1 A;  1QNT A;  4ZYH A;  2E72 A;  4WX9 A;  2GLI A;  4O24 A;  3F6G A;  3VYX A;  2EN6 A;  4LF5 E;  2HHH E;  3J7Y p;  2JPA A;  1AH5 A;  5A6B A;  4X8W A;  5KL5 A;  2HGH A;  1DGC A;  4KZS A;  5KL6 A;  4DR5 E;  2L2M A;  1N32 E;  4JI2 E;  2NAB A;  3ADJ A;  4F9A B;  3EPK A;  4B3R E;  2VQE E;  1A1F A;  2WBT A;  5IV8 B;  5FLX C;  4X62 E; 
#chains in the Genus database with same CATH homology
 5LMN E;  4DR3 E;  2UXC E;  4LF6 E;  3HPZ A;  3JTZ A;  5DNY A;  2V88 A;  2DSY A;  2ZM6 E;  1GQE A;  4B3T E;  4K0K E;  2JY9 A;  1FJG E;  1YYO A;  4L5N C;  4B3S E;  4DV0 E;  2DIX A;  2K4V A;  2DB2 A;  3ADG A;  4DKK A;  1J26 A;  4BMJ A;  2DMY A;  2B7V A;  4LFB E;  1SR9 A;  1X48 A;  2MC5 A;  1DQ3 A;  2LE2 A;  1RC7 A;  4NXN E;  1X49 A;  4I8O A;  2VE7 C;  4BCA A;  4DR1 E;  3T1H E;  1XMQ E;  4J8Z A;  1IBL E;  2E5L E;  1HNX E;  3VYY A;  3F6H A;  2EWL A;  4DUZ E;  1O0W A;  3IWC A;  5LL6 R;  4F9C B;  2M1S A;  3C4T A;  2H36 X;  2L2K B;  2MDR A;  5ADZ A;  4LF7 E;  2LUQ A;  4OX9 E;  3JU0 A;  3H09 A;  4YHH E;  1I94 E;  4DR7 E;  4M0V A;  2WZO A;  3MSW A;  4JI5 E;  1QU6 A;  2JWO A;  4DMI A;  4DV7 E;  4WPY A;  1T4O A;  2NA2 A;  4DV6 E;  1HR0 E;  5A2Q C;  1XNR E;  1ZBT A;  5T6J A;  2G7H A;  2V85 A;  5LMU E;  1YZ9 A;  2V86 A;  5BR8 E;  3AUZ A;  1T4N A;  3HQ1 A;  2V87 A;  1X47 A;  2LBS B;  4JI7 E;  2LJH A;  1RQ0 A;  2FTX B;  3FIG A;  5IWA E;  3DJW A;  4LF4 E;  2LRS A;  4X64 E;  4JI3 E;  3ADL A;  2CPN A;  1WHN A;  4JI0 E;  1N36 E;  2IHR 1;  2L3J A;  2NUG A;  4DR6 E;  4WFT A;  2B9D A;  4F9B B;  3J81 C;  4P78 A;  4X66 E;  2YT4 A;  3AV0 A;  5IT9 C;  1UIL A;  4M30 A;  1GZ6 A;  2B7T A;  2LUP B;  2RTX A;  1HNZ E;  4NXM E;  2NUE A;  4KHP E;  3HPS A;  4LF8 E;  2FV4 B;  3HTX A;  1HNW E;  2RS6 A;  4TUI A;  2L3C A;  1UHZ A;  2N3H A;  2UXD E;  4DV5 E;  4WSP A;  4LU9 A;  3JAM C;  2VQF E;  1J5E E;  2LMZ A;  2UUC E;  3K6Q A;  4JI6 E;  2JOB A;  3IWB A;  2V89 A;  2M7Q A;  1PKP A;  1YYW A;  3C4B A;  3LLH A;  4R03 A;  2EZ6 A;  4DV4 E;  2ODR C;  2LTS A;  4BS9 A;  1XNQ E;  2L8T A;  2RS7 A;  4DUY E;  2E1M A;  2V83 A;  3T1Y E;  4AQY E;  3ADI A;  1ZBQ A;  2KHX A;  2VF1 A;  2B3T B;  2F4V E;  2L92 A;  3IWD A;  4JI8 E;  2M4I A;  4L8N A;  2KON A;  4DV3 E;  4DR2 E;  1XMO E;  2UUA E;  5AE2 A;  4DV2 E;  4GEQ B;  4YY3 E;  1IBM E;  4GKJ E;  3OTO E;  4LTY A;  2ODR D;  3ZOQ B;  4BBY A;  4LFA E;  4M2Z A;  2MC6 A;  2JR1 A;  4F54 A;  5AAS A;  4OOG C;  1N33 E;  2JVA A;  4R8O A;  1WHQ A;  2L2N A;  4BC7 A;  4JI4 E;  1EKZ A;  5AE3 A;  2N3G A;  2UUB E;  2YZT A;  4LF9 E;  4JI1 E;  2JOX A;  2LTR A;  2UXB E;  3J80 C;  3P1X A;  2L33 A;  4JV5 E;  1YYK A;  4GKK E;  3VYX A;  4DR4 E;  3F6G A;  1T4L B;  4LF5 E;  2NUF A;  1FKA E;  2HHH E;  3J7Y p;  2L6M A;  4JYA E;  2F8B A;  5AE1 A;  4P7D A;  2V8Q B;  3RMP A;  4DV1 E;  4X8W A;  5F3W A;  2KOU A;  3OML A;  4WYQ B;  1IBK E;  4B3M E;  4KZS A;  4TUG A;  2FGG A;  4BC9 A;  4DR5 E;  4LFC E;  4Q28 A;  3J7A G;  1N34 E;  2L2M A;  1N32 E;  3KWR A;  4JI2 E;  3VK6 A;  3ADJ A;  1DI2 A;  4F9A B;  4B3R E;  5CFF E;  1WXR A;  3HXL A;  3LML A;  1STU A;  2RSM A;  4X65 E;  2VQE E;  2UU9 E;  5FLX C;  3DF6 A;  4X62 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...