2EN1A

Solution structure of the c2h2 type zinc finger (region 563-595) of human zinc finger protein 224
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 563-595) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 4
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en1A01
3MHSC 5KL7A 2EMBA 2EQ1A 2EM3A 2DRPA 1JK1A 2EOZA 3UK3C 1TF6A 4IS1C 2EMZA 2EM7A 2WBSA 2NABA 2WBUA 2EPPA 2LCEA 2I13A 5KL2A 2YRKA 1AAYA 2ENAA 2EOYA 1A1JA 2EPZA 2EOHA 4R2AA 2JP9A 2RSIA 2GLIA 2EN7A 2EMKA 2EOJA 2ENHA 1MEYC 2MKDA 5KL4A 4R2QA 2ELZA 2BB8A 2EMLA 2YTDA 2YU8A 2ELYA 2LV2A 2EM6A 2EPUA 1ZAAC 2EM8A 2YTNA 2LT7A 1A1GA 2EMCA 2YTFA 1B69A 4FK5C 1G2DC 2EPXA 1ZR9A 2YSPA 2YU5A 1P47A 2JPAA 4IJDA 2EPRA 2YSOA 2EN3A 1A1IA 1X6EA 2EP3A 2EM9A 2J7JA 2YTJA 1ZU1A 4R2SA 2EOIA 3EPKA 1F2IG 1UN6B 3MHHC 2DGCA 4M9VC 4F6NA 2EN4A 2CSHA 1YUIA 2EM0A 2YTIA 2EPCA 2EN2A 4GZNC 4F2JC 2DLQA 2A25A 1TF3A 2EL4A 2EMFA 3EPHA 1NCSA 2LO3A 2EM5A 1X5WA 1YUJA 2EOSA 2M9AA 4F6MA 2ADRA 2EOOA 2EN8A 1WJPA 1A1FA 1BB8A 1KJKA 2EORA 4R2RA 1RMDA 5KL5A 4R2PA 2EPAA 1A1HA 2MKNA 2EJ4A 2EE8A 5KL3A 2YRMA 2D9HA 2YTQA 2GHFA 3M99B 2EMWA 2EOQA 1X3CA 4X9JA 1LLMC 1DGCA 1Z1BA 2MDGA 1X6FA 2DLKA 2EMXA 2VRDA 2YTGA 1G2FC 1YSAC 1JK2A 2EL5A 2DMIA 1X6HA 2EM2A 2ENCA 2YTPA 4WSGA 2YTOA 4R2CA 2R1FA 2EN1A 2WCC3 1BBOA 2EMGA 2EOFA 2CT1A 2EMAA 4R2EA 1A1LA 2WBTA 1TN9A 2YTEA 1UBDC 2EOXA 2EM4A 2RPCA 2EOMA 2EL6A 2EMIA 2CTDA 2EQ3A 2EMYA 2LVHA 2E72A 4R2DA 2YRHA 3VHTB 2EQ0A 2EMHA 3EPLA 2EOEA 3EPJA 1A1KA 2EN6A 2HGHA 5KL6A 2PRTA
chains in the Genus database with same CATH superfamily
2EMBA 3K6QA 2EPLX 4GKKE 4HEIA 4O4KA 4IS1C 2EM7A 4DV1E 2WBSA 1XNRE 1X49A 4Q28A 2EPPA 4MLVA 5KL2A 2JP9A 4R2AA 2LJHA 1HNWE 2RSIA 2EOJA 3P1XA 1BBGA 2ENHA 2HJJA 1MEYC 1T38A 5T6JA 4LF7E 4DUZE 2NUFA 2YU8A 2ELYA 2UUAE 2LT7A 2YTFA 3ADLA 1PJTA 4BBYA 2YU5A 2L3JA 2EPRA 3BIDA 2ZM6E 3H09A 2MDRA 2Q8UA 3C6MA 1YPNA 2RTXA 5AE1A 2JOXA 2YPNA 2EOIA 3IWDA 3QG5C 3MHHC 1DQ3A 2WZOA 2DGCA 1HNXE 2EM0A 4OX9E 2M4IA 4JI7E 2A25A 2EL4A 3HTXA 3EPHA 5ADZA 1EH8A 2EOSA 4BS9A 3J81C 2UUCE 1WJPA 2YT4A 5AE3A 1A1FA 2E1MA 1J5EE 4JI8E 1A1HA 5IWAE 1IBLE 2LUQA 4JI2E 2B7TA 3ZOQB 3LLHA 4TUGA 5TSEA 1LLMC 1DI2A 2VQFE 2MDGA 3RMPA 2UUBE 1N33E 1RC7A 1YSAC 4DR5E 2YTPA 4JV5E 2EM2A 2ENCA 2YTOA 2B3TB 2ODRC 3THOB 4KZSA 5A6AA 2CT1A 2V87A 4NXNE 4K0KE 4LFAE 2EL6A 1UHZA 2EMYA 2E72A 4X66E 2YRHA 4GEQB 5AC4A 3OMLA 2DMYA 5CFFE 5IT9C 3EPLA 4O24A 3JU0A 2EWLA 1NEIA 3EPJA 1A1KA 2PRTA 4NHRA 4O5GA 2DRPA 1QNTA 2EM3A 1EKZA 1TF6A 2EMZA 2NABA 4J8ZA 2KHXA 2I13A 2NUGA 2KONA 2YRKA 2LRSA 1FKAE 2B7VA 1A1JA 2EPZA 4WYQB 2EPKX 4ZYDA 3DJWA 4DV6E 2GLIA 3ADIA 2MKDA 2ELZA 2EMLA 3C4BA 3KZZA 4DV4E 2YTDA 2LV2A 4P7DA 3TQMA 2EM6A 2EPUA 1A1GA 3J7AG 4Q35B 1T39A 2EPXA 1ZR9A 3HPZA 4LTYA 2LMZA 4HTGA 4ZYGA 4X65E 5DNYA 1YYOA 3ECRA 2VF1A 2YSOA 2FTXB 1X48A 4LF9E 1IQOA 4M9VC 4F6NA 2EN4A 2CSHA 4B3RE 4M2ZA 1RQ0A 2EPCA 2DSYA 2GPIA 1TF3A 2EMFA 1PKPA 4BC9A 1ZBQA 3EQ1A 4JI3E 4JI5E 3THNA 2M1SA 3IWBA 2IHR1 4OOGC 4F9AB 2K4VA 2YWQA 4JI6E 2V89A 4DV7E 4F6MA 1HR0E 1WXRA 2L3CA 4JI1E 4YY3E 4R2RA 4DV3E 2KOUA 5A69A 5KL5A 1GZ6A 2EJ4A 1MGTA 2UU9E 2YTQA 1PJQA 4X8WA 1X3CA 3C6KA 4BHCA 2HC5A 4X64E 1Z1BA 2L33A 1X6FA 2JY9A 2VE7C 3JTZA 4DUYE 1GQEA 4R03A 1X6HA 2G7HA 1AH5A 4LFCE 2EN1A 2M7QA 2EOFA 1O0WA 4R2EA 2WBTA 2YTEA 1UBDC 3C4TA 2EM4A 2V86A 3AV0A 2EOMA 3DF6A 2F8BA 2EQ3A 2CTDA 2HHHE 1STUA 3T1YE 2EPMX 2V85A 2FV4B 4DR2E 1EH7A 4WPYA 5A6BD 2H36X 4BCAA 2JR1A 3MHSC 5KL7A 4YHHE 2EQ1A 4KWYA 2JVAA 1JK1A 4B3ME 2RS6A 4KHPE 2WBUA 3F6HA 2L2MA 2ENAA 2EOYA 1N36E 5AC5A 4TUIA 1IQSA 2R76A 1N3GA 4JI4E 3IWCA 5KL4A 3BGHA 1EH6A 2JOBA 3LMLA 4BC7A 1ZAAC 2EMCA 4FK5C 1G2DC 1KYQA 4NXME 1T4NA 1P47A 2UXBE 5BR8E 5A6BA 1T4OA 3VYYA 2JPAA 2DIXA 1A1IA 4L8NA 3J7Yp 2YTJA 1XMQE 1F2IG 1UN6B 4DR7E 5IXMB 1YUIA 1YYWA 4LF8E 3F6GA 3KWRA 1X47A 2EN2A 4GZNC 4ZYHA 2EPOA 4F2JC 4DR3E 2DLQA 2EZ6A 2LO3A 2LBSB 1X5WA 1SR9A 2M9AA 2L8TA 2ADRA 1I94E 2MC5A 5A2QC 1BB8A 1PJSA 1RMDA 4NZVA 2EPAA 1N34E 2MKNA 2FGGA 3VYXA 2EE8A 5KL3A 4JI0E 3MSWA 2GHFA 3KZYA 2L6MA 2RQLA 1GTKA 5A6JA 1WHNA 2F4VE 2N3HA 2EPNA 2NUEA 1DGCA 2JYAA 4B3TE 2RSMA 2K7IA 4WX9A 4R8OA 1QU6A 3FIGA 4L5NC 2MC6A 4R2CA 2R1FA 1BBOA 2WCC3 2EMGA 3JAMC 2EMAA 1TN9A 2EOXA 4O43A 3ADJA 2RPCA 4WXCA 3HQ1A 4AQYE 4F54A 1N32E 1ZBTA 2EOEA 4WFTA 3J80C 1JK2A 4LF4E 5KL6A 5LLQA 4LU9A 2EOZA 2ODRD 3UK3C 1YFHA 4DV2E 2LCEA 2V83A 1WRJA 2JWOA 1AAYA 2EOHA 3HPSA 2N3GA 2V8QB 4RH8A 2EMKA 2EN7A 5LMNE 4R2QA 4GKJE 5LL6R 2V88A 2BB8A 4F9CB 5A6KA 1FJGE 4DMIA 1IMUA 2N8XA 4BMJA 4M30A 2EM8A 2YTNA 4P78A 2YZTA 1B69A 3VK6A 3L00A 1XNQE 1YYKA 2YSPA 3T1HE 5IV8B 1IBME 4IJDA 5AASA 2LUPB 2EN3A 1X6EA 1YZ9A 2EP3A 2EM9A 2J7JA 2L92A 4DV0E 1ZU1A 4R2SA 3EPKA 2BBGA 2LE2A 4WSPA 2L2NA 3BBGA 4X62E 2VQEE 2YTIA 2NA2A 4JYAE 4ZYEA 1NCSA 2EM5A 1YUJA 4MLQA 5LMUE 2CPNA 1SFEA 4DV5E 2B9DA 2EOOA 2DB2A 4BHBA 2EN8A 1HNZE 4B3SE 2UXDE 1KJKA 2EORA 1UILA 4DKKA 4R2PA 2I9IA 2RS7A 2YRMA 5F3WA 2D9HA 1IBKE 4LF6E 3BF2A 1XMOE 3M99B 2EMWA 2EOQA 4X9JA 1L4SA 1WHQA 4M0VA 1J26A 4WXDA 2JXPA 4DR4E 4I8OA 2E5LE 2LTSA 2LTRA 2DLKA 2EMXA 2VRDA 2YTGA 1G2FC 4DR6E 4F9BB 2EL5A 2DMIA 1T4LB 4WSGA 1PDAA 2LJUA 1A1LA 2UXCE 4DR1E 3ADGA 4LFBE 2EMIA 4N4RB 3OTOE 5AE2A 2LVHA 4R2DA 2L2KB 4LF5E 3VHTB 2EQ0A 5FLXC 2EMHA 3HXLA 3AUZA 4RHBB 2EN6A 2HGHA
chains in the Genus database with same CATH topology
3MHSC 5KL7A 2EMBA 2EQ1A 2EM3A 2DRPA 1JK1A 2EOZA 3UK3C 1TF6A 4IS1C 2EMZA 2EM7A 2WBSA 2NABA 2WBUA 2EPPA 2LCEA 2I13A 5KL2A 2YRKA 1AAYA 2ENAA 2EOYA 1A1JA 2EPZA 2EOHA 4R2AA 2JP9A 2RSIA 2GLIA 2EN7A 2EMKA 2EOJA 2ENHA 1MEYC 2MKDA 5KL4A 4R2QA 2ELZA 2BB8A 2EMLA 2YTDA 2YU8A 2ELYA 2LV2A 2EM6A 2EPUA 1ZAAC 2EM8A 2YTNA 2LT7A 1A1GA 2EMCA 2YTFA 1B69A 4FK5C 1G2DC 2EPXA 1ZR9A 2YSPA 2YU5A 1P47A 2JPAA 4IJDA 2EPRA 2YSOA 2EN3A 1A1IA 1X6EA 2EP3A 2EM9A 2J7JA 2YTJA 1ZU1A 4R2SA 2EOIA 3EPKA 1F2IG 1UN6B 3MHHC 2DGCA 4M9VC 4F6NA 2EN4A 2CSHA 1YUIA 2EM0A 2YTIA 2EPCA 2EN2A 4GZNC 4F2JC 2DLQA 2A25A 1TF3A 2EL4A 2EMFA 3EPHA 1NCSA 2LO3A 2EM5A 1X5WA 1YUJA 2EOSA 2M9AA 4F6MA 2ADRA 2EOOA 2EN8A 1WJPA 1A1FA 1BB8A 1KJKA 2EORA 4R2RA 1RMDA 5KL5A 4R2PA 2EPAA 1A1HA 2MKNA 2EJ4A 2EE8A 5KL3A 2YRMA 2D9HA 2YTQA 2GHFA 3M99B 2EMWA 2EOQA 1X3CA 4X9JA 1LLMC 1DGCA 1Z1BA 2MDGA 1X6FA 2DLKA 2EMXA 2VRDA 2YTGA 1G2FC 1YSAC 1JK2A 2EL5A 2DMIA 1X6HA 2EM2A 2ENCA 2YTPA 4WSGA 2YTOA 4R2CA 2R1FA 2EN1A 2WCC3 1BBOA 2EMGA 2EOFA 2CT1A 2EMAA 4R2EA 1A1LA 2WBTA 1TN9A 2YTEA 1UBDC 2EOXA 2EM4A 2RPCA 2EOMA 2EL6A 2EMIA 2CTDA 2EQ3A 2EMYA 2LVHA 2E72A 4R2DA 2YRHA 3VHTB 2EQ0A 2EMHA 3EPLA 2EOEA 3EPJA 1A1KA 2EN6A 2HGHA 5KL6A 2PRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS C;  5KL7 A;  2EMB A;  2EQ1 A;  2EM3 A;  2DRP A;  1JK1 A;  2EOZ A;  3UK3 C;  1TF6 A;  4IS1 C;  2EMZ A;  2EM7 A;  2WBS A;  2NAB A;  2WBU A;  2EPP A;  2LCE A;  2I13 A;  5KL2 A;  2YRK A;  1AAY A;  2ENA A;  2EOY A;  1A1J A;  2EPZ A;  2EOH A;  4R2A A;  2JP9 A;  2RSI A;  2GLI A;  2EN7 A;  2EMK A;  2EOJ A;  2ENH A;  1MEY C;  2MKD A;  5KL4 A;  4R2Q A;  2ELZ A;  2BB8 A;  2EML A;  2YTD A;  2YU8 A;  2ELY A;  2LV2 A;  2EM6 A;  2EPU A;  1ZAA C;  2EM8 A;  2YTN A;  2LT7 A;  1A1G A;  2EMC A;  2YTF A;  1B69 A;  4FK5 C;  1G2D C;  2EPX A;  1ZR9 A;  2YSP A;  2YU5 A;  1P47 A;  2JPA A;  4IJD A;  2EPR A;  2YSO A;  2EN3 A;  1A1I A;  1X6E A;  2EP3 A;  2EM9 A;  2J7J A;  2YTJ A;  1ZU1 A;  4R2S A;  2EOI A;  3EPK A;  1F2I G;  1UN6 B;  3MHH C;  2DGC A;  4M9V C;  4F6N A;  2EN4 A;  2CSH A;  1YUI A;  2EM0 A;  2YTI A;  2EPC A;  2EN2 A;  4GZN C;  4F2J C;  2DLQ A;  2A25 A;  1TF3 A;  2EL4 A;  2EMF A;  3EPH A;  1NCS A;  2LO3 A;  2EM5 A;  1X5W A;  1YUJ A;  2EOS A;  2M9A A;  4F6M A;  2ADR A;  2EOO A;  2EN8 A;  1WJP A;  1A1F A;  1BB8 A;  1KJK A;  2EOR A;  4R2R A;  1RMD A;  5KL5 A;  4R2P A;  2EPA A;  1A1H A;  2MKN A;  2EJ4 A;  2EE8 A;  5KL3 A;  2YRM A;  2D9H A;  2YTQ A;  2GHF A;  3M99 B;  2EMW A;  2EOQ A;  1X3C A;  4X9J A;  1LLM C;  1DGC A;  1Z1B A;  2MDG A;  1X6F A;  2DLK A;  2EMX A;  2VRD A;  2YTG A;  1G2F C;  1YSA C;  1JK2 A;  2EL5 A;  2DMI A;  1X6H A;  2EM2 A;  2ENC A;  2YTP A;  4WSG A;  2YTO A;  4R2C A;  2R1F A;  2EN1 A;  2WCC 3;  1BBO A;  2EMG A;  2EOF A;  2CT1 A;  2EMA A;  4R2E A;  1A1L A;  2WBT A;  1TN9 A;  2YTE A;  1UBD C;  2EOX A;  2EM4 A;  2RPC A;  2EOM A;  2EL6 A;  2EMI A;  2CTD A;  2EQ3 A;  2EMY A;  2LVH A;  2E72 A;  4R2D A;  2YRH A;  3VHT B;  2EQ0 A;  2EMH A;  3EPL A;  2EOE A;  3EPJ A;  1A1K A;  2EN6 A;  2HGH A;  5KL6 A;  2PRT A; 
#chains in the Genus database with same CATH topology
 2EMB A;  3K6Q A;  2EPL X;  4GKK E;  4HEI A;  4O4K A;  4IS1 C;  2EM7 A;  4DV1 E;  2WBS A;  1XNR E;  1X49 A;  4Q28 A;  2EPP A;  4MLV A;  5KL2 A;  2JP9 A;  4R2A A;  2LJH A;  1HNW E;  2RSI A;  2EOJ A;  3P1X A;  1BBG A;  2ENH A;  2HJJ A;  1MEY C;  1T38 A;  5T6J A;  4LF7 E;  4DUZ E;  2NUF A;  2YU8 A;  2ELY A;  2UUA E;  2LT7 A;  2YTF A;  3ADL A;  1PJT A;  4BBY A;  2YU5 A;  2L3J A;  2EPR A;  3BID A;  2ZM6 E;  3H09 A;  2MDR A;  2Q8U A;  3C6M A;  1YPN A;  2RTX A;  5AE1 A;  2JOX A;  2YPN A;  2EOI A;  3IWD A;  3QG5 C;  3MHH C;  1DQ3 A;  2WZO A;  2DGC A;  1HNX E;  2EM0 A;  4OX9 E;  2M4I A;  4JI7 E;  2A25 A;  2EL4 A;  3HTX A;  3EPH A;  5ADZ A;  1EH8 A;  2EOS A;  4BS9 A;  3J81 C;  2UUC E;  1WJP A;  2YT4 A;  5AE3 A;  1A1F A;  2E1M A;  1J5E E;  4JI8 E;  1A1H A;  5IWA E;  1IBL E;  2LUQ A;  4JI2 E;  2B7T A;  3ZOQ B;  3LLH A;  4TUG A;  5TSE A;  1LLM C;  1DI2 A;  2VQF E;  2MDG A;  3RMP A;  2UUB E;  1N33 E;  1RC7 A;  1YSA C;  4DR5 E;  2YTP A;  4JV5 E;  2EM2 A;  2ENC A;  2YTO A;  2B3T B;  2ODR C;  3THO B;  4KZS A;  5A6A A;  2CT1 A;  2V87 A;  4NXN E;  4K0K E;  4LFA E;  2EL6 A;  1UHZ A;  2EMY A;  2E72 A;  4X66 E;  2YRH A;  4GEQ B;  5AC4 A;  3OML A;  2DMY A;  5CFF E;  5IT9 C;  3EPL A;  4O24 A;  3JU0 A;  2EWL A;  1NEI A;  3EPJ A;  1A1K A;  2PRT A;  4NHR A;  4O5G A;  2DRP A;  1QNT A;  2EM3 A;  1EKZ A;  1TF6 A;  2EMZ A;  2NAB A;  4J8Z A;  2KHX A;  2I13 A;  2NUG A;  2KON A;  2YRK A;  2LRS A;  1FKA E;  2B7V A;  1A1J A;  2EPZ A;  4WYQ B;  2EPK X;  4ZYD A;  3DJW A;  4DV6 E;  2GLI A;  3ADI A;  2MKD A;  2ELZ A;  2EML A;  3C4B A;  3KZZ A;  4DV4 E;  2YTD A;  2LV2 A;  4P7D A;  3TQM A;  2EM6 A;  2EPU A;  1A1G A;  3J7A G;  4Q35 B;  1T39 A;  2EPX A;  1ZR9 A;  3HPZ A;  4LTY A;  2LMZ A;  4HTG A;  4ZYG A;  4X65 E;  5DNY A;  1YYO A;  3ECR A;  2VF1 A;  2YSO A;  2FTX B;  1X48 A;  4LF9 E;  1IQO A;  4M9V C;  4F6N A;  2EN4 A;  2CSH A;  4B3R E;  4M2Z A;  1RQ0 A;  2EPC A;  2DSY A;  2GPI A;  1TF3 A;  2EMF A;  1PKP A;  4BC9 A;  1ZBQ A;  3EQ1 A;  4JI3 E;  4JI5 E;  3THN A;  2M1S A;  3IWB A;  2IHR 1;  4OOG C;  4F9A B;  2K4V A;  2YWQ A;  4JI6 E;  2V89 A;  4DV7 E;  4F6M A;  1HR0 E;  1WXR A;  2L3C A;  4JI1 E;  4YY3 E;  4R2R A;  4DV3 E;  2KOU A;  5A69 A;  5KL5 A;  1GZ6 A;  2EJ4 A;  1MGT A;  2UU9 E;  2YTQ A;  1PJQ A;  4X8W A;  1X3C A;  3C6K A;  4BHC A;  2HC5 A;  4X64 E;  1Z1B A;  2L33 A;  1X6F A;  2JY9 A;  2VE7 C;  3JTZ A;  4DUY E;  1GQE A;  4R03 A;  1X6H A;  2G7H A;  1AH5 A;  4LFC E;  2EN1 A;  2M7Q A;  2EOF A;  1O0W A;  4R2E A;  2WBT A;  2YTE A;  1UBD C;  3C4T A;  2EM4 A;  2V86 A;  3AV0 A;  2EOM A;  3DF6 A;  2F8B A;  2EQ3 A;  2CTD A;  2HHH E;  1STU A;  3T1Y E;  2EPM X;  2V85 A;  2FV4 B;  4DR2 E;  1EH7 A;  4WPY A;  5A6B D;  2H36 X;  4BCA A;  2JR1 A;  3MHS C;  5KL7 A;  4YHH E;  2EQ1 A;  4KWY A;  2JVA A;  1JK1 A;  4B3M E;  2RS6 A;  4KHP E;  2WBU A;  3F6H A;  2L2M A;  2ENA A;  2EOY A;  1N36 E;  5AC5 A;  4TUI A;  1IQS A;  2R76 A;  1N3G A;  4JI4 E;  3IWC A;  5KL4 A;  3BGH A;  1EH6 A;  2JOB A;  3LML A;  4BC7 A;  1ZAA C;  2EMC A;  4FK5 C;  1G2D C;  1KYQ A;  4NXM E;  1T4N A;  1P47 A;  2UXB E;  5BR8 E;  5A6B A;  1T4O A;  3VYY A;  2JPA A;  2DIX A;  1A1I A;  4L8N A;  3J7Y p;  2YTJ A;  1XMQ E;  1F2I G;  1UN6 B;  4DR7 E;  5IXM B;  1YUI A;  1YYW A;  4LF8 E;  3F6G A;  3KWR A;  1X47 A;  2EN2 A;  4GZN C;  4ZYH A;  2EPO A;  4F2J C;  4DR3 E;  2DLQ A;  2EZ6 A;  2LO3 A;  2LBS B;  1X5W A;  1SR9 A;  2M9A A;  2L8T A;  2ADR A;  1I94 E;  2MC5 A;  5A2Q C;  1BB8 A;  1PJS A;  1RMD A;  4NZV A;  2EPA A;  1N34 E;  2MKN A;  2FGG A;  3VYX A;  2EE8 A;  5KL3 A;  4JI0 E;  3MSW A;  2GHF A;  3KZY A;  2L6M A;  2RQL A;  1GTK A;  5A6J A;  1WHN A;  2F4V E;  2N3H A;  2EPN A;  2NUE A;  1DGC A;  2JYA A;  4B3T E;  2RSM A;  2K7I A;  4WX9 A;  4R8O A;  1QU6 A;  3FIG A;  4L5N C;  2MC6 A;  4R2C A;  2R1F A;  1BBO A;  2WCC 3;  2EMG A;  3JAM C;  2EMA A;  1TN9 A;  2EOX A;  4O43 A;  3ADJ A;  2RPC A;  4WXC A;  3HQ1 A;  4AQY E;  4F54 A;  1N32 E;  1ZBT A;  2EOE A;  4WFT A;  3J80 C;  1JK2 A;  4LF4 E;  5KL6 A;  5LLQ A;  4LU9 A;  2EOZ A;  2ODR D;  3UK3 C;  1YFH A;  4DV2 E;  2LCE A;  2V83 A;  1WRJ A;  2JWO A;  1AAY A;  2EOH A;  3HPS A;  2N3G A;  2V8Q B;  4RH8 A;  2EMK A;  2EN7 A;  5LMN E;  4R2Q A;  4GKJ E;  5LL6 R;  2V88 A;  2BB8 A;  4F9C B;  5A6K A;  1FJG E;  4DMI A;  1IMU A;  2N8X A;  4BMJ A;  4M30 A;  2EM8 A;  2YTN A;  4P78 A;  2YZT A;  1B69 A;  3VK6 A;  3L00 A;  1XNQ E;  1YYK A;  2YSP A;  3T1H E;  5IV8 B;  1IBM E;  4IJD A;  5AAS A;  2LUP B;  2EN3 A;  1X6E A;  1YZ9 A;  2EP3 A;  2EM9 A;  2J7J A;  2L92 A;  4DV0 E;  1ZU1 A;  4R2S A;  3EPK A;  2BBG A;  2LE2 A;  4WSP A;  2L2N A;  3BBG A;  4X62 E;  2VQE E;  2YTI A;  2NA2 A;  4JYA E;  4ZYE A;  1NCS A;  2EM5 A;  1YUJ A;  4MLQ A;  5LMU E;  2CPN A;  1SFE A;  4DV5 E;  2B9D A;  2EOO A;  2DB2 A;  4BHB A;  2EN8 A;  1HNZ E;  4B3S E;  2UXD E;  1KJK A;  2EOR A;  1UIL A;  4DKK A;  4R2P A;  2I9I A;  2RS7 A;  2YRM A;  5F3W A;  2D9H A;  1IBK E;  4LF6 E;  3BF2 A;  1XMO E;  3M99 B;  2EMW A;  2EOQ A;  4X9J A;  1L4S A;  1WHQ A;  4M0V A;  1J26 A;  4WXD A;  2JXP A;  4DR4 E;  4I8O A;  2E5L E;  2LTS A;  2LTR A;  2DLK A;  2EMX A;  2VRD A;  2YTG A;  1G2F C;  4DR6 E;  4F9B B;  2EL5 A;  2DMI A;  1T4L B;  4WSG A;  1PDA A;  2LJU A;  1A1L A;  2UXC E;  4DR1 E;  3ADG A;  4LFB E;  2EMI A;  4N4R B;  3OTO E;  5AE2 A;  2LVH A;  4R2D A;  2L2K B;  4LF5 E;  3VHT B;  2EQ0 A;  5FLX C;  2EMH A;  3HXL A;  3AUZ A;  4RHB B;  2EN6 A;  2HGH A; 
#chains in the Genus database with same CATH homology
 3MHS C;  5KL7 A;  2EMB A;  2EQ1 A;  2EM3 A;  2DRP A;  1JK1 A;  2EOZ A;  3UK3 C;  1TF6 A;  4IS1 C;  2EMZ A;  2EM7 A;  2WBS A;  2NAB A;  2WBU A;  2EPP A;  2LCE A;  2I13 A;  5KL2 A;  2YRK A;  1AAY A;  2ENA A;  2EOY A;  1A1J A;  2EPZ A;  2EOH A;  4R2A A;  2JP9 A;  2RSI A;  2GLI A;  2EN7 A;  2EMK A;  2EOJ A;  2ENH A;  1MEY C;  2MKD A;  5KL4 A;  4R2Q A;  2ELZ A;  2BB8 A;  2EML A;  2YTD A;  2YU8 A;  2ELY A;  2LV2 A;  2EM6 A;  2EPU A;  1ZAA C;  2EM8 A;  2YTN A;  2LT7 A;  1A1G A;  2EMC A;  2YTF A;  1B69 A;  4FK5 C;  1G2D C;  2EPX A;  1ZR9 A;  2YSP A;  2YU5 A;  1P47 A;  2JPA A;  4IJD A;  2EPR A;  2YSO A;  2EN3 A;  1A1I A;  1X6E A;  2EP3 A;  2EM9 A;  2J7J A;  2YTJ A;  1ZU1 A;  4R2S A;  2EOI A;  3EPK A;  1F2I G;  1UN6 B;  3MHH C;  2DGC A;  4M9V C;  4F6N A;  2EN4 A;  2CSH A;  1YUI A;  2EM0 A;  2YTI A;  2EPC A;  2EN2 A;  4GZN C;  4F2J C;  2DLQ A;  2A25 A;  1TF3 A;  2EL4 A;  2EMF A;  3EPH A;  1NCS A;  2LO3 A;  2EM5 A;  1X5W A;  1YUJ A;  2EOS A;  2M9A A;  4F6M A;  2ADR A;  2EOO A;  2EN8 A;  1WJP A;  1A1F A;  1BB8 A;  1KJK A;  2EOR A;  4R2R A;  1RMD A;  5KL5 A;  4R2P A;  2EPA A;  1A1H A;  2MKN A;  2EJ4 A;  2EE8 A;  5KL3 A;  2YRM A;  2D9H A;  2YTQ A;  2GHF A;  3M99 B;  2EMW A;  2EOQ A;  1X3C A;  4X9J A;  1LLM C;  1DGC A;  1Z1B A;  2MDG A;  1X6F A;  2DLK A;  2EMX A;  2VRD A;  2YTG A;  1G2F C;  1YSA C;  1JK2 A;  2EL5 A;  2DMI A;  1X6H A;  2EM2 A;  2ENC A;  2YTP A;  4WSG A;  2YTO A;  4R2C A;  2R1F A;  2EN1 A;  2WCC 3;  1BBO A;  2EMG A;  2EOF A;  2CT1 A;  2EMA A;  4R2E A;  1A1L A;  2WBT A;  1TN9 A;  2YTE A;  1UBD C;  2EOX A;  2EM4 A;  2RPC A;  2EOM A;  2EL6 A;  2EMI A;  2CTD A;  2EQ3 A;  2EMY A;  2LVH A;  2E72 A;  4R2D A;  2YRH A;  3VHT B;  2EQ0 A;  2EMH A;  3EPL A;  2EOE A;  3EPJ A;  1A1K A;  2EN6 A;  2HGH A;  5KL6 A;  2PRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...