2EN1A

Solution structure of the c2h2 type zinc finger (region 563-595) of human zinc finger protein 224
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 563-595) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 4
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en1A01
2ELZA 2EMWA 2R1FA 2RPCA 2EJ4A 2YU8A 2EOMA 2EPZA 3EPKA 1AAYA 1TN9A 2DRPA 1A1KA 2EOFA 2EE8A 3EPJA 4IJDA 1TF3A 4X9JA 1X3CA 4R2SA 2I13A 4F2JC 1B69A 2EL6A 1G2FC 2EMAA 2EM4A 2GLIA 4M9VC 2EL5A 2EMKA 2LT7A 2EOZA 2JPAA 2EPRA 2A25A 2BB8A 2EPUA 1A1GA 1A1IA 3EPLA 4R2QA 2EP3A 2EM7A 2LVHA 2EM0A 2EPAA 2YTJA 2YRMA 5KL5A 4IS1C 1ZU1A 2LV2A 4GZNC 2EMZA 1UN6B 1BB8A 1X6EA 2EOSA 2MDGA 4R2RA 1A1HA 2DLKA 2EMIA 2NABA 3UK3C 2EN3A 2PRTA 1WJPA 2ADRA 2EPPA 2YTDA 2GHFA 2EOHA 4WSGA 4R2DA 2HGHA 1JK1A 2EN4A 1X5WA 2YTPA 1JK2A 2EMCA 1A1LA 2EN2A 2WBUA 2ENHA 2M9AA 2DMIA 2RSIA 2WBSA 1LLMC 2YTEA 4F6NA 2EOEA 2EM6A 2LCEA 4R2CA 3EPHA 5KL7A 2ELYA 2EMLA 2EM3A 2DGCA 2EOQA 2EQ1A 2JP9A 1BBOA 2EOOA 1X6FA 2CSHA 2MKDA 2EN6A 2YTFA 1TF6A 2EMHA 4FK5C 2EM9A 2YTQA 2EL4A 2EN8A 2YU5A 2EN7A 2E72A 2YSOA 2EM8A 2EN1A 2WCC3 5KL2A 1DGCA 3M99B 2EMYA 2EQ0A 4F6MA 1UBDC 2WBTA 2EOXA 2LO3A 2YTNA 1X6HA 5KL3A 1G2DC 2EORA 4R2AA 2D9HA 1KJKA 1MEYC 4R2EA 2VRDA 1A1FA 1F2IG 2CTDA 2CT1A 2YTOA 2EPCA 5KL4A 1A1JA 2EM5A 2YTGA 2EMBA 2EOIA 2YSPA 1P47A 1ZR9A 2EM2A 2EMFA 1YSAC 1Z1BA 2YTIA 1YUJA 1ZAAC 2ENAA 2EOJA 2EQ3A 2YRHA 2YRKA 2MKNA 2DLQA 1YUIA 1NCSA 3VHTB 4R2PA 2EOYA 3MHHC 3MHSC 5KL6A 2EMXA 2ENCA 2EMGA 2EPXA 1RMDA 2J7JA
chains in the Genus database with same CATH superfamily
2L6MA 2ELZA 4DR5E 2RPCA 2VE7C 4F54A 4WSPA 2LUQA 2NUEA 4IJDA 5IV8B 4ZYHA 2EWLA 3EQ1A 4DV0E 4F2JC 1B69A 2EMAA 2EM4A 3IWCA 1HR0E 4JI4E 2A25A 2BB8A 1YYWA 4DR3E 3EPLA 1XMQE 2EM7A 2UUCE 2LVHA 4NXNE 4JI6E 3FIGA 4WXCA 2DSYA 2EPAA 5IWAE 4LTYA 3DF6A 5KL5A 2GPIA 4GZNC 4NZVA 2LRSA 2LMZA 4JI3E 1WHQA 4R2RA 2EOSA 2MDGA 1IQSA 2NABA 2EN3A 2R76A 3QG5C 3BIDA 4KHPE 4JI0E 2LJUA 2CPNA 1JK2A 1X5WA 1J26A 2EMCA 3THOB 1A1LA 2Q8UA 4DR7E 2ENHA 1STUA 2M9AA 2DMIA 2LE2A 2WBSA 4DR6E 4K0KE 3J7Yp 2MC6A 2L8TA 2EM6A 2UU9E 3DJWA 4RH8A 2EMLA 3JTZA 5A2QC 1BBOA 2EOOA 2L3JA 2MKDA 2EN6A 1TF6A 4B3TE 2EMHA 4ZYEA 1T38A 4JI8E 4X64E 3IWBA 2JY9A 1DGCA 3M99B 2EMYA 1UBDC 2EOXA 2YTNA 3C6KA 4OOGC 5KL3A 4R2AA 2VQEE 5A6AA 1MEYC 4R2EA 5AE3A 2VRDA 3T1HE 1EH7A 4DUYE 3L00A 2M4IA 2YZTA 4HEIA 4TUGA 3HPSA 1XNQE 2K4VA 2YWQA 2UXCE 2LUPB 3ECRA 3LLHA 4DR1E 4LF5E 1HNWE 3RMPA 3MHSC 4J8ZA 1X47A 4GKJE 2EN4A 2J7JA 4GEQB 4R03A 3AUZA 2EOMA 4DR2E 1A1KA 5A6BA 2EOFA 3EPJA 1DI2A 1YYOA 2MDRA 1X3CA 2I13A 1I94E 4DV2E 2EL6A 5LLQA 1G2FC 4M2ZA 2N3GA 2F4VE 2DMYA 4DV4E 4HTGA 1NEIA 3ADIA 2EPRA 5TSEA 3C4TA 1MGTA 1YPNA 2YPNA 5LMUE 2BBGA 3VYXA 4F9BB 2V83A 1YFHA 4LF8E 2YTJA 2UXDE 4DKKA 4YHHE 4O5GA 5AASA 3LMLA 1ZU1A 2LV2A 4WYQB 5LL6R 2EMZA 1UN6B 2N8XA 5AC5A 3ADGA 4X65E 4Q28A 4X66E 1A1HA 2JOXA 2KOUA 2L2KB 3UK3C 4MLQA 3AV0A 4LF9E 2ADRA 2YTDA 4BCAA 5AC4A 5A6JA 4DUZE 2N3HA 1ZBTA 2UUBE 3KZZA 2FTXB 1IBLE 2YTEA 3EPHA 2MC5A 1BBGA 5A69A 2V87A 2KHXA 1UHZA 5A6BD 2KONA 4JI2E 2B7TA 3T1YE 3IWDA 1YYKA 2EL4A 5DNYA 4DR4E 2L92A 2EN1A 2WCC3 3BF2A 2YT4A 1AH5A 4Q35B 2LO3A 5FLXC 2EORA 1T4NA 1PJTA 4JI1E 4LF6E 4R8OA 4X62E 4LFCE 4NHRA 4B3SE 2YSPA 2B9DA 1ZR9A 2DIXA 4P78A 2LJHA 1YSAC 1RQ0A 1Z1BA 4YY3E 2V86A 2EQ3A 5BR8E 1EH8A 2MKNA 2HHHE 3ZOQB 4WPYA 4GKKE 4L8NA 4P7DA 4B3RE 4R2PA 1T4OA 3KWRA 5KL6A 2HJJA 1PJSA 2RSMA 4WX9A 3HPZA 2EJ4A 2YU8A 1XMOE 2DRPA 2UXBE 2EE8A 2GLIA 4M9VC 2EL5A 3HQ1A 4LF4E 4DV5E 2EOZA 4M0VA 1N33E 2EPUA 1A1GA 1WRJA 2DB2A 3VYYA 5F3WA 4R2QA 1GTKA 1ZBQA 1T39A 3K6QA 2EM0A 2YRMA 1DQ3A 2EPKX 2VF1A 1BB8A 2LTSA 1KYQA 3ADLA 2DLKA 3HTXA 1O0WA 1PJQA 2EPPA 4BHBA 2V85A 2NUFA 2GHFA 5IXMB 2L2MA 4R2DA 2H36X 2YTPA 2RS7A 2EN2A 4LU9A 2WBUA 1LLMC 1IQOA 4F6NA 1PKPA 5KL7A 2ELYA 2V88A 2M1SA 2DGCA 2EOQA 4O4KA 3BBGA 1RC7A 2EQ1A 2JOBA 2JXPA 3F6GA 4KZSA 4NXME 2YTFA 2CSHA 3ADJA 3OTOE 5LMNE 4FK5C 2YTQA 1FKAE 3C6MA 2EN8A 4ZYDA 2YU5A 2EN7A 2EPLX 2L2NA 2YSOA 3TQMA 4LFAE 4B3ME 4OX9E 3H09A 2IHR1 2WBTA 1G2DC 4F9AB 4JYAE 1GZ6A 4F9CB 4WXDA 2B3TB 2WZOA 2L33A 2CTDA 2CT1A 2YTOA 2EPCA 4TUIA 1F2IG 1N3GA 1QNTA 4I8OA 3MSWA 4BBYA 2ODRD 2YTIA 1YUJA 1ZAAC 4AQYE 4DV6E 1L4SA 2V8QB 2I9IA 4N4RB 1GQEA 1QU6A 3VHTB 4BS9A 4KWYA 2EOYA 1XNRE 1J5EE 2EMIA 1RMDA 2EMWA 2JYAA 2R1FA 1N34E 4JV5E 2K7IA 3J80C 3EPKA 2EPZA 1T4LB 1AAYA 1TN9A 2ODRC 1WXRA 2NUGA 1N36E 1SR9A 1TF3A 4X9JA 2E5LE 1EKZA 1IMUA 2F8BA 4R2SA 1WHNA 4M30A 2RQLA 2EZ6A 2VQFE 2EMKA 2LT7A 1UILA 2RS6A 4X8WA 3P1XA 2JPAA 4RHBB 2V89A 4BC7A 4L5NC 1A1IA 1IBKE 3HXLA 2UUAE 2L3CA 2EP3A 1FJGE 2JWOA 2HC5A 3KZYA 2ZM6E 3JAMC 2JVAA 3BGHA 4IS1C 3THNA 1N32E 2FV4B 1X6EA 4DV3E 4DV1E 2PRTA 1WJPA 4JI7E 5AE2A 1EH6A 4BC9A 2EOHA 4WSGA 4DMIA 2HGHA 1JK1A 1X49A 1HNZE 2RSIA 4JI5E 2EOEA 1PDAA 2LCEA 4R2CA 3J81C 3JU0A 2EM3A 5CFFE 2JR1A 2M7QA 2FGGA 2JP9A 1X6FA 3C4BA 5T6JA 2EM9A 3VK6A 4DV7E 2RTXA 3F6HA 3J7AG 5AE1A 2LBSB 2E72A 2EM8A 5KL2A 2G7HA 2EQ0A 4F6MA 4BMJA 1X6HA 2EPNA 1YZ9A 2D9HA 1KJKA 4O43A 1A1FA 1A1JA 5KL4A 2EPMX 1X48A 2EM5A 2YTGA 2EPOA 2EMBA 2NA2A 2EOIA 2LTRA 1P47A 2EM2A 2EMFA 5ADZA 4LF7E 2ENAA 4LFBE 5A6KA 2EOJA 2YRHA 2YRKA 4O24A 4ZYGA 2DLQA 1YUIA 1NCSA 1SFEA 1IBME 4BHCA 4WFTA 2E1MA 5IT9C 1HNXE 2B7VA 3MHHC 3OMLA 2EMXA 2ENCA 2EMGA 4MLVA 2EPXA
chains in the Genus database with same CATH topology
2ELZA 2EMWA 2R1FA 2RPCA 2EJ4A 2YU8A 2EOMA 2EPZA 3EPKA 1AAYA 1TN9A 2DRPA 1A1KA 2EOFA 2EE8A 3EPJA 4IJDA 1TF3A 4X9JA 1X3CA 4R2SA 2I13A 4F2JC 1B69A 2EL6A 1G2FC 2EMAA 2EM4A 2GLIA 4M9VC 2EL5A 2EMKA 2LT7A 2EOZA 2JPAA 2EPRA 2A25A 2BB8A 2EPUA 1A1GA 1A1IA 3EPLA 4R2QA 2EP3A 2EM7A 2LVHA 2EM0A 2EPAA 2YTJA 2YRMA 5KL5A 4IS1C 1ZU1A 2LV2A 4GZNC 2EMZA 1UN6B 1BB8A 1X6EA 2EOSA 2MDGA 4R2RA 1A1HA 2DLKA 2EMIA 2NABA 3UK3C 2EN3A 2PRTA 1WJPA 2ADRA 2EPPA 2YTDA 2GHFA 2EOHA 4WSGA 4R2DA 2HGHA 1JK1A 2EN4A 1X5WA 2YTPA 1JK2A 2EMCA 1A1LA 2EN2A 2WBUA 2ENHA 2M9AA 2DMIA 2RSIA 2WBSA 1LLMC 2YTEA 4F6NA 2EOEA 2EM6A 2LCEA 4R2CA 3EPHA 5KL7A 2ELYA 2EMLA 2EM3A 2DGCA 2EOQA 2EQ1A 2JP9A 1BBOA 2EOOA 1X6FA 2CSHA 2MKDA 2EN6A 2YTFA 1TF6A 2EMHA 4FK5C 2EM9A 2YTQA 2EL4A 2EN8A 2YU5A 2EN7A 2E72A 2YSOA 2EM8A 2EN1A 2WCC3 5KL2A 1DGCA 3M99B 2EMYA 2EQ0A 4F6MA 1UBDC 2WBTA 2EOXA 2LO3A 2YTNA 1X6HA 5KL3A 1G2DC 2EORA 4R2AA 2D9HA 1KJKA 1MEYC 4R2EA 2VRDA 1A1FA 1F2IG 2CTDA 2CT1A 2YTOA 2EPCA 5KL4A 1A1JA 2EM5A 2YTGA 2EMBA 2EOIA 2YSPA 1P47A 1ZR9A 2EM2A 2EMFA 1YSAC 1Z1BA 2YTIA 1YUJA 1ZAAC 2ENAA 2EOJA 2EQ3A 2YRHA 2YRKA 2MKNA 2DLQA 1YUIA 1NCSA 3VHTB 4R2PA 2EOYA 3MHHC 3MHSC 5KL6A 2EMXA 2ENCA 2EMGA 2EPXA 1RMDA 2J7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELZ A;  2EMW A;  2R1F A;  2RPC A;  2EJ4 A;  2YU8 A;  2EOM A;  2EPZ A;  3EPK A;  1AAY A;  1TN9 A;  2DRP A;  1A1K A;  2EOF A;  2EE8 A;  3EPJ A;  4IJD A;  1TF3 A;  4X9J A;  1X3C A;  4R2S A;  2I13 A;  4F2J C;  1B69 A;  2EL6 A;  1G2F C;  2EMA A;  2EM4 A;  2GLI A;  4M9V C;  2EL5 A;  2EMK A;  2LT7 A;  2EOZ A;  2JPA A;  2EPR A;  2A25 A;  2BB8 A;  2EPU A;  1A1G A;  1A1I A;  3EPL A;  4R2Q A;  2EP3 A;  2EM7 A;  2LVH A;  2EM0 A;  2EPA A;  2YTJ A;  2YRM A;  5KL5 A;  4IS1 C;  1ZU1 A;  2LV2 A;  4GZN C;  2EMZ A;  1UN6 B;  1BB8 A;  1X6E A;  2EOS A;  2MDG A;  4R2R A;  1A1H A;  2DLK A;  2EMI A;  2NAB A;  3UK3 C;  2EN3 A;  2PRT A;  1WJP A;  2ADR A;  2EPP A;  2YTD A;  2GHF A;  2EOH A;  4WSG A;  4R2D A;  2HGH A;  1JK1 A;  2EN4 A;  1X5W A;  2YTP A;  1JK2 A;  2EMC A;  1A1L A;  2EN2 A;  2WBU A;  2ENH A;  2M9A A;  2DMI A;  2RSI A;  2WBS A;  1LLM C;  2YTE A;  4F6N A;  2EOE A;  2EM6 A;  2LCE A;  4R2C A;  3EPH A;  5KL7 A;  2ELY A;  2EML A;  2EM3 A;  2DGC A;  2EOQ A;  2EQ1 A;  2JP9 A;  1BBO A;  2EOO A;  1X6F A;  2CSH A;  2MKD A;  2EN6 A;  2YTF A;  1TF6 A;  2EMH A;  4FK5 C;  2EM9 A;  2YTQ A;  2EL4 A;  2EN8 A;  2YU5 A;  2EN7 A;  2E72 A;  2YSO A;  2EM8 A;  2EN1 A;  2WCC 3;  5KL2 A;  1DGC A;  3M99 B;  2EMY A;  2EQ0 A;  4F6M A;  1UBD C;  2WBT A;  2EOX A;  2LO3 A;  2YTN A;  1X6H A;  5KL3 A;  1G2D C;  2EOR A;  4R2A A;  2D9H A;  1KJK A;  1MEY C;  4R2E A;  2VRD A;  1A1F A;  1F2I G;  2CTD A;  2CT1 A;  2YTO A;  2EPC A;  5KL4 A;  1A1J A;  2EM5 A;  2YTG A;  2EMB A;  2EOI A;  2YSP A;  1P47 A;  1ZR9 A;  2EM2 A;  2EMF A;  1YSA C;  1Z1B A;  2YTI A;  1YUJ A;  1ZAA C;  2ENA A;  2EOJ A;  2EQ3 A;  2YRH A;  2YRK A;  2MKN A;  2DLQ A;  1YUI A;  1NCS A;  3VHT B;  4R2P A;  2EOY A;  3MHH C;  3MHS C;  5KL6 A;  2EMX A;  2ENC A;  2EMG A;  2EPX A;  1RMD A;  2J7J A; 
#chains in the Genus database with same CATH topology
 2L6M A;  2ELZ A;  4DR5 E;  2RPC A;  2VE7 C;  4F54 A;  4WSP A;  2LUQ A;  2NUE A;  4IJD A;  5IV8 B;  4ZYH A;  2EWL A;  3EQ1 A;  4DV0 E;  4F2J C;  1B69 A;  2EMA A;  2EM4 A;  3IWC A;  1HR0 E;  4JI4 E;  2A25 A;  2BB8 A;  1YYW A;  4DR3 E;  3EPL A;  1XMQ E;  2EM7 A;  2UUC E;  2LVH A;  4NXN E;  4JI6 E;  3FIG A;  4WXC A;  2DSY A;  2EPA A;  5IWA E;  4LTY A;  3DF6 A;  5KL5 A;  2GPI A;  4GZN C;  4NZV A;  2LRS A;  2LMZ A;  4JI3 E;  1WHQ A;  4R2R A;  2EOS A;  2MDG A;  1IQS A;  2NAB A;  2EN3 A;  2R76 A;  3QG5 C;  3BID A;  4KHP E;  4JI0 E;  2LJU A;  2CPN A;  1JK2 A;  1X5W A;  1J26 A;  2EMC A;  3THO B;  1A1L A;  2Q8U A;  4DR7 E;  2ENH A;  1STU A;  2M9A A;  2DMI A;  2LE2 A;  2WBS A;  4DR6 E;  4K0K E;  3J7Y p;  2MC6 A;  2L8T A;  2EM6 A;  2UU9 E;  3DJW A;  4RH8 A;  2EML A;  3JTZ A;  5A2Q C;  1BBO A;  2EOO A;  2L3J A;  2MKD A;  2EN6 A;  1TF6 A;  4B3T E;  2EMH A;  4ZYE A;  1T38 A;  4JI8 E;  4X64 E;  3IWB A;  2JY9 A;  1DGC A;  3M99 B;  2EMY A;  1UBD C;  2EOX A;  2YTN A;  3C6K A;  4OOG C;  5KL3 A;  4R2A A;  2VQE E;  5A6A A;  1MEY C;  4R2E A;  5AE3 A;  2VRD A;  3T1H E;  1EH7 A;  4DUY E;  3L00 A;  2M4I A;  2YZT A;  4HEI A;  4TUG A;  3HPS A;  1XNQ E;  2K4V A;  2YWQ A;  2UXC E;  2LUP B;  3ECR A;  3LLH A;  4DR1 E;  4LF5 E;  1HNW E;  3RMP A;  3MHS C;  4J8Z A;  1X47 A;  4GKJ E;  2EN4 A;  2J7J A;  4GEQ B;  4R03 A;  3AUZ A;  2EOM A;  4DR2 E;  1A1K A;  5A6B A;  2EOF A;  3EPJ A;  1DI2 A;  1YYO A;  2MDR A;  1X3C A;  2I13 A;  1I94 E;  4DV2 E;  2EL6 A;  5LLQ A;  1G2F C;  4M2Z A;  2N3G A;  2F4V E;  2DMY A;  4DV4 E;  4HTG A;  1NEI A;  3ADI A;  2EPR A;  5TSE A;  3C4T A;  1MGT A;  1YPN A;  2YPN A;  5LMU E;  2BBG A;  3VYX A;  4F9B B;  2V83 A;  1YFH A;  4LF8 E;  2YTJ A;  2UXD E;  4DKK A;  4YHH E;  4O5G A;  5AAS A;  3LML A;  1ZU1 A;  2LV2 A;  4WYQ B;  5LL6 R;  2EMZ A;  1UN6 B;  2N8X A;  5AC5 A;  3ADG A;  4X65 E;  4Q28 A;  4X66 E;  1A1H A;  2JOX A;  2KOU A;  2L2K B;  3UK3 C;  4MLQ A;  3AV0 A;  4LF9 E;  2ADR A;  2YTD A;  4BCA A;  5AC4 A;  5A6J A;  4DUZ E;  2N3H A;  1ZBT A;  2UUB E;  3KZZ A;  2FTX B;  1IBL E;  2YTE A;  3EPH A;  2MC5 A;  1BBG A;  5A69 A;  2V87 A;  2KHX A;  1UHZ A;  5A6B D;  2KON A;  4JI2 E;  2B7T A;  3T1Y E;  3IWD A;  1YYK A;  2EL4 A;  5DNY A;  4DR4 E;  2L92 A;  2EN1 A;  2WCC 3;  3BF2 A;  2YT4 A;  1AH5 A;  4Q35 B;  2LO3 A;  5FLX C;  2EOR A;  1T4N A;  1PJT A;  4JI1 E;  4LF6 E;  4R8O A;  4X62 E;  4LFC E;  4NHR A;  4B3S E;  2YSP A;  2B9D A;  1ZR9 A;  2DIX A;  4P78 A;  2LJH A;  1YSA C;  1RQ0 A;  1Z1B A;  4YY3 E;  2V86 A;  2EQ3 A;  5BR8 E;  1EH8 A;  2MKN A;  2HHH E;  3ZOQ B;  4WPY A;  4GKK E;  4L8N A;  4P7D A;  4B3R E;  4R2P A;  1T4O A;  3KWR A;  5KL6 A;  2HJJ A;  1PJS A;  2RSM A;  4WX9 A;  3HPZ A;  2EJ4 A;  2YU8 A;  1XMO E;  2DRP A;  2UXB E;  2EE8 A;  2GLI A;  4M9V C;  2EL5 A;  3HQ1 A;  4LF4 E;  4DV5 E;  2EOZ A;  4M0V A;  1N33 E;  2EPU A;  1A1G A;  1WRJ A;  2DB2 A;  3VYY A;  5F3W A;  4R2Q A;  1GTK A;  1ZBQ A;  1T39 A;  3K6Q A;  2EM0 A;  2YRM A;  1DQ3 A;  2EPK X;  2VF1 A;  1BB8 A;  2LTS A;  1KYQ A;  3ADL A;  2DLK A;  3HTX A;  1O0W A;  1PJQ A;  2EPP A;  4BHB A;  2V85 A;  2NUF A;  2GHF A;  5IXM B;  2L2M A;  4R2D A;  2H36 X;  2YTP A;  2RS7 A;  2EN2 A;  4LU9 A;  2WBU A;  1LLM C;  1IQO A;  4F6N A;  1PKP A;  5KL7 A;  2ELY A;  2V88 A;  2M1S A;  2DGC A;  2EOQ A;  4O4K A;  3BBG A;  1RC7 A;  2EQ1 A;  2JOB A;  2JXP A;  3F6G A;  4KZS A;  4NXM E;  2YTF A;  2CSH A;  3ADJ A;  3OTO E;  5LMN E;  4FK5 C;  2YTQ A;  1FKA E;  3C6M A;  2EN8 A;  4ZYD A;  2YU5 A;  2EN7 A;  2EPL X;  2L2N A;  2YSO A;  3TQM A;  4LFA E;  4B3M E;  4OX9 E;  3H09 A;  2IHR 1;  2WBT A;  1G2D C;  4F9A B;  4JYA E;  1GZ6 A;  4F9C B;  4WXD A;  2B3T B;  2WZO A;  2L33 A;  2CTD A;  2CT1 A;  2YTO A;  2EPC A;  4TUI A;  1F2I G;  1N3G A;  1QNT A;  4I8O A;  3MSW A;  4BBY A;  2ODR D;  2YTI A;  1YUJ A;  1ZAA C;  4AQY E;  4DV6 E;  1L4S A;  2V8Q B;  2I9I A;  4N4R B;  1GQE A;  1QU6 A;  3VHT B;  4BS9 A;  4KWY A;  2EOY A;  1XNR E;  1J5E E;  2EMI A;  1RMD A;  2EMW A;  2JYA A;  2R1F A;  1N34 E;  4JV5 E;  2K7I A;  3J80 C;  3EPK A;  2EPZ A;  1T4L B;  1AAY A;  1TN9 A;  2ODR C;  1WXR A;  2NUG A;  1N36 E;  1SR9 A;  1TF3 A;  4X9J A;  2E5L E;  1EKZ A;  1IMU A;  2F8B A;  4R2S A;  1WHN A;  4M30 A;  2RQL A;  2EZ6 A;  2VQF E;  2EMK A;  2LT7 A;  1UIL A;  2RS6 A;  4X8W A;  3P1X A;  2JPA A;  4RHB B;  2V89 A;  4BC7 A;  4L5N C;  1A1I A;  1IBK E;  3HXL A;  2UUA E;  2L3C A;  2EP3 A;  1FJG E;  2JWO A;  2HC5 A;  3KZY A;  2ZM6 E;  3JAM C;  2JVA A;  3BGH A;  4IS1 C;  3THN A;  1N32 E;  2FV4 B;  1X6E A;  4DV3 E;  4DV1 E;  2PRT A;  1WJP A;  4JI7 E;  5AE2 A;  1EH6 A;  4BC9 A;  2EOH A;  4WSG A;  4DMI A;  2HGH A;  1JK1 A;  1X49 A;  1HNZ E;  2RSI A;  4JI5 E;  2EOE A;  1PDA A;  2LCE A;  4R2C A;  3J81 C;  3JU0 A;  2EM3 A;  5CFF E;  2JR1 A;  2M7Q A;  2FGG A;  2JP9 A;  1X6F A;  3C4B A;  5T6J A;  2EM9 A;  3VK6 A;  4DV7 E;  2RTX A;  3F6H A;  3J7A G;  5AE1 A;  2LBS B;  2E72 A;  2EM8 A;  5KL2 A;  2G7H A;  2EQ0 A;  4F6M A;  4BMJ A;  1X6H A;  2EPN A;  1YZ9 A;  2D9H A;  1KJK A;  4O43 A;  1A1F A;  1A1J A;  5KL4 A;  2EPM X;  1X48 A;  2EM5 A;  2YTG A;  2EPO A;  2EMB A;  2NA2 A;  2EOI A;  2LTR A;  1P47 A;  2EM2 A;  2EMF A;  5ADZ A;  4LF7 E;  2ENA A;  4LFB E;  5A6K A;  2EOJ A;  2YRH A;  2YRK A;  4O24 A;  4ZYG A;  2DLQ A;  1YUI A;  1NCS A;  1SFE A;  1IBM E;  4BHC A;  4WFT A;  2E1M A;  5IT9 C;  1HNX E;  2B7V A;  3MHH C;  3OML A;  2EMX A;  2ENC A;  2EMG A;  4MLV A;  2EPX A; 
#chains in the Genus database with same CATH homology
 2ELZ A;  2EMW A;  2R1F A;  2RPC A;  2EJ4 A;  2YU8 A;  2EOM A;  2EPZ A;  3EPK A;  1AAY A;  1TN9 A;  2DRP A;  1A1K A;  2EOF A;  2EE8 A;  3EPJ A;  4IJD A;  1TF3 A;  4X9J A;  1X3C A;  4R2S A;  2I13 A;  4F2J C;  1B69 A;  2EL6 A;  1G2F C;  2EMA A;  2EM4 A;  2GLI A;  4M9V C;  2EL5 A;  2EMK A;  2LT7 A;  2EOZ A;  2JPA A;  2EPR A;  2A25 A;  2BB8 A;  2EPU A;  1A1G A;  1A1I A;  3EPL A;  4R2Q A;  2EP3 A;  2EM7 A;  2LVH A;  2EM0 A;  2EPA A;  2YTJ A;  2YRM A;  5KL5 A;  4IS1 C;  1ZU1 A;  2LV2 A;  4GZN C;  2EMZ A;  1UN6 B;  1BB8 A;  1X6E A;  2EOS A;  2MDG A;  4R2R A;  1A1H A;  2DLK A;  2EMI A;  2NAB A;  3UK3 C;  2EN3 A;  2PRT A;  1WJP A;  2ADR A;  2EPP A;  2YTD A;  2GHF A;  2EOH A;  4WSG A;  4R2D A;  2HGH A;  1JK1 A;  2EN4 A;  1X5W A;  2YTP A;  1JK2 A;  2EMC A;  1A1L A;  2EN2 A;  2WBU A;  2ENH A;  2M9A A;  2DMI A;  2RSI A;  2WBS A;  1LLM C;  2YTE A;  4F6N A;  2EOE A;  2EM6 A;  2LCE A;  4R2C A;  3EPH A;  5KL7 A;  2ELY A;  2EML A;  2EM3 A;  2DGC A;  2EOQ A;  2EQ1 A;  2JP9 A;  1BBO A;  2EOO A;  1X6F A;  2CSH A;  2MKD A;  2EN6 A;  2YTF A;  1TF6 A;  2EMH A;  4FK5 C;  2EM9 A;  2YTQ A;  2EL4 A;  2EN8 A;  2YU5 A;  2EN7 A;  2E72 A;  2YSO A;  2EM8 A;  2EN1 A;  2WCC 3;  5KL2 A;  1DGC A;  3M99 B;  2EMY A;  2EQ0 A;  4F6M A;  1UBD C;  2WBT A;  2EOX A;  2LO3 A;  2YTN A;  1X6H A;  5KL3 A;  1G2D C;  2EOR A;  4R2A A;  2D9H A;  1KJK A;  1MEY C;  4R2E A;  2VRD A;  1A1F A;  1F2I G;  2CTD A;  2CT1 A;  2YTO A;  2EPC A;  5KL4 A;  1A1J A;  2EM5 A;  2YTG A;  2EMB A;  2EOI A;  2YSP A;  1P47 A;  1ZR9 A;  2EM2 A;  2EMF A;  1YSA C;  1Z1B A;  2YTI A;  1YUJ A;  1ZAA C;  2ENA A;  2EOJ A;  2EQ3 A;  2YRH A;  2YRK A;  2MKN A;  2DLQ A;  1YUI A;  1NCS A;  3VHT B;  4R2P A;  2EOY A;  3MHH C;  3MHS C;  5KL6 A;  2EMX A;  2ENC A;  2EMG A;  2EPX A;  1RMD A;  2J7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...