2EN1A

Solution structure of the c2h2 type zinc finger (region 563-595) of human zinc finger protein 224
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 563-595) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 4
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en1A01
1RMDA 2GHFA 2BB8A 1JK2A 2EOIA 2E72A 2ELZA 1X3CA 2YU5A 2EORA 5KL5A 2EOFA 1TF3A 2LCEA 2YTPA 2PRTA 2EM6A 2MKDA 4M9VC 1LLMC 2EMLA 2YSPA 1DGCA 2J7JA 2EMFA 1A1HA 2YTIA 2EOYA 1NCSA 4F2JC 2EM2A 2EMWA 3MHHC 1X5WA 2WBSA 2I13A 2YSOA 2A25A 2EP3A 2HGHA 1AAYA 1YSAC 2EL5A 1MEYC 4R2PA 2LT7A 2EOZA 4R2EA 2YTJA 2EOEA 2YTQA 1ZAAC 2EN2A 5KL4A 5KL7A 4GZNC 2ELYA 1ZU1A 2EL6A 3VHTB 2EMBA 1X6FA 2EPRA 1YUJA 2M9AA 1A1KA 1TN9A 3M99B 2CTDA 2EOSA 1A1GA 2EOMA 2EMYA 2DLKA 1TF6A 2WCC3 1P47A 4WSGA 4R2RA 2EM8A 2RPCA 2YTDA 1YUIA 3UK3C 1A1IA 4R2CA 2EN1A 2EOOA 2EMKA 2DMIA 1BB8A 2YTNA 2EM3A 2EN3A 2EPUA 2VRDA 2YTFA 1WJPA 2EOJA 2CSHA 4X9JA 1F2IG 4R2QA 1X6EA 5KL2A 2LVHA 2EM7A 2EQ3A 2NABA 2DGCA 2EOQA 2LV2A 1A1LA 2ENCA 2WBUA 1B69A 2EMZA 4IJDA 2JP9A 4FK5C 2YTGA 2DRPA 4R2DA 2EM4A 2EL4A 2EM9A 2EMHA 4R2SA 2EMGA 2EMCA 2EPAA 2MKNA 2EMXA 1ZR9A 2EN8A 5KL6A 4F6NA 2LO3A 1G2FC 5KL3A 2DLQA 1X6HA 2WBTA 1BBOA 1A1FA 1UN6B 2YRKA 2EPPA 2EQ1A 2CT1A 2EM0A 2RSIA 2EE8A 2YTEA 2EOXA 2ADRA 2EPXA 2GLIA 2EN6A 3EPHA 3EPLA 2EM5A 2EQ0A 3EPJA 1Z1BA 2MDGA 4R2AA 4IS1C 2EPCA 2JPAA 2ENHA 2YTOA 2EJ4A 2YRMA 2YU8A 1G2DC 2EMIA 2EMAA 1UBDC 3MHSC 3EPKA 2EN7A 2YRHA 2EN4A 4F6MA 2EPZA 1JK1A 2R1FA 2EOHA 1A1JA 2ENAA 2D9HA 1KJKA
chains in the Genus database with same CATH superfamily
2L8TA 1HR0E 4DUZE 1AH5A 3C6KA 2WZOA 2YTPA 1FKAE 2M4IA 2MKDA 3ADGA 3TQMA 2DIXA 5A6KA 1LLMC 1N34E 4B3ME 1XNQE 2EMLA 3LMLA 1RQ0A 4TUGA 2V89A 3KZZA 2J7JA 2YTIA 3VYYA 5LMNE 2EPOA 4ZYGA 3MHHC 2WBSA 2EP3A 4MLVA 2FGGA 2HGHA 4HTGA 3C6MA 4R2EA 2UUCE 2YTJA 2EOEA 2L3JA 4O5GA 3J7Yp 2VQFE 2EL6A 2EMBA 4LF8E 2V8QB 2M9AA 1N3GA 4DV0E 2EOSA 2EMYA 2EPKX 2WCC3 4LF4E 4WSGA 1EH7A 5BR8E 5LLQA 5ADZA 3KZYA 3HTXA 2EN1A 5AE2A 4K0KE 3DJWA 2YTNA 4JI8E 4BHBA 1NEIA 1IQSA 3C4TA 4X9JA 5A6BD 3ZOQB 1X6EA 4R2QA 1I94E 4DV5E 2EPLX 2V85A 1EH6A 2YZTA 5AC5A 5DNYA 2EZ6A 2JOXA 5A6BA 3AUZA 2K7IA 2DRPA 2EM4A 1PJQA 2EM9A 2EMHA 4DV4E 4R2SA 3MSWA 2B3TB 3T1YE 2EMCA 4LTYA 4F6NA 1G2FC 3H09A 4ZYEA 1X6HA 2WBTA 2LJHA 1J5EE 1A1FA 1UN6B 1YFHA 2MC6A 2YRKA 4KZSA 3J80C 4KWYA 2EPXA 5AE1A 2EPMX 2GLIA 3EPLA 2EM5A 2EQ0A 1Z1BA 4LF7E 4JI0E 2JXPA 2ENHA 4GEQB 2IHR1 4X62E 1G2DC 3EPKA 2EN7A 4L5NC 1DQ3A 2YWQA 4F6MA 2ZM6E 4YY3E 1HNWE 2N3HA 2D9HA 2UXBE 1WHQA 4M2ZA 4YHHE 4DV3E 1RMDA 4JI4E 1HNXE 2GHFA 3J7AG 3BGHA 4NXME 4DR7E 5KL5A 2L2MA 3BIDA 4F9AB 2L92A 2V87A 1RC7A 2JVAA 2M7QA 2L6MA 3OMLA 2GPIA 1T4NA 4RH8A 4DR3E 3ADLA 2EMFA 1A1HA 2EOYA 5TSEA 2I13A 2YSOA 2A25A 4Q28A 4JYAE 4L8NA 4R2PA 3THNA 3C4BA 1YPNA 5KL4A 5IV8B 5KL7A 4GZNC 2FTXB 3VHTB 2VQEE 1YUJA 3OTOE 2LTRA 2CTDA 1FJGE 1A1GA 2LTSA 2KOUA 4WFTA 4F9BB 1P47A 2RPCA 1IQOA 4OX9E 4R2CA 1N36E 4LFBE 2EMKA 2N8XA 4LF9E 3ECRA 1BB8A 5LMUE 4DR2E 4X8WA 1L4SA 2LBSB 2EN3A 2HC5A 4BMJA 4WXCA 2EOJA 1F2IG 5T6JA 4DR1E 1PKPA 2B7VA 2EOQA 1A1LA 4DR6E 2ENCA 2N3GA 1PJTA 4FK5C 2YTGA 2RTXA 2EL4A 2L33A 2EMGA 2EPAA 4DV7E 2EN8A 1MGTA 2LO3A 3JU0A 5IXMB 1YYKA 4X65E 2FV4B 2L3CA 2HHHE 4B3RE 2EPPA 2EQ1A 2EM0A 4KHPE 3HPZA 2YTEA 2UUBE 4J8ZA 2ADRA 4JV5E 1PJSA 1SR9A 2UXCE 4NXNE 2NUEA 2YRMA 4LF5E 3JAMC 2JY9A 3IWCA 2UU9E 2EMAA 1UILA 2JWOA 2YRHA 4R03A 1QNTA 2NUGA 4LFAE 2ENAA 4WXDA 2L2KB 4X64E 1QU6A 4WSPA 2H36X 3ADIA 1UHZA 4LFCE 1X49A 2BB8A 4ZYDA 2EOIA 2E72A 1X3CA 2YU5A 2EORA 3BF2A 4BCAA 4P7DA 2RS6A 4DV6E 2DMYA 1TF3A 2LCEA 2PRTA 2EM6A 4M9VC 1EKZA 2EWLA 2YSPA 2UUAE 5IT9C 1N32E 3J81C 5IWAE 2UXDE 4LF6E 4M0VA 2EM2A 2EMWA 1X5WA 4B3SE 2EL5A 4BS9A 2LT7A 5A6JA 1XMQE 4MLQA 1IBME 2YTQA 1WHNA 3KWRA 4O43A 1X48A 2CPNA 2VE7C 2MC5A 2NUFA 2EPRA 2R76A 3M99B 2EOMA 1TF6A 4R2RA 4I8OA 1ZBQA 1YUIA 3UK3C 3HPSA 1A1IA 1T38A 4O24A 3EQ1A 4JI6E 2EM3A 2EPUA 2ODRC 2E1MA 2VRDA 1T4LB 1WJPA 3QG5C 4WYQB 2CSHA 3VK6A 5KL2A 2EM7A 1N33E 2EQ3A 2NABA 4N4RB 3AV0A 2V83A 3THOB 2NA2A 2LUQA 3DF6A 2G7HA 1YYOA 4R2DA 2JR1A 4JI5E 2DSYA 2MKNA 2EMXA 1ZR9A 2RSMA 5KL6A 5A69A 5KL3A 2DLQA 4DKKA 1HNZE 4AQYE 2LRSA 1BBOA 2JOBA 5FLXC 2HJJA 4DUYE 2CT1A 2RSIA 2EE8A 1IMUA 3EPHA 2YT4A 3EPJA 5LL6R 2MDGA 1GQEA 2M1SA 2EPCA 4R2AA 4IS1C 2YTOA 4DR5E 4JI1E 4M30A 4JI2E 2YU8A 1STUA 2I9IA 2LMZA 1UBDC 3T1HE 2RS7A 2YPNA 2EPZA 2R1FA 2EOHA 1IBKE 3JTZA 1KJKA 2B7TA 2RQLA 2Q8UA 2DB2A 4P78A 4F54A 1O0WA 1JK2A 4Q35B 2ELZA 3HQ1A 2LE2A 2EOFA 1XMOE 5A6AA 1T39A 5AE3A 2F4VE 4TUIA 2V88A 2LJUA 4NZVA 4GKJE 1DGCA 4BBYA 1NCSA 4X66E 4F2JC 2LUPB 1PDAA 2BBGA 2V86A 3IWDA 1AAYA 1YSAC 2E5LE 1MEYC 2EOZA 4DV1E 4GKKE 1ZAAC 2EN2A 4RHBB 4HEIA 5AASA 2ELYA 4DMIA 1ZU1A 4ZYHA 3F6GA 1X6FA 1WXRA 4JI7E 1A1KA 1X47A 2KHXA 1TN9A 1DI2A 1SFEA 2DLKA 3F6HA 2EM8A 3P1XA 2YTDA 5AC4A 3FIGA 2EOOA 2DMIA 2L2NA 3K6QA 4OOGC 1XNRE 4F9CB 1IBLE 2YTFA 2VF1A 1T4OA 2B9DA 2LVHA 4B3TE 3VYXA 2KONA 2DGCA 4DV2E 2LV2A 2WBUA 1B69A 4WX9A 1YYWA 2EMZA 4IJDA 2ODRD 4LU9A 2JP9A 1BBGA 5CFFE 3RMPA 4JI3E 3ADJA 2EPNA 1EH8A 2F8BA 4DR4E 1YZ9A 4WPYA 3L00A 1GTKA 2K4VA 1GZ6A 2MDRA 5A2QC 3BBGA 4NHRA 1ZBTA 3IWBA 2EOXA 4BC7A 2EN6A 4BHCA 2JYAA 2JPAA 1WRJA 1KYQA 2EJ4A 4R8OA 2EMIA 5F3WA 3HXLA 3MHSC 3LLHA 2EN4A 1J26A 1JK1A 1A1JA 4BC9A 4O4KA
chains in the Genus database with same CATH topology
1RMDA 2GHFA 2BB8A 1JK2A 2EOIA 2E72A 2ELZA 1X3CA 2YU5A 2EORA 5KL5A 2EOFA 1TF3A 2LCEA 2YTPA 2PRTA 2EM6A 2MKDA 4M9VC 1LLMC 2EMLA 2YSPA 1DGCA 2J7JA 2EMFA 1A1HA 2YTIA 2EOYA 1NCSA 4F2JC 2EM2A 2EMWA 3MHHC 1X5WA 2WBSA 2I13A 2YSOA 2A25A 2EP3A 2HGHA 1AAYA 1YSAC 2EL5A 1MEYC 4R2PA 2LT7A 2EOZA 4R2EA 2YTJA 2EOEA 2YTQA 1ZAAC 2EN2A 5KL4A 5KL7A 4GZNC 2ELYA 1ZU1A 2EL6A 3VHTB 2EMBA 1X6FA 2EPRA 1YUJA 2M9AA 1A1KA 1TN9A 3M99B 2CTDA 2EOSA 1A1GA 2EOMA 2EMYA 2DLKA 1TF6A 2WCC3 1P47A 4WSGA 4R2RA 2EM8A 2RPCA 2YTDA 1YUIA 3UK3C 1A1IA 4R2CA 2EN1A 2EOOA 2EMKA 2DMIA 1BB8A 2YTNA 2EM3A 2EN3A 2EPUA 2VRDA 2YTFA 1WJPA 2EOJA 2CSHA 4X9JA 1F2IG 4R2QA 1X6EA 5KL2A 2LVHA 2EM7A 2EQ3A 2NABA 2DGCA 2EOQA 2LV2A 1A1LA 2ENCA 2WBUA 1B69A 2EMZA 4IJDA 2JP9A 4FK5C 2YTGA 2DRPA 4R2DA 2EM4A 2EL4A 2EM9A 2EMHA 4R2SA 2EMGA 2EMCA 2EPAA 2MKNA 2EMXA 1ZR9A 2EN8A 5KL6A 4F6NA 2LO3A 1G2FC 5KL3A 2DLQA 1X6HA 2WBTA 1BBOA 1A1FA 1UN6B 2YRKA 2EPPA 2EQ1A 2CT1A 2EM0A 2RSIA 2EE8A 2YTEA 2EOXA 2ADRA 2EPXA 2GLIA 2EN6A 3EPHA 3EPLA 2EM5A 2EQ0A 3EPJA 1Z1BA 2MDGA 4R2AA 4IS1C 2EPCA 2JPAA 2ENHA 2YTOA 2EJ4A 2YRMA 2YU8A 1G2DC 2EMIA 2EMAA 1UBDC 3MHSC 3EPKA 2EN7A 2YRHA 2EN4A 4F6MA 2EPZA 1JK1A 2R1FA 2EOHA 1A1JA 2ENAA 2D9HA 1KJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMD A;  2GHF A;  2BB8 A;  1JK2 A;  2EOI A;  2E72 A;  2ELZ A;  1X3C A;  2YU5 A;  2EOR A;  5KL5 A;  2EOF A;  1TF3 A;  2LCE A;  2YTP A;  2PRT A;  2EM6 A;  2MKD A;  4M9V C;  1LLM C;  2EML A;  2YSP A;  1DGC A;  2J7J A;  2EMF A;  1A1H A;  2YTI A;  2EOY A;  1NCS A;  4F2J C;  2EM2 A;  2EMW A;  3MHH C;  1X5W A;  2WBS A;  2I13 A;  2YSO A;  2A25 A;  2EP3 A;  2HGH A;  1AAY A;  1YSA C;  2EL5 A;  1MEY C;  4R2P A;  2LT7 A;  2EOZ A;  4R2E A;  2YTJ A;  2EOE A;  2YTQ A;  1ZAA C;  2EN2 A;  5KL4 A;  5KL7 A;  4GZN C;  2ELY A;  1ZU1 A;  2EL6 A;  3VHT B;  2EMB A;  1X6F A;  2EPR A;  1YUJ A;  2M9A A;  1A1K A;  1TN9 A;  3M99 B;  2CTD A;  2EOS A;  1A1G A;  2EOM A;  2EMY A;  2DLK A;  1TF6 A;  2WCC 3;  1P47 A;  4WSG A;  4R2R A;  2EM8 A;  2RPC A;  2YTD A;  1YUI A;  3UK3 C;  1A1I A;  4R2C A;  2EN1 A;  2EOO A;  2EMK A;  2DMI A;  1BB8 A;  2YTN A;  2EM3 A;  2EN3 A;  2EPU A;  2VRD A;  2YTF A;  1WJP A;  2EOJ A;  2CSH A;  4X9J A;  1F2I G;  4R2Q A;  1X6E A;  5KL2 A;  2LVH A;  2EM7 A;  2EQ3 A;  2NAB A;  2DGC A;  2EOQ A;  2LV2 A;  1A1L A;  2ENC A;  2WBU A;  1B69 A;  2EMZ A;  4IJD A;  2JP9 A;  4FK5 C;  2YTG A;  2DRP A;  4R2D A;  2EM4 A;  2EL4 A;  2EM9 A;  2EMH A;  4R2S A;  2EMG A;  2EMC A;  2EPA A;  2MKN A;  2EMX A;  1ZR9 A;  2EN8 A;  5KL6 A;  4F6N A;  2LO3 A;  1G2F C;  5KL3 A;  2DLQ A;  1X6H A;  2WBT A;  1BBO A;  1A1F A;  1UN6 B;  2YRK A;  2EPP A;  2EQ1 A;  2CT1 A;  2EM0 A;  2RSI A;  2EE8 A;  2YTE A;  2EOX A;  2ADR A;  2EPX A;  2GLI A;  2EN6 A;  3EPH A;  3EPL A;  2EM5 A;  2EQ0 A;  3EPJ A;  1Z1B A;  2MDG A;  4R2A A;  4IS1 C;  2EPC A;  2JPA A;  2ENH A;  2YTO A;  2EJ4 A;  2YRM A;  2YU8 A;  1G2D C;  2EMI A;  2EMA A;  1UBD C;  3MHS C;  3EPK A;  2EN7 A;  2YRH A;  2EN4 A;  4F6M A;  2EPZ A;  1JK1 A;  2R1F A;  2EOH A;  1A1J A;  2ENA A;  2D9H A;  1KJK A; 
#chains in the Genus database with same CATH topology
 2L8T A;  1HR0 E;  4DUZ E;  1AH5 A;  3C6K A;  2WZO A;  2YTP A;  1FKA E;  2M4I A;  2MKD A;  3ADG A;  3TQM A;  2DIX A;  5A6K A;  1LLM C;  1N34 E;  4B3M E;  1XNQ E;  2EML A;  3LML A;  1RQ0 A;  4TUG A;  2V89 A;  3KZZ A;  2J7J A;  2YTI A;  3VYY A;  5LMN E;  2EPO A;  4ZYG A;  3MHH C;  2WBS A;  2EP3 A;  4MLV A;  2FGG A;  2HGH A;  4HTG A;  3C6M A;  4R2E A;  2UUC E;  2YTJ A;  2EOE A;  2L3J A;  4O5G A;  3J7Y p;  2VQF E;  2EL6 A;  2EMB A;  4LF8 E;  2V8Q B;  2M9A A;  1N3G A;  4DV0 E;  2EOS A;  2EMY A;  2EPK X;  2WCC 3;  4LF4 E;  4WSG A;  1EH7 A;  5BR8 E;  5LLQ A;  5ADZ A;  3KZY A;  3HTX A;  2EN1 A;  5AE2 A;  4K0K E;  3DJW A;  2YTN A;  4JI8 E;  4BHB A;  1NEI A;  1IQS A;  3C4T A;  4X9J A;  5A6B D;  3ZOQ B;  1X6E A;  4R2Q A;  1I94 E;  4DV5 E;  2EPL X;  2V85 A;  1EH6 A;  2YZT A;  5AC5 A;  5DNY A;  2EZ6 A;  2JOX A;  5A6B A;  3AUZ A;  2K7I A;  2DRP A;  2EM4 A;  1PJQ A;  2EM9 A;  2EMH A;  4DV4 E;  4R2S A;  3MSW A;  2B3T B;  3T1Y E;  2EMC A;  4LTY A;  4F6N A;  1G2F C;  3H09 A;  4ZYE A;  1X6H A;  2WBT A;  2LJH A;  1J5E E;  1A1F A;  1UN6 B;  1YFH A;  2MC6 A;  2YRK A;  4KZS A;  3J80 C;  4KWY A;  2EPX A;  5AE1 A;  2EPM X;  2GLI A;  3EPL A;  2EM5 A;  2EQ0 A;  1Z1B A;  4LF7 E;  4JI0 E;  2JXP A;  2ENH A;  4GEQ B;  2IHR 1;  4X62 E;  1G2D C;  3EPK A;  2EN7 A;  4L5N C;  1DQ3 A;  2YWQ A;  4F6M A;  2ZM6 E;  4YY3 E;  1HNW E;  2N3H A;  2D9H A;  2UXB E;  1WHQ A;  4M2Z A;  4YHH E;  4DV3 E;  1RMD A;  4JI4 E;  1HNX E;  2GHF A;  3J7A G;  3BGH A;  4NXM E;  4DR7 E;  5KL5 A;  2L2M A;  3BID A;  4F9A B;  2L92 A;  2V87 A;  1RC7 A;  2JVA A;  2M7Q A;  2L6M A;  3OML A;  2GPI A;  1T4N A;  4RH8 A;  4DR3 E;  3ADL A;  2EMF A;  1A1H A;  2EOY A;  5TSE A;  2I13 A;  2YSO A;  2A25 A;  4Q28 A;  4JYA E;  4L8N A;  4R2P A;  3THN A;  3C4B A;  1YPN A;  5KL4 A;  5IV8 B;  5KL7 A;  4GZN C;  2FTX B;  3VHT B;  2VQE E;  1YUJ A;  3OTO E;  2LTR A;  2CTD A;  1FJG E;  1A1G A;  2LTS A;  2KOU A;  4WFT A;  4F9B B;  1P47 A;  2RPC A;  1IQO A;  4OX9 E;  4R2C A;  1N36 E;  4LFB E;  2EMK A;  2N8X A;  4LF9 E;  3ECR A;  1BB8 A;  5LMU E;  4DR2 E;  4X8W A;  1L4S A;  2LBS B;  2EN3 A;  2HC5 A;  4BMJ A;  4WXC A;  2EOJ A;  1F2I G;  5T6J A;  4DR1 E;  1PKP A;  2B7V A;  2EOQ A;  1A1L A;  4DR6 E;  2ENC A;  2N3G A;  1PJT A;  4FK5 C;  2YTG A;  2RTX A;  2EL4 A;  2L33 A;  2EMG A;  2EPA A;  4DV7 E;  2EN8 A;  1MGT A;  2LO3 A;  3JU0 A;  5IXM B;  1YYK A;  4X65 E;  2FV4 B;  2L3C A;  2HHH E;  4B3R E;  2EPP A;  2EQ1 A;  2EM0 A;  4KHP E;  3HPZ A;  2YTE A;  2UUB E;  4J8Z A;  2ADR A;  4JV5 E;  1PJS A;  1SR9 A;  2UXC E;  4NXN E;  2NUE A;  2YRM A;  4LF5 E;  3JAM C;  2JY9 A;  3IWC A;  2UU9 E;  2EMA A;  1UIL A;  2JWO A;  2YRH A;  4R03 A;  1QNT A;  2NUG A;  4LFA E;  2ENA A;  4WXD A;  2L2K B;  4X64 E;  1QU6 A;  4WSP A;  2H36 X;  3ADI A;  1UHZ A;  4LFC E;  1X49 A;  2BB8 A;  4ZYD A;  2EOI A;  2E72 A;  1X3C A;  2YU5 A;  2EOR A;  3BF2 A;  4BCA A;  4P7D A;  2RS6 A;  4DV6 E;  2DMY A;  1TF3 A;  2LCE A;  2PRT A;  2EM6 A;  4M9V C;  1EKZ A;  2EWL A;  2YSP A;  2UUA E;  5IT9 C;  1N32 E;  3J81 C;  5IWA E;  2UXD E;  4LF6 E;  4M0V A;  2EM2 A;  2EMW A;  1X5W A;  4B3S E;  2EL5 A;  4BS9 A;  2LT7 A;  5A6J A;  1XMQ E;  4MLQ A;  1IBM E;  2YTQ A;  1WHN A;  3KWR A;  4O43 A;  1X48 A;  2CPN A;  2VE7 C;  2MC5 A;  2NUF A;  2EPR A;  2R76 A;  3M99 B;  2EOM A;  1TF6 A;  4R2R A;  4I8O A;  1ZBQ A;  1YUI A;  3UK3 C;  3HPS A;  1A1I A;  1T38 A;  4O24 A;  3EQ1 A;  4JI6 E;  2EM3 A;  2EPU A;  2ODR C;  2E1M A;  2VRD A;  1T4L B;  1WJP A;  3QG5 C;  4WYQ B;  2CSH A;  3VK6 A;  5KL2 A;  2EM7 A;  1N33 E;  2EQ3 A;  2NAB A;  4N4R B;  3AV0 A;  2V83 A;  3THO B;  2NA2 A;  2LUQ A;  3DF6 A;  2G7H A;  1YYO A;  4R2D A;  2JR1 A;  4JI5 E;  2DSY A;  2MKN A;  2EMX A;  1ZR9 A;  2RSM A;  5KL6 A;  5A69 A;  5KL3 A;  2DLQ A;  4DKK A;  1HNZ E;  4AQY E;  2LRS A;  1BBO A;  2JOB A;  5FLX C;  2HJJ A;  4DUY E;  2CT1 A;  2RSI A;  2EE8 A;  1IMU A;  3EPH A;  2YT4 A;  3EPJ A;  5LL6 R;  2MDG A;  1GQE A;  2M1S A;  2EPC A;  4R2A A;  4IS1 C;  2YTO A;  4DR5 E;  4JI1 E;  4M30 A;  4JI2 E;  2YU8 A;  1STU A;  2I9I A;  2LMZ A;  1UBD C;  3T1H E;  2RS7 A;  2YPN A;  2EPZ A;  2R1F A;  2EOH A;  1IBK E;  3JTZ A;  1KJK A;  2B7T A;  2RQL A;  2Q8U A;  2DB2 A;  4P78 A;  4F54 A;  1O0W A;  1JK2 A;  4Q35 B;  2ELZ A;  3HQ1 A;  2LE2 A;  2EOF A;  1XMO E;  5A6A A;  1T39 A;  5AE3 A;  2F4V E;  4TUI A;  2V88 A;  2LJU A;  4NZV A;  4GKJ E;  1DGC A;  4BBY A;  1NCS A;  4X66 E;  4F2J C;  2LUP B;  1PDA A;  2BBG A;  2V86 A;  3IWD A;  1AAY A;  1YSA C;  2E5L E;  1MEY C;  2EOZ A;  4DV1 E;  4GKK E;  1ZAA C;  2EN2 A;  4RHB B;  4HEI A;  5AAS A;  2ELY A;  4DMI A;  1ZU1 A;  4ZYH A;  3F6G A;  1X6F A;  1WXR A;  4JI7 E;  1A1K A;  1X47 A;  2KHX A;  1TN9 A;  1DI2 A;  1SFE A;  2DLK A;  3F6H A;  2EM8 A;  3P1X A;  2YTD A;  5AC4 A;  3FIG A;  2EOO A;  2DMI A;  2L2N A;  3K6Q A;  4OOG C;  1XNR E;  4F9C B;  1IBL E;  2YTF A;  2VF1 A;  1T4O A;  2B9D A;  2LVH A;  4B3T E;  3VYX A;  2KON A;  2DGC A;  4DV2 E;  2LV2 A;  2WBU A;  1B69 A;  4WX9 A;  1YYW A;  2EMZ A;  4IJD A;  2ODR D;  4LU9 A;  2JP9 A;  1BBG A;  5CFF E;  3RMP A;  4JI3 E;  3ADJ A;  2EPN A;  1EH8 A;  2F8B A;  4DR4 E;  1YZ9 A;  4WPY A;  3L00 A;  1GTK A;  2K4V A;  1GZ6 A;  2MDR A;  5A2Q C;  3BBG A;  4NHR A;  1ZBT A;  3IWB A;  2EOX A;  4BC7 A;  2EN6 A;  4BHC A;  2JYA A;  2JPA A;  1WRJ A;  1KYQ A;  2EJ4 A;  4R8O A;  2EMI A;  5F3W A;  3HXL A;  3MHS C;  3LLH A;  2EN4 A;  1J26 A;  1JK1 A;  1A1J A;  4BC9 A;  4O4K A; 
#chains in the Genus database with same CATH homology
 1RMD A;  2GHF A;  2BB8 A;  1JK2 A;  2EOI A;  2E72 A;  2ELZ A;  1X3C A;  2YU5 A;  2EOR A;  5KL5 A;  2EOF A;  1TF3 A;  2LCE A;  2YTP A;  2PRT A;  2EM6 A;  2MKD A;  4M9V C;  1LLM C;  2EML A;  2YSP A;  1DGC A;  2J7J A;  2EMF A;  1A1H A;  2YTI A;  2EOY A;  1NCS A;  4F2J C;  2EM2 A;  2EMW A;  3MHH C;  1X5W A;  2WBS A;  2I13 A;  2YSO A;  2A25 A;  2EP3 A;  2HGH A;  1AAY A;  1YSA C;  2EL5 A;  1MEY C;  4R2P A;  2LT7 A;  2EOZ A;  4R2E A;  2YTJ A;  2EOE A;  2YTQ A;  1ZAA C;  2EN2 A;  5KL4 A;  5KL7 A;  4GZN C;  2ELY A;  1ZU1 A;  2EL6 A;  3VHT B;  2EMB A;  1X6F A;  2EPR A;  1YUJ A;  2M9A A;  1A1K A;  1TN9 A;  3M99 B;  2CTD A;  2EOS A;  1A1G A;  2EOM A;  2EMY A;  2DLK A;  1TF6 A;  2WCC 3;  1P47 A;  4WSG A;  4R2R A;  2EM8 A;  2RPC A;  2YTD A;  1YUI A;  3UK3 C;  1A1I A;  4R2C A;  2EN1 A;  2EOO A;  2EMK A;  2DMI A;  1BB8 A;  2YTN A;  2EM3 A;  2EN3 A;  2EPU A;  2VRD A;  2YTF A;  1WJP A;  2EOJ A;  2CSH A;  4X9J A;  1F2I G;  4R2Q A;  1X6E A;  5KL2 A;  2LVH A;  2EM7 A;  2EQ3 A;  2NAB A;  2DGC A;  2EOQ A;  2LV2 A;  1A1L A;  2ENC A;  2WBU A;  1B69 A;  2EMZ A;  4IJD A;  2JP9 A;  4FK5 C;  2YTG A;  2DRP A;  4R2D A;  2EM4 A;  2EL4 A;  2EM9 A;  2EMH A;  4R2S A;  2EMG A;  2EMC A;  2EPA A;  2MKN A;  2EMX A;  1ZR9 A;  2EN8 A;  5KL6 A;  4F6N A;  2LO3 A;  1G2F C;  5KL3 A;  2DLQ A;  1X6H A;  2WBT A;  1BBO A;  1A1F A;  1UN6 B;  2YRK A;  2EPP A;  2EQ1 A;  2CT1 A;  2EM0 A;  2RSI A;  2EE8 A;  2YTE A;  2EOX A;  2ADR A;  2EPX A;  2GLI A;  2EN6 A;  3EPH A;  3EPL A;  2EM5 A;  2EQ0 A;  3EPJ A;  1Z1B A;  2MDG A;  4R2A A;  4IS1 C;  2EPC A;  2JPA A;  2ENH A;  2YTO A;  2EJ4 A;  2YRM A;  2YU8 A;  1G2D C;  2EMI A;  2EMA A;  1UBD C;  3MHS C;  3EPK A;  2EN7 A;  2YRH A;  2EN4 A;  4F6M A;  2EPZ A;  1JK1 A;  2R1F A;  2EOH A;  1A1J A;  2ENA A;  2D9H A;  1KJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...