2EPPA

Solution structure of the first c2h2 type zinc finger domain of zinc finger protein 278
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
GSSGSSGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the first C2H2 type zinc finger domain of Zinc finger protein 278
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords POZ-, AT hook-, and zinc finger-containing protein 1
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eppA01
4R2EA 2LVHA 1TF3A 2EL4A 4M9VC 1UN6B 2ADRA 2EPPA 2YTGA 2EJ4A 3MHHC 1A1KA 2EOZA 3M99B 2EOMA 4F6MA 2ENHA 2EOXA 2MKDA 2EM8A 2EOHA 2EPXA 2BB8A 2EMKA 2YU8A 2EMXA 2ENAA 2EMIA 2HGHA 4F2JC 2LO3A 1A1JA 2EM9A 2EOQA 2EN8A 5KL3A 3UK3C 2EPCA 2D9HA 2CT1A 1X3CA 2ELYA 2LCEA 2EN1A 1A1LA 4R2RA 2EMLA 2MDGA 1JK2A 2EL6A 1MEYC 2EM2A 1LLMC 1ZU1A 2ELZA 2EOSA 1X5WA 1UBDC 2EM3A 2GHFA 2A25A 2EMWA 5KL2A 4WSGA 2EOOA 2EOFA 2YTFA 2EMYA 2EOIA 2WCC3 1G2FC 4R2AA 2YU5A 2EPRA 2EQ3A 1NCSA 1YUIA 2CSHA 2LT7A 2WBUA 2EN4A 2EQ0A 1RMDA 3VHTB 2EMCA 2YTEA 2I13A 2EN3A 2EMHA 2ENCA 2R1FA 1A1GA 2EM6A 1A1IA 2YTQA 2YSPA 1YUJA 2EORA 4FK5C 4GZNC 1X6HA 2J7JA 4R2DA 2EMAA 3EPJA 4R2PA 1JK1A 4R2CA 1F2IG 2DRPA 3MHSC 2YTOA 1X6EA 2NABA 5KL6A 2EMBA 2EM4A 1A1HA 2DLQA 1TN9A 2RPCA 2YRHA 1DGCA 4X9JA 2EQ1A 2EOEA 4IJDA 1G2DC 2YTJA 3EPKA 1AAYA 1X6FA 2EPAA 3EPHA 2DMIA 2JP9A 2EN6A 2EP3A 2EL5A 1ZR9A 2CTDA 4R2SA 1TF6A 2JPAA 1WJPA 2EMZA 2EN7A 2EPZA 2WBTA 2YRKA 2EMGA 1YSAC 2DGCA 5KL7A 2LV2A 2YTDA 2EN2A 2EM5A 2PRTA 2EOYA 2DLKA 1Z1BA 2MKNA 2WBSA 2YTPA 2EOJA 1BBOA 1P47A 2EPUA 2VRDA 4R2QA 2EE8A 1B69A 4F6NA 1KJKA 5KL5A 2M9AA 2YTNA 1BB8A 2RSIA 1ZAAC 2EM7A 4IS1C 2GLIA 2YSOA 2E72A 2EMFA 2YTIA 3EPLA 5KL4A 2YRMA 2EM0A 1A1FA
chains in the Genus database with same CATH superfamily
1TF3A 2E1MA 2EL4A 4M9VC 4LF8E 2YT4A 2Q8UA 4DR1E 4DV7E 2ENHA 2EOXA 4P78A 5CFFE 2EPMX 2YWQA 2EOHA 4DR3E 1IQOA 5T6JA 2YU8A 2UXCE 2LTRA 2EMIA 5IXMB 1YFHA 4JI6E 3ZOQB 1FJGE 5LMNE 2EM9A 3AUZA 2EN8A 2DIXA 3C4BA 2D9HA 1X3CA 4WSPA 4O5GA 1J5EE 4NXME 2LCEA 1PKPA 2M1SA 1XNRE 1A1LA 2R76A 1XNQE 2EL6A 3J80C 2B7TA 2EM2A 4WYQB 1ZU1A 2ELZA 1T39A 3OMLA 3DF6A 5TSEA 2A25A 2EMYA 4ZYGA 4B3TE 4JYAE 3FIGA 1N36E 1YUIA 5AE1A 1IBKE 1RMDA 4NZVA 3VHTB 2LBSB 1J26A 2EMCA 2LRSA 4DMIA 1A1GA 2ODRC 2EPLX 2YTQA 4O4KA 2YSPA 1N3GA 4LF9E 4LFCE 2DRPA 2BBGA 1WXRA 4RHBB 1T4LB 4NHRA 2DLQA 2DSYA 4MLVA 3HQ1A 1PJTA 2H36X 2EQ1A 4BHCA 1PJQA 1G2DC 2K7IA 3EPKA 2F4VE 3EPHA 2DMIA 2UXDE 1PJSA 3ADIA 2EN6A 3IWCA 1WJPA 3BGHA 2EMGA 1GQEA 4JI8E 5A6BD 2RSMA 1IQSA 5BR8E 1Z1BA 4X66E 2HJJA 4DR5E 1B69A 2I9IA 5KL5A 2M9AA 3BF2A 1BB8A 1N34E 2RSIA 1DI2A 2EMFA 5IWAE 1NEIA 2HC5A 2JOBA 2EM0A 1QNTA 2LVHA 1UN6B 2EPPA 2YTGA 4WXDA 3MHHC 2EOMA 2B3TB 4ZYHA 2N3GA 5ADZA 2V83A 4B3ME 4DR6E 4JI5E 3F6GA 4K0KE 2EPXA 4MLQA 2EMXA 1X48A 4B3RE 2EPOA 3THOB 1XMOE 2LO3A 1XMQE 4YY3E 2MC5A 3HXLA 4M0VA 1SR9A 5A2QC 1HNWE 2F8BA 2DB2A 2RQLA 2UUAE 2L33A 4LTYA 2G7HA 3THNA 5AE2A 1WHNA 2ELYA 4LU9A 2EN1A 2UUBE 4KZSA 1JK2A 1RQ0A 1LLMC 1ZBQA 4DR2E 2EOSA 3ADLA 2ODRD 1UBDC 2EMWA 4WFTA 5KL2A 2UUCE 4WSGA 2V88A 3AV0A 2EOIA 3T1YE 3KWRA 3HPZA 4R2AA 2EZ6A 2EPRA 1EH7A 2EQ0A 4WPYA 2RS7A 2LTSA 2GPIA 2JR1A 2LJUA 1YUJA 4FK5C 4DV4E 3VK6A 3MSWA 2B9DA 4O24A 1IMUA 3JU0A 2YTOA 1X6EA 2NABA 4DV5E 1T4NA 1ZBTA 5A6AA 2B7VA 2RPCA 1DGCA 2EPNA 4RH8A 1RC7A 4BBYA 2YTJA 1EH6A 2EPAA 4YHHE 2V85A 2FTXB 3K6QA 4R2SA 2JPAA 3ECRA 2M4IA 4P7DA 1N33E 2LUPB 5KL7A 1GZ6A 2EWLA 2DLKA 2WBSA 2EOJA 1P47A 4R2QA 2EE8A 2ZM6E 3VYXA 1KJKA 2JY9A 1KYQA 4Q28A 5FLXC 5A69A 3KZYA 4IS1C 2WZOA 2YSOA 2E72A 2LJHA 2MC6A 3LLHA 5KL4A 2YRMA 2EPUA 4R2EA 1X47A 3QG5C 2ADRA 2EJ4A 4KHPE 3DJWA 3KZZA 2VQFE 1YPNA 4BHBA 3L00A 1L4SA 4M30A 2BB8A 4NXNE 2EMKA 4F2JC 1A1JA 1BBGA 2MDRA 3J7Yp 2EOQA 5KL3A 4DV1E 3JTZA 2EPCA 4ZYDA 4R8OA 2CT1A 2FV4B 1FKAE 2NUFA 4HEIA 4L8NA 5AE3A 2KHXA 4R2RA 4JI4E 2UXBE 1QU6A 1MEYC 4DR4E 2L92A 2V89A 2L8TA 5AASA 2CPNA 2EM3A 2GHFA 2EOFA 3EQ1A 2WCC3 1MGTA 2RS6A 2LT7A 4I8OA 2VF1A 4JI7E 2LMZA 2YTEA 2EN3A 4F9BB 2IHR1 3T1HE 5IT9C 4DV3E 2K4VA 1A1IA 4DR7E 1YYOA 4GZNC 1X6HA 2J7JA 4R2DA 3BBGA 4AQYE 2EMAA 4R2PA 1JK1A 5LMUE 4R2CA 1I94E 4N4RB 3J81C 2FGGA 1EH8A 3F6HA 1WHQA 4F9CB 2EMBA 3H09A 3ADJA 1STUA 4LF5E 2V86A 2KONA 4DV2E 4TUGA 3IWBA 2EOEA 1X6FA 1GTKA 4TUIA 2VQEE 2EP3A 4BC9A 4WXCA 4X62E 2YRKA 1N32E 1YSAC 2KOUA 2EM5A 4GEQB 1YZ9A 2PRTA 2LE2A 5A6BA 2L2KB 1T38A 2MKNA 4DUZE 4JI1E 2V87A 2YPNA 2VRDA 5IV8B 3J7AG 4BCAA 4F9AB 4F6NA 4DV6E 4DKKA 4F54A 4JI0E 3BIDA 2YTIA 3EPLA 1A1FA 1IBLE 4OX9E 1EKZA 4R03A 2RTXA 3LMLA 1A1KA 2EOZA 3M99B 4KWYA 4F6MA 3ADGA 3JAMC 2L6MA 2MKDA 4O43A 2EM8A 4BMJA 2NUEA 1YYKA 4LF6E 2ENAA 2HGHA 4DV0E 2N3HA 1HNXE 4LF7E 4ZYEA 4LFBE 2LUQA 3UK3C 1O0WA 2L2NA 2V8QB 2NA2A 5LL6R 1WRJA 4WX9A 2EMLA 2MDGA 2N8XA 5DNYA 2E5LE 1PDAA 1X49A 1UHZA 3HTXA 1X5WA 2VE7C 1T4OA 3C6MA 5A6JA 2EOOA 2YTFA 2JYAA 1IBME 4JI2E 4LF4E 4BS9A 1G2FC 2YU5A 2EQ3A 1NCSA 2CSHA 4L5NC 2EN4A 2WBUA 2L3JA 3OTOE 1HNZE 1HR0E 3IWDA 1AH5A 2I13A 2EMHA 2ENCA 2R1FA 5AC4A 2HHHE 2EM6A 4B3SE 2JOXA 2EORA 5AC5A 3EPJA 2JXPA 1F2IG 3MHSC 4M2ZA 4DUYE 5KL6A 4GKKE 1A1HA 2EM4A 1DQ3A 4OOGC 4LFAE 1YYWA 1TN9A 2M7QA 2NUGA 2YRHA 4X64E 4X9JA 1UILA 4IJDA 2L3CA 1AAYA 4HTGA 3VYYA 1SFEA 2JP9A 3C4TA 2EL5A 1ZR9A 5LLQA 2CTDA 5F3WA 1TF6A 4JV5E 2EMZA 2EN7A 2EPZA 2WBTA 5A6KA 2DGCA 2L2MA 2LV2A 2YTDA 3RMPA 2EN2A 4X8WA 3HPSA 2EOYA 3P1XA 4GKJE 2YTPA 1BBOA 3C6KA 4BC7A 2DMYA 2JVAA 2YTNA 2JWOA 1ZAAC 3TQMA 2EM7A 2GLIA 4JI3E 2YZTA 2UU9E 4J8ZA 2EPKX 4X65E 4Q35B
chains in the Genus database with same CATH topology
4R2EA 2LVHA 1TF3A 2EL4A 4M9VC 1UN6B 2ADRA 2EPPA 2YTGA 2EJ4A 3MHHC 1A1KA 2EOZA 3M99B 2EOMA 4F6MA 2ENHA 2EOXA 2MKDA 2EM8A 2EOHA 2EPXA 2BB8A 2EMKA 2YU8A 2EMXA 2ENAA 2EMIA 2HGHA 4F2JC 2LO3A 1A1JA 2EM9A 2EOQA 2EN8A 5KL3A 3UK3C 2EPCA 2D9HA 2CT1A 1X3CA 2ELYA 2LCEA 2EN1A 1A1LA 4R2RA 2EMLA 2MDGA 1JK2A 2EL6A 1MEYC 2EM2A 1LLMC 1ZU1A 2ELZA 2EOSA 1X5WA 1UBDC 2EM3A 2GHFA 2A25A 2EMWA 5KL2A 4WSGA 2EOOA 2EOFA 2YTFA 2EMYA 2EOIA 2WCC3 1G2FC 4R2AA 2YU5A 2EPRA 2EQ3A 1NCSA 1YUIA 2CSHA 2LT7A 2WBUA 2EN4A 2EQ0A 1RMDA 3VHTB 2EMCA 2YTEA 2I13A 2EN3A 2EMHA 2ENCA 2R1FA 1A1GA 2EM6A 1A1IA 2YTQA 2YSPA 1YUJA 2EORA 4FK5C 4GZNC 1X6HA 2J7JA 4R2DA 2EMAA 3EPJA 4R2PA 1JK1A 4R2CA 1F2IG 2DRPA 3MHSC 2YTOA 1X6EA 2NABA 5KL6A 2EMBA 2EM4A 1A1HA 2DLQA 1TN9A 2RPCA 2YRHA 1DGCA 4X9JA 2EQ1A 2EOEA 4IJDA 1G2DC 2YTJA 3EPKA 1AAYA 1X6FA 2EPAA 3EPHA 2DMIA 2JP9A 2EN6A 2EP3A 2EL5A 1ZR9A 2CTDA 4R2SA 1TF6A 2JPAA 1WJPA 2EMZA 2EN7A 2EPZA 2WBTA 2YRKA 2EMGA 1YSAC 2DGCA 5KL7A 2LV2A 2YTDA 2EN2A 2EM5A 2PRTA 2EOYA 2DLKA 1Z1BA 2MKNA 2WBSA 2YTPA 2EOJA 1BBOA 1P47A 2EPUA 2VRDA 4R2QA 2EE8A 1B69A 4F6NA 1KJKA 5KL5A 2M9AA 2YTNA 1BB8A 2RSIA 1ZAAC 2EM7A 4IS1C 2GLIA 2YSOA 2E72A 2EMFA 2YTIA 3EPLA 5KL4A 2YRMA 2EM0A 1A1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2E A;  2LVH A;  1TF3 A;  2EL4 A;  4M9V C;  1UN6 B;  2ADR A;  2EPP A;  2YTG A;  2EJ4 A;  3MHH C;  1A1K A;  2EOZ A;  3M99 B;  2EOM A;  4F6M A;  2ENH A;  2EOX A;  2MKD A;  2EM8 A;  2EOH A;  2EPX A;  2BB8 A;  2EMK A;  2YU8 A;  2EMX A;  2ENA A;  2EMI A;  2HGH A;  4F2J C;  2LO3 A;  1A1J A;  2EM9 A;  2EOQ A;  2EN8 A;  5KL3 A;  3UK3 C;  2EPC A;  2D9H A;  2CT1 A;  1X3C A;  2ELY A;  2LCE A;  2EN1 A;  1A1L A;  4R2R A;  2EML A;  2MDG A;  1JK2 A;  2EL6 A;  1MEY C;  2EM2 A;  1LLM C;  1ZU1 A;  2ELZ A;  2EOS A;  1X5W A;  1UBD C;  2EM3 A;  2GHF A;  2A25 A;  2EMW A;  5KL2 A;  4WSG A;  2EOO A;  2EOF A;  2YTF A;  2EMY A;  2EOI A;  2WCC 3;  1G2F C;  4R2A A;  2YU5 A;  2EPR A;  2EQ3 A;  1NCS A;  1YUI A;  2CSH A;  2LT7 A;  2WBU A;  2EN4 A;  2EQ0 A;  1RMD A;  3VHT B;  2EMC A;  2YTE A;  2I13 A;  2EN3 A;  2EMH A;  2ENC A;  2R1F A;  1A1G A;  2EM6 A;  1A1I A;  2YTQ A;  2YSP A;  1YUJ A;  2EOR A;  4FK5 C;  4GZN C;  1X6H A;  2J7J A;  4R2D A;  2EMA A;  3EPJ A;  4R2P A;  1JK1 A;  4R2C A;  1F2I G;  2DRP A;  3MHS C;  2YTO A;  1X6E A;  2NAB A;  5KL6 A;  2EMB A;  2EM4 A;  1A1H A;  2DLQ A;  1TN9 A;  2RPC A;  2YRH A;  1DGC A;  4X9J A;  2EQ1 A;  2EOE A;  4IJD A;  1G2D C;  2YTJ A;  3EPK A;  1AAY A;  1X6F A;  2EPA A;  3EPH A;  2DMI A;  2JP9 A;  2EN6 A;  2EP3 A;  2EL5 A;  1ZR9 A;  2CTD A;  4R2S A;  1TF6 A;  2JPA A;  1WJP A;  2EMZ A;  2EN7 A;  2EPZ A;  2WBT A;  2YRK A;  2EMG A;  1YSA C;  2DGC A;  5KL7 A;  2LV2 A;  2YTD A;  2EN2 A;  2EM5 A;  2PRT A;  2EOY A;  2DLK A;  1Z1B A;  2MKN A;  2WBS A;  2YTP A;  2EOJ A;  1BBO A;  1P47 A;  2EPU A;  2VRD A;  4R2Q A;  2EE8 A;  1B69 A;  4F6N A;  1KJK A;  5KL5 A;  2M9A A;  2YTN A;  1BB8 A;  2RSI A;  1ZAA C;  2EM7 A;  4IS1 C;  2GLI A;  2YSO A;  2E72 A;  2EMF A;  2YTI A;  3EPL A;  5KL4 A;  2YRM A;  2EM0 A;  1A1F A; 
#chains in the Genus database with same CATH topology
 1TF3 A;  2E1M A;  2EL4 A;  4M9V C;  4LF8 E;  2YT4 A;  2Q8U A;  4DR1 E;  4DV7 E;  2ENH A;  2EOX A;  4P78 A;  5CFF E;  2EPM X;  2YWQ A;  2EOH A;  4DR3 E;  1IQO A;  5T6J A;  2YU8 A;  2UXC E;  2LTR A;  2EMI A;  5IXM B;  1YFH A;  4JI6 E;  3ZOQ B;  1FJG E;  5LMN E;  2EM9 A;  3AUZ A;  2EN8 A;  2DIX A;  3C4B A;  2D9H A;  1X3C A;  4WSP A;  4O5G A;  1J5E E;  4NXM E;  2LCE A;  1PKP A;  2M1S A;  1XNR E;  1A1L A;  2R76 A;  1XNQ E;  2EL6 A;  3J80 C;  2B7T A;  2EM2 A;  4WYQ B;  1ZU1 A;  2ELZ A;  1T39 A;  3OML A;  3DF6 A;  5TSE A;  2A25 A;  2EMY A;  4ZYG A;  4B3T E;  4JYA E;  3FIG A;  1N36 E;  1YUI A;  5AE1 A;  1IBK E;  1RMD A;  4NZV A;  3VHT B;  2LBS B;  1J26 A;  2EMC A;  2LRS A;  4DMI A;  1A1G A;  2ODR C;  2EPL X;  2YTQ A;  4O4K A;  2YSP A;  1N3G A;  4LF9 E;  4LFC E;  2DRP A;  2BBG A;  1WXR A;  4RHB B;  1T4L B;  4NHR A;  2DLQ A;  2DSY A;  4MLV A;  3HQ1 A;  1PJT A;  2H36 X;  2EQ1 A;  4BHC A;  1PJQ A;  1G2D C;  2K7I A;  3EPK A;  2F4V E;  3EPH A;  2DMI A;  2UXD E;  1PJS A;  3ADI A;  2EN6 A;  3IWC A;  1WJP A;  3BGH A;  2EMG A;  1GQE A;  4JI8 E;  5A6B D;  2RSM A;  1IQS A;  5BR8 E;  1Z1B A;  4X66 E;  2HJJ A;  4DR5 E;  1B69 A;  2I9I A;  5KL5 A;  2M9A A;  3BF2 A;  1BB8 A;  1N34 E;  2RSI A;  1DI2 A;  2EMF A;  5IWA E;  1NEI A;  2HC5 A;  2JOB A;  2EM0 A;  1QNT A;  2LVH A;  1UN6 B;  2EPP A;  2YTG A;  4WXD A;  3MHH C;  2EOM A;  2B3T B;  4ZYH A;  2N3G A;  5ADZ A;  2V83 A;  4B3M E;  4DR6 E;  4JI5 E;  3F6G A;  4K0K E;  2EPX A;  4MLQ A;  2EMX A;  1X48 A;  4B3R E;  2EPO A;  3THO B;  1XMO E;  2LO3 A;  1XMQ E;  4YY3 E;  2MC5 A;  3HXL A;  4M0V A;  1SR9 A;  5A2Q C;  1HNW E;  2F8B A;  2DB2 A;  2RQL A;  2UUA E;  2L33 A;  4LTY A;  2G7H A;  3THN A;  5AE2 A;  1WHN A;  2ELY A;  4LU9 A;  2EN1 A;  2UUB E;  4KZS A;  1JK2 A;  1RQ0 A;  1LLM C;  1ZBQ A;  4DR2 E;  2EOS A;  3ADL A;  2ODR D;  1UBD C;  2EMW A;  4WFT A;  5KL2 A;  2UUC E;  4WSG A;  2V88 A;  3AV0 A;  2EOI A;  3T1Y E;  3KWR A;  3HPZ A;  4R2A A;  2EZ6 A;  2EPR A;  1EH7 A;  2EQ0 A;  4WPY A;  2RS7 A;  2LTS A;  2GPI A;  2JR1 A;  2LJU A;  1YUJ A;  4FK5 C;  4DV4 E;  3VK6 A;  3MSW A;  2B9D A;  4O24 A;  1IMU A;  3JU0 A;  2YTO A;  1X6E A;  2NAB A;  4DV5 E;  1T4N A;  1ZBT A;  5A6A A;  2B7V A;  2RPC A;  1DGC A;  2EPN A;  4RH8 A;  1RC7 A;  4BBY A;  2YTJ A;  1EH6 A;  2EPA A;  4YHH E;  2V85 A;  2FTX B;  3K6Q A;  4R2S A;  2JPA A;  3ECR A;  2M4I A;  4P7D A;  1N33 E;  2LUP B;  5KL7 A;  1GZ6 A;  2EWL A;  2DLK A;  2WBS A;  2EOJ A;  1P47 A;  4R2Q A;  2EE8 A;  2ZM6 E;  3VYX A;  1KJK A;  2JY9 A;  1KYQ A;  4Q28 A;  5FLX C;  5A69 A;  3KZY A;  4IS1 C;  2WZO A;  2YSO A;  2E72 A;  2LJH A;  2MC6 A;  3LLH A;  5KL4 A;  2YRM A;  2EPU A;  4R2E A;  1X47 A;  3QG5 C;  2ADR A;  2EJ4 A;  4KHP E;  3DJW A;  3KZZ A;  2VQF E;  1YPN A;  4BHB A;  3L00 A;  1L4S A;  4M30 A;  2BB8 A;  4NXN E;  2EMK A;  4F2J C;  1A1J A;  1BBG A;  2MDR A;  3J7Y p;  2EOQ A;  5KL3 A;  4DV1 E;  3JTZ A;  2EPC A;  4ZYD A;  4R8O A;  2CT1 A;  2FV4 B;  1FKA E;  2NUF A;  4HEI A;  4L8N A;  5AE3 A;  2KHX A;  4R2R A;  4JI4 E;  2UXB E;  1QU6 A;  1MEY C;  4DR4 E;  2L92 A;  2V89 A;  2L8T A;  5AAS A;  2CPN A;  2EM3 A;  2GHF A;  2EOF A;  3EQ1 A;  2WCC 3;  1MGT A;  2RS6 A;  2LT7 A;  4I8O A;  2VF1 A;  4JI7 E;  2LMZ A;  2YTE A;  2EN3 A;  4F9B B;  2IHR 1;  3T1H E;  5IT9 C;  4DV3 E;  2K4V A;  1A1I A;  4DR7 E;  1YYO A;  4GZN C;  1X6H A;  2J7J A;  4R2D A;  3BBG A;  4AQY E;  2EMA A;  4R2P A;  1JK1 A;  5LMU E;  4R2C A;  1I94 E;  4N4R B;  3J81 C;  2FGG A;  1EH8 A;  3F6H A;  1WHQ A;  4F9C B;  2EMB A;  3H09 A;  3ADJ A;  1STU A;  4LF5 E;  2V86 A;  2KON A;  4DV2 E;  4TUG A;  3IWB A;  2EOE A;  1X6F A;  1GTK A;  4TUI A;  2VQE E;  2EP3 A;  4BC9 A;  4WXC A;  4X62 E;  2YRK A;  1N32 E;  1YSA C;  2KOU A;  2EM5 A;  4GEQ B;  1YZ9 A;  2PRT A;  2LE2 A;  5A6B A;  2L2K B;  1T38 A;  2MKN A;  4DUZ E;  4JI1 E;  2V87 A;  2YPN A;  2VRD A;  5IV8 B;  3J7A G;  4BCA A;  4F9A B;  4F6N A;  4DV6 E;  4DKK A;  4F54 A;  4JI0 E;  3BID A;  2YTI A;  3EPL A;  1A1F A;  1IBL E;  4OX9 E;  1EKZ A;  4R03 A;  2RTX A;  3LML A;  1A1K A;  2EOZ A;  3M99 B;  4KWY A;  4F6M A;  3ADG A;  3JAM C;  2L6M A;  2MKD A;  4O43 A;  2EM8 A;  4BMJ A;  2NUE A;  1YYK A;  4LF6 E;  2ENA A;  2HGH A;  4DV0 E;  2N3H A;  1HNX E;  4LF7 E;  4ZYE A;  4LFB E;  2LUQ A;  3UK3 C;  1O0W A;  2L2N A;  2V8Q B;  2NA2 A;  5LL6 R;  1WRJ A;  4WX9 A;  2EML A;  2MDG A;  2N8X A;  5DNY A;  2E5L E;  1PDA A;  1X49 A;  1UHZ A;  3HTX A;  1X5W A;  2VE7 C;  1T4O A;  3C6M A;  5A6J A;  2EOO A;  2YTF A;  2JYA A;  1IBM E;  4JI2 E;  4LF4 E;  4BS9 A;  1G2F C;  2YU5 A;  2EQ3 A;  1NCS A;  2CSH A;  4L5N C;  2EN4 A;  2WBU A;  2L3J A;  3OTO E;  1HNZ E;  1HR0 E;  3IWD A;  1AH5 A;  2I13 A;  2EMH A;  2ENC A;  2R1F A;  5AC4 A;  2HHH E;  2EM6 A;  4B3S E;  2JOX A;  2EOR A;  5AC5 A;  3EPJ A;  2JXP A;  1F2I G;  3MHS C;  4M2Z A;  4DUY E;  5KL6 A;  4GKK E;  1A1H A;  2EM4 A;  1DQ3 A;  4OOG C;  4LFA E;  1YYW A;  1TN9 A;  2M7Q A;  2NUG A;  2YRH A;  4X64 E;  4X9J A;  1UIL A;  4IJD A;  2L3C A;  1AAY A;  4HTG A;  3VYY A;  1SFE A;  2JP9 A;  3C4T A;  2EL5 A;  1ZR9 A;  5LLQ A;  2CTD A;  5F3W A;  1TF6 A;  4JV5 E;  2EMZ A;  2EN7 A;  2EPZ A;  2WBT A;  5A6K A;  2DGC A;  2L2M A;  2LV2 A;  2YTD A;  3RMP A;  2EN2 A;  4X8W A;  3HPS A;  2EOY A;  3P1X A;  4GKJ E;  2YTP A;  1BBO A;  3C6K A;  4BC7 A;  2DMY A;  2JVA A;  2YTN A;  2JWO A;  1ZAA C;  3TQM A;  2EM7 A;  2GLI A;  4JI3 E;  2YZT A;  2UU9 E;  4J8Z A;  2EPK X;  4X65 E;  4Q35 B; 
#chains in the Genus database with same CATH homology
 4R2E A;  2LVH A;  1TF3 A;  2EL4 A;  4M9V C;  1UN6 B;  2ADR A;  2EPP A;  2YTG A;  2EJ4 A;  3MHH C;  1A1K A;  2EOZ A;  3M99 B;  2EOM A;  4F6M A;  2ENH A;  2EOX A;  2MKD A;  2EM8 A;  2EOH A;  2EPX A;  2BB8 A;  2EMK A;  2YU8 A;  2EMX A;  2ENA A;  2EMI A;  2HGH A;  4F2J C;  2LO3 A;  1A1J A;  2EM9 A;  2EOQ A;  2EN8 A;  5KL3 A;  3UK3 C;  2EPC A;  2D9H A;  2CT1 A;  1X3C A;  2ELY A;  2LCE A;  2EN1 A;  1A1L A;  4R2R A;  2EML A;  2MDG A;  1JK2 A;  2EL6 A;  1MEY C;  2EM2 A;  1LLM C;  1ZU1 A;  2ELZ A;  2EOS A;  1X5W A;  1UBD C;  2EM3 A;  2GHF A;  2A25 A;  2EMW A;  5KL2 A;  4WSG A;  2EOO A;  2EOF A;  2YTF A;  2EMY A;  2EOI A;  2WCC 3;  1G2F C;  4R2A A;  2YU5 A;  2EPR A;  2EQ3 A;  1NCS A;  1YUI A;  2CSH A;  2LT7 A;  2WBU A;  2EN4 A;  2EQ0 A;  1RMD A;  3VHT B;  2EMC A;  2YTE A;  2I13 A;  2EN3 A;  2EMH A;  2ENC A;  2R1F A;  1A1G A;  2EM6 A;  1A1I A;  2YTQ A;  2YSP A;  1YUJ A;  2EOR A;  4FK5 C;  4GZN C;  1X6H A;  2J7J A;  4R2D A;  2EMA A;  3EPJ A;  4R2P A;  1JK1 A;  4R2C A;  1F2I G;  2DRP A;  3MHS C;  2YTO A;  1X6E A;  2NAB A;  5KL6 A;  2EMB A;  2EM4 A;  1A1H A;  2DLQ A;  1TN9 A;  2RPC A;  2YRH A;  1DGC A;  4X9J A;  2EQ1 A;  2EOE A;  4IJD A;  1G2D C;  2YTJ A;  3EPK A;  1AAY A;  1X6F A;  2EPA A;  3EPH A;  2DMI A;  2JP9 A;  2EN6 A;  2EP3 A;  2EL5 A;  1ZR9 A;  2CTD A;  4R2S A;  1TF6 A;  2JPA A;  1WJP A;  2EMZ A;  2EN7 A;  2EPZ A;  2WBT A;  2YRK A;  2EMG A;  1YSA C;  2DGC A;  5KL7 A;  2LV2 A;  2YTD A;  2EN2 A;  2EM5 A;  2PRT A;  2EOY A;  2DLK A;  1Z1B A;  2MKN A;  2WBS A;  2YTP A;  2EOJ A;  1BBO A;  1P47 A;  2EPU A;  2VRD A;  4R2Q A;  2EE8 A;  1B69 A;  4F6N A;  1KJK A;  5KL5 A;  2M9A A;  2YTN A;  1BB8 A;  2RSI A;  1ZAA C;  2EM7 A;  4IS1 C;  2GLI A;  2YSO A;  2E72 A;  2EMF A;  2YTI A;  3EPL A;  5KL4 A;  2YRM A;  2EM0 A;  1A1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...