2EN1A

Solution structure of the c2h2 type zinc finger (region 563-595) of human zinc finger protein 224
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 563-595) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 4
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en1A01
1JK1A 2EN1A 2EMZA 2YTPA 3EPHA 1LLMC 3MHHC 4R2EA 2ADRA 5KL5A 1X3CA 1KJKA 2EPXA 1WJPA 2WBUA 2EM3A 4GZNC 2EMFA 2MKNA 2ELYA 2EPRA 4FK5C 2JP9A 1MEYC 1RMDA 2WBSA 3UK3C 4R2RA 2ENCA 2R1FA 5KL3A 2EM0A 2YRMA 3EPJA 2DMIA 1TN9A 1TF3A 1UN6B 2YRKA 2EMKA 1BB8A 1A1LA 2EJ4A 2EMHA 2EOHA 2HGHA 2EQ1A 2EP3A 2YTNA 1X6EA 2ENAA 2EPCA 2A25A 2CT1A 2EPZA 2YTEA 2YTOA 2EN8A 1X6FA 2EPPA 2EPUA 4R2DA 2EM8A 2EM7A 2EMBA 2E72A 4WSGA 2DLQA 1A1IA 1ZU1A 4IJDA 2EOFA 2EOOA 2LCEA 3EPKA 4F2JC 1YSAC 2EL6A 1B69A 3VHTB 4R2SA 2J7JA 1P47A 4R2QA 1DGCA 2EOYA 1UBDC 2EN6A 2EOQA 5KL7A 2EN2A 2YTIA 2GHFA 2DGCA 1G2DC 2EMYA 1ZR9A 2EMWA 2WBTA 2EPAA 2EOEA 1YUJA 2DLKA 2PRTA 2EMIA 5KL2A 4F6NA 2EN3A 2EL5A 1A1KA 4F6MA 1G2FC 2EOXA 1F2IG 2EMCA 5KL4A 2MKDA 2YU8A 2LO3A 2EOIA 1A1GA 2EM5A 3EPLA 1BBOA 2M9AA 2EORA 1X6HA 2NABA 2YTQA 2EE8A 2CSHA 2RPCA 1NCSA 4X9JA 2I13A 2EOSA 2MDGA 1YUIA 2EM2A 1A1FA 3M99B 2YSPA 4IS1C 1TF6A 2EL4A 4R2CA 2WCC3 2D9HA 2LT7A 1X5WA 1A1JA 2EQ0A 2JPAA 2YRHA 2YTGA 2BB8A 2ENHA 3MHSC 2EMXA 2GLIA 2ELZA 2EN7A 2YTDA 2RSIA 2YSOA 2EMGA 5KL6A 2YTJA 2EMAA 2LVHA 4R2AA 4M9VC 2VRDA 1JK2A 4R2PA 2YTFA 2EMLA 2EM6A 2EQ3A 2EM9A 2EOZA 1Z1BA 2YU5A 1A1HA 1AAYA 2EOJA 2EM4A 1ZAAC 2LV2A 2DRPA 2EN4A 2CTDA 2EOMA
chains in the Genus database with same CATH superfamily
2MC6A 1N36E 1HNXE 1T4LB 1KJKA 2EPXA 4R8OA 1WJPA 1N3GA 2MKNA 2EPRA 2V86A 1RMDA 2B7TA 2WBSA 1PDAA 2DB2A 2R1FA 5A6JA 2EM0A 2YRMA 5KL3A 4B3TE 1TF3A 4LF9E 1UN6B 1T38A 4WYQB 2WZOA 2EMKA 2EJ4A 2HGHA 2LJHA 5AE1A 2FV4B 2LJUA 2I9IA 2EN8A 1J5EE 1X6FA 2EPPA 2EPUA 1QU6A 3IWBA 3JTZA 1FKAE 2IHR1 4LU9A 1KYQA 2MC5A 1A1IA 1ZU1A 4TUGA 1DQ3A 2LCEA 3EPKA 4DV0E 1B69A 1PKPA 1IQOA 4R2SA 2J7JA 3THNA 2EOYA 5AASA 4NXNE 4GKKE 4JI0E 1UBDC 2N8XA 2EOQA 4BCAA 2GHFA 2H36X 4DV2E 2RTXA 3HQ1A 3JU0A 3ZOQB 4GKJE 4DKKA 2EOEA 4RH8A 4L5NC 1DI2A 3DF6A 5AE2A 2R76A 4Q35B 2MKDA 2EOIA 4WSPA 2EM5A 2L3CA 3KZZA 2YTQA 2RPCA 3F6HA 1XNQE 1NCSA 2UXDE 4O43A 4X9JA 2M1SA 1YUIA 1GTKA 3M99B 4ZYEA 4IS1C 3AV0A 2D9HA 2F4VE 2LT7A 3C6KA 4JI3E 3T1YE 4J8ZA 1RC7A 2L92A 2EQ0A 4L8NA 2L8TA 2GPIA 4TUIA 2BBGA 3MHSC 1X48A 2MDRA 3OTOE 2V87A 2EPLX 3HXLA 3AUZA 2KOUA 4R03A 3BIDA 5TSEA 4F9CB 1GZ6A 2LVHA 4DR1E 2UU9E 2NUGA 1MGTA 2V89A 5A6AA 2YPNA 5DNYA 2EM9A 2EOZA 1O0WA 5A2QC 2LV2A 1UHZA 1ZBQA 4WX9A 3IWDA 2EN4A 4LTYA 2EOMA 1L4SA 1JK1A 2EN1A 1T39A 1IMUA 3EQ1A 2KONA 3EPHA 3MHHC 3L00A 2V8QB 2ADRA 5KL5A 4KZSA 4LF7E 2EPOA 4JI2E 2N3GA 4FK5C 1EH7A 3QG5C 4O24A 2DMIA 1RQ0A 1PJTA 5LL6R 2M7QA 1T4OA 3T1HE 4BHBA 2EPKX 1A1LA 3BF2A 4OX9E 2ENAA 5A69A 2EPZA 2EWLA 4R2DA 5LLQA 4DR2E 2HC5A 2JR1A 3HTXA 4JI6E 2V83A 3ADLA 4BC9A 1N32E 2UUBE 2B9DA 3ADGA 4I8OA 2EOFA 3KWRA 4IJDA 4ZYGA 1YSAC 3LMLA 5A6BD 4M30A 5AC5A 2LRSA 2HHHE 1DGCA 4MLVA 5ADZA 2LUQA 5KL7A 5IT9C 4WPYA 2YTIA 1STUA 5CFFE 4DR3E 1G2DC 2DGCA 1ZR9A 2EMWA 2K4VA 4DV6E 2WBTA 2EPAA 3VYXA 2JOBA 5IXMB 2DLKA 2EMIA 2V85A 5KL2A 1J26A 2EOXA 5T6JA 5KL4A 1A1GA 3LLHA 2VF1A 2JWOA 2G7HA 1PJSA 1HNZE 1TF6A 1QNTA 2WCC3 2UUAE 2RS7A 2RSMA 2JPAA 2YRHA 2CPNA 2ENHA 3J7AG 2V88A 4LFAE 3TQMA 3THOB 1GQEA 2EN7A 4ZYHA 2RSIA 3H09A 4M0VA 2LMZA 2YTJA 5FLXC 3RMPA 3K6QA 4LFBE 4BBYA 4R2PA 2YTFA 2EM6A 4OOGC 2B7VA 4DR6E 2NA2A 2B3TB 2EOJA 4LF6E 4HTGA 4LFCE 4AQYE 2DRPA 4RHBB 1EH6A 1EH8A 2EPMX 4F54A 3C6MA 2JXPA 1X49A 2EMZA 4YHHE 1LLMC 4LF5E 1X3CA 4O5GA 2DMYA 2N3HA 2EMFA 4X64E 2ELYA 4DV7E 2JP9A 4R2RA 1WHQA 3EPJA 1X47A 4N4RB 4NHRA 2YRKA 4LF8E 4DV3E 4HEIA 2EOHA 1IBKE 4JV5E 1YYWA 1HR0E 2EQ1A 2RQLA 1X6EA 4JI7E 1ZBTA 2EPCA 2A25A 2CT1A 2YTEA 2YTOA 3HPZA 1HNWE 2K7IA 3OMLA 3C4TA 1N33E 2E72A 2ZM6E 2DLQA 4P78A 2LUPB 2EOOA 2EL6A 3VHTB 2JVAA 1AH5A 4MLQA 1P47A 4F9BB 2UUCE 2EN6A 4DUYE 1WHNA 4JI4E 2RS6A 2EMYA 2LE2A 5LMUE 2L2NA 1YUJA 2EL5A 1IBLE 1SR9A 4DV4E 4M2ZA 1F2IG 2LO3A 3EPLA 2M9AA 2EORA 5IWAE 2NABA 5A6KA 1XNRE 4BC7A 4X8WA 5AE3A 1A1FA 4BMJA 2FTXB 2DSYA 2EL4A 2M4IA 4R2CA 4DR7E 1X5WA 1A1JA 4WFTA 2LTRA 3KZYA 3J7Yp 3BBGA 2EMXA 1PJQA 4DV1E 2ELZA 4DR5E 4DV5E 2LBSB 1IQSA 2YTDA 4KWYA 2L3JA 4B3RE 5KL6A 4X65E 1FJGE 2JY9A 4R2AA 2VQFE 2EQ3A 3MSWA 3VYYA 2YU5A 1A1HA 2EM4A 1ZAAC 2HJJA 2CTDA 4K0KE 2YTPA 2YWQA 4R2EA 2VE7C 4JI1E 2UXCE 4BHCA 4X66E 2L2MA 2YT4A 1YFHA 1I94E 2WBUA 2EM3A 2L33A 4GZNC 3FIGA 1MEYC 5F3WA 3UK3C 5A6BA 2ENCA 1TN9A 1WXRA 4JI5E 2NUEA 1BB8A 4DUZE 2EMHA 1YYKA 5IV8B 2Q8UA 2EP3A 2YTNA 4NZVA 3DJWA 4BS9A 5BR8E 2EM8A 2JOXA 2E5LE 2EM7A 2EMBA 4WSGA 2EZ6A 4F2JC 1YYOA 4X62E 1N34E 3VK6A 4R2QA 3P1XA 4O4KA 4ZYDA 4KHPE 2EN2A 4P7DA 4WXCA 2YZTA 2KHXA 3ADIA 5AC4A 4F9AB 2PRTA 4F6NA 2EN3A 1A1KA 5LMNE 4F6MA 4GEQB 1G2FC 3ECRA 2EMCA 3J81C 1UILA 1T4NA 2UXBE 2YU8A 1BBOA 1EKZA 2FGGA 1X6HA 1NEIA 2EE8A 2CSHA 2DIXA 2I13A 2EOSA 4JI8E 2MDGA 4B3ME 2EM2A 1SFEA 2YSPA 2F8BA 3JAMC 3HPSA 1XMOE 4B3SE 4DMIA 2JYAA 2E1MA 2VQEE 4YY3E 3C4BA 1BBGA 2YTGA 3BGHA 4NXME 2BB8A 2L6MA 4Q28A 1IBME 1YPNA 4LF4E 2GLIA 1YZ9A 4WXDA 1XMQE 3J80C 2YSOA 2EMGA 2L2KB 2ODRD 2LTSA 2EMAA 4M9VC 2VRDA 1JK2A 2EMLA 1Z1BA 3F6GA 4JYAE 2ODRC 1AAYA 1WRJA 3ADJA 2EPNA 3IWCA 2NUFA 4DR4E
chains in the Genus database with same CATH topology
1JK1A 2EN1A 2EMZA 2YTPA 3EPHA 1LLMC 3MHHC 4R2EA 2ADRA 5KL5A 1X3CA 1KJKA 2EPXA 1WJPA 2WBUA 2EM3A 4GZNC 2EMFA 2MKNA 2ELYA 2EPRA 4FK5C 2JP9A 1MEYC 1RMDA 2WBSA 3UK3C 4R2RA 2ENCA 2R1FA 5KL3A 2EM0A 2YRMA 3EPJA 2DMIA 1TN9A 1TF3A 1UN6B 2YRKA 2EMKA 1BB8A 1A1LA 2EJ4A 2EMHA 2EOHA 2HGHA 2EQ1A 2EP3A 2YTNA 1X6EA 2ENAA 2EPCA 2A25A 2CT1A 2EPZA 2YTEA 2YTOA 2EN8A 1X6FA 2EPPA 2EPUA 4R2DA 2EM8A 2EM7A 2EMBA 2E72A 4WSGA 2DLQA 1A1IA 1ZU1A 4IJDA 2EOFA 2EOOA 2LCEA 3EPKA 4F2JC 1YSAC 2EL6A 1B69A 3VHTB 4R2SA 2J7JA 1P47A 4R2QA 1DGCA 2EOYA 1UBDC 2EN6A 2EOQA 5KL7A 2EN2A 2YTIA 2GHFA 2DGCA 1G2DC 2EMYA 1ZR9A 2EMWA 2WBTA 2EPAA 2EOEA 1YUJA 2DLKA 2PRTA 2EMIA 5KL2A 4F6NA 2EN3A 2EL5A 1A1KA 4F6MA 1G2FC 2EOXA 1F2IG 2EMCA 5KL4A 2MKDA 2YU8A 2LO3A 2EOIA 1A1GA 2EM5A 3EPLA 1BBOA 2M9AA 2EORA 1X6HA 2NABA 2YTQA 2EE8A 2CSHA 2RPCA 1NCSA 4X9JA 2I13A 2EOSA 2MDGA 1YUIA 2EM2A 1A1FA 3M99B 2YSPA 4IS1C 1TF6A 2EL4A 4R2CA 2WCC3 2D9HA 2LT7A 1X5WA 1A1JA 2EQ0A 2JPAA 2YRHA 2YTGA 2BB8A 2ENHA 3MHSC 2EMXA 2GLIA 2ELZA 2EN7A 2YTDA 2RSIA 2YSOA 2EMGA 5KL6A 2YTJA 2EMAA 2LVHA 4R2AA 4M9VC 2VRDA 1JK2A 4R2PA 2YTFA 2EMLA 2EM6A 2EQ3A 2EM9A 2EOZA 1Z1BA 2YU5A 1A1HA 1AAYA 2EOJA 2EM4A 1ZAAC 2LV2A 2DRPA 2EN4A 2CTDA 2EOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JK1 A;  2EN1 A;  2EMZ A;  2YTP A;  3EPH A;  1LLM C;  3MHH C;  4R2E A;  2ADR A;  5KL5 A;  1X3C A;  1KJK A;  2EPX A;  1WJP A;  2WBU A;  2EM3 A;  4GZN C;  2EMF A;  2MKN A;  2ELY A;  2EPR A;  4FK5 C;  2JP9 A;  1MEY C;  1RMD A;  2WBS A;  3UK3 C;  4R2R A;  2ENC A;  2R1F A;  5KL3 A;  2EM0 A;  2YRM A;  3EPJ A;  2DMI A;  1TN9 A;  1TF3 A;  1UN6 B;  2YRK A;  2EMK A;  1BB8 A;  1A1L A;  2EJ4 A;  2EMH A;  2EOH A;  2HGH A;  2EQ1 A;  2EP3 A;  2YTN A;  1X6E A;  2ENA A;  2EPC A;  2A25 A;  2CT1 A;  2EPZ A;  2YTE A;  2YTO A;  2EN8 A;  1X6F A;  2EPP A;  2EPU A;  4R2D A;  2EM8 A;  2EM7 A;  2EMB A;  2E72 A;  4WSG A;  2DLQ A;  1A1I A;  1ZU1 A;  4IJD A;  2EOF A;  2EOO A;  2LCE A;  3EPK A;  4F2J C;  1YSA C;  2EL6 A;  1B69 A;  3VHT B;  4R2S A;  2J7J A;  1P47 A;  4R2Q A;  1DGC A;  2EOY A;  1UBD C;  2EN6 A;  2EOQ A;  5KL7 A;  2EN2 A;  2YTI A;  2GHF A;  2DGC A;  1G2D C;  2EMY A;  1ZR9 A;  2EMW A;  2WBT A;  2EPA A;  2EOE A;  1YUJ A;  2DLK A;  2PRT A;  2EMI A;  5KL2 A;  4F6N A;  2EN3 A;  2EL5 A;  1A1K A;  4F6M A;  1G2F C;  2EOX A;  1F2I G;  2EMC A;  5KL4 A;  2MKD A;  2YU8 A;  2LO3 A;  2EOI A;  1A1G A;  2EM5 A;  3EPL A;  1BBO A;  2M9A A;  2EOR A;  1X6H A;  2NAB A;  2YTQ A;  2EE8 A;  2CSH A;  2RPC A;  1NCS A;  4X9J A;  2I13 A;  2EOS A;  2MDG A;  1YUI A;  2EM2 A;  1A1F A;  3M99 B;  2YSP A;  4IS1 C;  1TF6 A;  2EL4 A;  4R2C A;  2WCC 3;  2D9H A;  2LT7 A;  1X5W A;  1A1J A;  2EQ0 A;  2JPA A;  2YRH A;  2YTG A;  2BB8 A;  2ENH A;  3MHS C;  2EMX A;  2GLI A;  2ELZ A;  2EN7 A;  2YTD A;  2RSI A;  2YSO A;  2EMG A;  5KL6 A;  2YTJ A;  2EMA A;  2LVH A;  4R2A A;  4M9V C;  2VRD A;  1JK2 A;  4R2P A;  2YTF A;  2EML A;  2EM6 A;  2EQ3 A;  2EM9 A;  2EOZ A;  1Z1B A;  2YU5 A;  1A1H A;  1AAY A;  2EOJ A;  2EM4 A;  1ZAA C;  2LV2 A;  2DRP A;  2EN4 A;  2CTD A;  2EOM A; 
#chains in the Genus database with same CATH topology
 2MC6 A;  1N36 E;  1HNX E;  1T4L B;  1KJK A;  2EPX A;  4R8O A;  1WJP A;  1N3G A;  2MKN A;  2EPR A;  2V86 A;  1RMD A;  2B7T A;  2WBS A;  1PDA A;  2DB2 A;  2R1F A;  5A6J A;  2EM0 A;  2YRM A;  5KL3 A;  4B3T E;  1TF3 A;  4LF9 E;  1UN6 B;  1T38 A;  4WYQ B;  2WZO A;  2EMK A;  2EJ4 A;  2HGH A;  2LJH A;  5AE1 A;  2FV4 B;  2LJU A;  2I9I A;  2EN8 A;  1J5E E;  1X6F A;  2EPP A;  2EPU A;  1QU6 A;  3IWB A;  3JTZ A;  1FKA E;  2IHR 1;  4LU9 A;  1KYQ A;  2MC5 A;  1A1I A;  1ZU1 A;  4TUG A;  1DQ3 A;  2LCE A;  3EPK A;  4DV0 E;  1B69 A;  1PKP A;  1IQO A;  4R2S A;  2J7J A;  3THN A;  2EOY A;  5AAS A;  4NXN E;  4GKK E;  4JI0 E;  1UBD C;  2N8X A;  2EOQ A;  4BCA A;  2GHF A;  2H36 X;  4DV2 E;  2RTX A;  3HQ1 A;  3JU0 A;  3ZOQ B;  4GKJ E;  4DKK A;  2EOE A;  4RH8 A;  4L5N C;  1DI2 A;  3DF6 A;  5AE2 A;  2R76 A;  4Q35 B;  2MKD A;  2EOI A;  4WSP A;  2EM5 A;  2L3C A;  3KZZ A;  2YTQ A;  2RPC A;  3F6H A;  1XNQ E;  1NCS A;  2UXD E;  4O43 A;  4X9J A;  2M1S A;  1YUI A;  1GTK A;  3M99 B;  4ZYE A;  4IS1 C;  3AV0 A;  2D9H A;  2F4V E;  2LT7 A;  3C6K A;  4JI3 E;  3T1Y E;  4J8Z A;  1RC7 A;  2L92 A;  2EQ0 A;  4L8N A;  2L8T A;  2GPI A;  4TUI A;  2BBG A;  3MHS C;  1X48 A;  2MDR A;  3OTO E;  2V87 A;  2EPL X;  3HXL A;  3AUZ A;  2KOU A;  4R03 A;  3BID A;  5TSE A;  4F9C B;  1GZ6 A;  2LVH A;  4DR1 E;  2UU9 E;  2NUG A;  1MGT A;  2V89 A;  5A6A A;  2YPN A;  5DNY A;  2EM9 A;  2EOZ A;  1O0W A;  5A2Q C;  2LV2 A;  1UHZ A;  1ZBQ A;  4WX9 A;  3IWD A;  2EN4 A;  4LTY A;  2EOM A;  1L4S A;  1JK1 A;  2EN1 A;  1T39 A;  1IMU A;  3EQ1 A;  2KON A;  3EPH A;  3MHH C;  3L00 A;  2V8Q B;  2ADR A;  5KL5 A;  4KZS A;  4LF7 E;  2EPO A;  4JI2 E;  2N3G A;  4FK5 C;  1EH7 A;  3QG5 C;  4O24 A;  2DMI A;  1RQ0 A;  1PJT A;  5LL6 R;  2M7Q A;  1T4O A;  3T1H E;  4BHB A;  2EPK X;  1A1L A;  3BF2 A;  4OX9 E;  2ENA A;  5A69 A;  2EPZ A;  2EWL A;  4R2D A;  5LLQ A;  4DR2 E;  2HC5 A;  2JR1 A;  3HTX A;  4JI6 E;  2V83 A;  3ADL A;  4BC9 A;  1N32 E;  2UUB E;  2B9D A;  3ADG A;  4I8O A;  2EOF A;  3KWR A;  4IJD A;  4ZYG A;  1YSA C;  3LML A;  5A6B D;  4M30 A;  5AC5 A;  2LRS A;  2HHH E;  1DGC A;  4MLV A;  5ADZ A;  2LUQ A;  5KL7 A;  5IT9 C;  4WPY A;  2YTI A;  1STU A;  5CFF E;  4DR3 E;  1G2D C;  2DGC A;  1ZR9 A;  2EMW A;  2K4V A;  4DV6 E;  2WBT A;  2EPA A;  3VYX A;  2JOB A;  5IXM B;  2DLK A;  2EMI A;  2V85 A;  5KL2 A;  1J26 A;  2EOX A;  5T6J A;  5KL4 A;  1A1G A;  3LLH A;  2VF1 A;  2JWO A;  2G7H A;  1PJS A;  1HNZ E;  1TF6 A;  1QNT A;  2WCC 3;  2UUA E;  2RS7 A;  2RSM A;  2JPA A;  2YRH A;  2CPN A;  2ENH A;  3J7A G;  2V88 A;  4LFA E;  3TQM A;  3THO B;  1GQE A;  2EN7 A;  4ZYH A;  2RSI A;  3H09 A;  4M0V A;  2LMZ A;  2YTJ A;  5FLX C;  3RMP A;  3K6Q A;  4LFB E;  4BBY A;  4R2P A;  2YTF A;  2EM6 A;  4OOG C;  2B7V A;  4DR6 E;  2NA2 A;  2B3T B;  2EOJ A;  4LF6 E;  4HTG A;  4LFC E;  4AQY E;  2DRP A;  4RHB B;  1EH6 A;  1EH8 A;  2EPM X;  4F54 A;  3C6M A;  2JXP A;  1X49 A;  2EMZ A;  4YHH E;  1LLM C;  4LF5 E;  1X3C A;  4O5G A;  2DMY A;  2N3H A;  2EMF A;  4X64 E;  2ELY A;  4DV7 E;  2JP9 A;  4R2R A;  1WHQ A;  3EPJ A;  1X47 A;  4N4R B;  4NHR A;  2YRK A;  4LF8 E;  4DV3 E;  4HEI A;  2EOH A;  1IBK E;  4JV5 E;  1YYW A;  1HR0 E;  2EQ1 A;  2RQL A;  1X6E A;  4JI7 E;  1ZBT A;  2EPC A;  2A25 A;  2CT1 A;  2YTE A;  2YTO A;  3HPZ A;  1HNW E;  2K7I A;  3OML A;  3C4T A;  1N33 E;  2E72 A;  2ZM6 E;  2DLQ A;  4P78 A;  2LUP B;  2EOO A;  2EL6 A;  3VHT B;  2JVA A;  1AH5 A;  4MLQ A;  1P47 A;  4F9B B;  2UUC E;  2EN6 A;  4DUY E;  1WHN A;  4JI4 E;  2RS6 A;  2EMY A;  2LE2 A;  5LMU E;  2L2N A;  1YUJ A;  2EL5 A;  1IBL E;  1SR9 A;  4DV4 E;  4M2Z A;  1F2I G;  2LO3 A;  3EPL A;  2M9A A;  2EOR A;  5IWA E;  2NAB A;  5A6K A;  1XNR E;  4BC7 A;  4X8W A;  5AE3 A;  1A1F A;  4BMJ A;  2FTX B;  2DSY A;  2EL4 A;  2M4I A;  4R2C A;  4DR7 E;  1X5W A;  1A1J A;  4WFT A;  2LTR A;  3KZY A;  3J7Y p;  3BBG A;  2EMX A;  1PJQ A;  4DV1 E;  2ELZ A;  4DR5 E;  4DV5 E;  2LBS B;  1IQS A;  2YTD A;  4KWY A;  2L3J A;  4B3R E;  5KL6 A;  4X65 E;  1FJG E;  2JY9 A;  4R2A A;  2VQF E;  2EQ3 A;  3MSW A;  3VYY A;  2YU5 A;  1A1H A;  2EM4 A;  1ZAA C;  2HJJ A;  2CTD A;  4K0K E;  2YTP A;  2YWQ A;  4R2E A;  2VE7 C;  4JI1 E;  2UXC E;  4BHC A;  4X66 E;  2L2M A;  2YT4 A;  1YFH A;  1I94 E;  2WBU A;  2EM3 A;  2L33 A;  4GZN C;  3FIG A;  1MEY C;  5F3W A;  3UK3 C;  5A6B A;  2ENC A;  1TN9 A;  1WXR A;  4JI5 E;  2NUE A;  1BB8 A;  4DUZ E;  2EMH A;  1YYK A;  5IV8 B;  2Q8U A;  2EP3 A;  2YTN A;  4NZV A;  3DJW A;  4BS9 A;  5BR8 E;  2EM8 A;  2JOX A;  2E5L E;  2EM7 A;  2EMB A;  4WSG A;  2EZ6 A;  4F2J C;  1YYO A;  4X62 E;  1N34 E;  3VK6 A;  4R2Q A;  3P1X A;  4O4K A;  4ZYD A;  4KHP E;  2EN2 A;  4P7D A;  4WXC A;  2YZT A;  2KHX A;  3ADI A;  5AC4 A;  4F9A B;  2PRT A;  4F6N A;  2EN3 A;  1A1K A;  5LMN E;  4F6M A;  4GEQ B;  1G2F C;  3ECR A;  2EMC A;  3J81 C;  1UIL A;  1T4N A;  2UXB E;  2YU8 A;  1BBO A;  1EKZ A;  2FGG A;  1X6H A;  1NEI A;  2EE8 A;  2CSH A;  2DIX A;  2I13 A;  2EOS A;  4JI8 E;  2MDG A;  4B3M E;  2EM2 A;  1SFE A;  2YSP A;  2F8B A;  3JAM C;  3HPS A;  1XMO E;  4B3S E;  4DMI A;  2JYA A;  2E1M A;  2VQE E;  4YY3 E;  3C4B A;  1BBG A;  2YTG A;  3BGH A;  4NXM E;  2BB8 A;  2L6M A;  4Q28 A;  1IBM E;  1YPN A;  4LF4 E;  2GLI A;  1YZ9 A;  4WXD A;  1XMQ E;  3J80 C;  2YSO A;  2EMG A;  2L2K B;  2ODR D;  2LTS A;  2EMA A;  4M9V C;  2VRD A;  1JK2 A;  2EML A;  1Z1B A;  3F6G A;  4JYA E;  2ODR C;  1AAY A;  1WRJ A;  3ADJ A;  2EPN A;  3IWC A;  2NUF A;  4DR4 E; 
#chains in the Genus database with same CATH homology
 1JK1 A;  2EN1 A;  2EMZ A;  2YTP A;  3EPH A;  1LLM C;  3MHH C;  4R2E A;  2ADR A;  5KL5 A;  1X3C A;  1KJK A;  2EPX A;  1WJP A;  2WBU A;  2EM3 A;  4GZN C;  2EMF A;  2MKN A;  2ELY A;  2EPR A;  4FK5 C;  2JP9 A;  1MEY C;  1RMD A;  2WBS A;  3UK3 C;  4R2R A;  2ENC A;  2R1F A;  5KL3 A;  2EM0 A;  2YRM A;  3EPJ A;  2DMI A;  1TN9 A;  1TF3 A;  1UN6 B;  2YRK A;  2EMK A;  1BB8 A;  1A1L A;  2EJ4 A;  2EMH A;  2EOH A;  2HGH A;  2EQ1 A;  2EP3 A;  2YTN A;  1X6E A;  2ENA A;  2EPC A;  2A25 A;  2CT1 A;  2EPZ A;  2YTE A;  2YTO A;  2EN8 A;  1X6F A;  2EPP A;  2EPU A;  4R2D A;  2EM8 A;  2EM7 A;  2EMB A;  2E72 A;  4WSG A;  2DLQ A;  1A1I A;  1ZU1 A;  4IJD A;  2EOF A;  2EOO A;  2LCE A;  3EPK A;  4F2J C;  1YSA C;  2EL6 A;  1B69 A;  3VHT B;  4R2S A;  2J7J A;  1P47 A;  4R2Q A;  1DGC A;  2EOY A;  1UBD C;  2EN6 A;  2EOQ A;  5KL7 A;  2EN2 A;  2YTI A;  2GHF A;  2DGC A;  1G2D C;  2EMY A;  1ZR9 A;  2EMW A;  2WBT A;  2EPA A;  2EOE A;  1YUJ A;  2DLK A;  2PRT A;  2EMI A;  5KL2 A;  4F6N A;  2EN3 A;  2EL5 A;  1A1K A;  4F6M A;  1G2F C;  2EOX A;  1F2I G;  2EMC A;  5KL4 A;  2MKD A;  2YU8 A;  2LO3 A;  2EOI A;  1A1G A;  2EM5 A;  3EPL A;  1BBO A;  2M9A A;  2EOR A;  1X6H A;  2NAB A;  2YTQ A;  2EE8 A;  2CSH A;  2RPC A;  1NCS A;  4X9J A;  2I13 A;  2EOS A;  2MDG A;  1YUI A;  2EM2 A;  1A1F A;  3M99 B;  2YSP A;  4IS1 C;  1TF6 A;  2EL4 A;  4R2C A;  2WCC 3;  2D9H A;  2LT7 A;  1X5W A;  1A1J A;  2EQ0 A;  2JPA A;  2YRH A;  2YTG A;  2BB8 A;  2ENH A;  3MHS C;  2EMX A;  2GLI A;  2ELZ A;  2EN7 A;  2YTD A;  2RSI A;  2YSO A;  2EMG A;  5KL6 A;  2YTJ A;  2EMA A;  2LVH A;  4R2A A;  4M9V C;  2VRD A;  1JK2 A;  4R2P A;  2YTF A;  2EML A;  2EM6 A;  2EQ3 A;  2EM9 A;  2EOZ A;  1Z1B A;  2YU5 A;  1A1H A;  1AAY A;  2EOJ A;  2EM4 A;  1ZAA C;  2LV2 A;  2DRP A;  2EN4 A;  2CTD A;  2EOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...