2EPPA

Solution structure of the first c2h2 type zinc finger domain of zinc finger protein 278
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
GSSGSSGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords POZ-, AT hook-, and zinc finger-containing protein 1
publication title Solution structure of the first C2H2 type zinc finger domain of Zinc finger protein 278
rcsb
source organism Homo sapiens
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eppA01
4R2DA 2ENCA 2EPAA 2YRHA 3M99B 2EM3A 2CT1A 2YU5A 2EOZA 2EOEA 2EP3A 1TF3A 2EMXA 1X6EA 2EMLA 2EMZA 2A25A 2DRPA 2JP9A 2EOOA 2LT7A 1Z1BA 2EMYA 2EM2A 2JPAA 2EN4A 2CTDA 2LV2A 3EPJA 1WJPA 2EMAA 2EOSA 2EMKA 4R2PA 3UK3C 2ENAA 2LO3A 2YTGA 2EL5A 2EMGA 2EM9A 2RPCA 2YRKA 1G2FC 2WBTA 2EOQA 1ZU1A 2J7JA 1P47A 2EM6A 1BB8A 4R2CA 1A1JA 2EMHA 3MHSC 1G2DC 4F2JC 4WSGA 2YSOA 4R2AA 2EPRA 2YSPA 2EL4A 2YTDA 2M9AA 2EM5A 2ENHA 1A1IA 2EMBA 5KL5A 2EN6A 2EOFA 2EOMA 4R2EA 3EPKA 1X6FA 2D9HA 2EMWA 1LLMC 1JK1A 1A1LA 2EPPA 2CSHA 2EMIA 4R2SA 2EMFA 2GHFA 2EOJA 4GZNC 2EM8A 2EJ4A 1KJKA 2EN7A 2EQ0A 4F6MA 1RMDA 4R2QA 3EPHA 2VRDA 2EOHA 4X9JA 2EOYA 2EPZA 4R2RA 2GLIA 2EN2A 2YTEA 2WBUA 2EOIA 2YTOA 2DLKA 1A1KA 1TF6A 2ADRA 1BBOA 1X6HA 2YTPA 2YU8A 1A1HA 2WBSA 2DLQA 2EM4A 1JK2A 2EM7A 2DGCA 2I13A 2EN8A 2EPUA 1F2IG 2EE8A 2YTNA 2DMIA 4IJDA 2PRTA 2EN3A 2EPCA 1YSAC 2RSIA 1X5WA 4IS1C 2MKNA 2YTFA 1YUJA 2LCEA 2YTQA 4FK5C 1ZR9A 1UBDC 2EMCA 2ELZA 5KL4A 5KL3A 2MKDA 2EOXA 1B69A 1A1FA 2EN1A 2MDGA 2EPXA 1AAYA 1DGCA 3MHHC 2BB8A 1A1GA 1TN9A 1ZAAC 2EM0A 2NABA 1NCSA 2EORA 5KL6A 2EQ1A 2EL6A 1YUIA 2R1FA 2EQ3A 2YTIA 2YRMA 5KL7A 1MEYC 3VHTB 2LVHA 4F6NA 2E72A 3EPLA 1X3CA 4M9VC 2HGHA 5KL2A 2ELYA 1UN6B 2WCC3 2YTJA
chains in the Genus database with same CATH superfamily
4F9BB 2ENCA 5A6JA 3M99B 4DV3E 4OOGC 4M0VA 1RQ0A 2YU5A 1STUA 4BC7A 3T1YE 1T38A 1YYWA 2RSMA 1WXRA 2EP3A 2EMXA 2NUEA 1X6EA 2EMLA 5AE3A 2DRPA 2EPLX 3HPSA 4X62E 2JP9A 4LFAE 4NXME 2EM2A 1RC7A 2JPAA 4OX9E 2EN4A 5A2QC 2LV2A 1WJPA 2EMKA 4ZYDA 1YFHA 1MGTA 2EL5A 3IWBA 4KWYA 3J80C 1N32E 3BIDA 1KYQA 1EH7A 2BBGA 5LL6R 2YSOA 4R2AA 4J8ZA 2EL4A 2ENHA 4JI5E 1N34E 2UXBE 2EN6A 3THNA 5A6AA 3EPKA 2M4IA 1LLMC 4I8OA 1YYOA 1IQOA 2HHHE 3OMLA 3ADLA 4TUIA 2EMIA 4DR6E 2EJ4A 4NXNE 2EQ0A 5LMUE 4F6MA 4BHCA 4X66E 4KHPE 2EPZA 2EOIA 2YTOA 1N36E 2FTXB 4WX9A 2UUAE 2YTPA 4TUGA 1A1HA 2JVAA 4DUYE 4B3RE 2EM7A 2DGCA 1XMQE 2MC5A 2UUBE 5LLQA 2DMIA 4WYQB 4LF6E 2EPCA 4BS9A 2LUPB 2DSYA 5AE2A 5AC4A 2EMCA 4BCAA 4X65E 5AE1A 4DR3E 2FV4B 4N4RB 3F6HA 2B7TA 3EQ1A 2EOXA 4DV1E 1XMOE 4F9CB 3J7Yp 4DV4E 3F6GA 5AASA 2EQ1A 1PJSA 4DR2E 1IBME 2IHR1 3C6KA 3BF2A 2K7IA 4NZVA 5A6BA 4ZYEA 1J5EE 2JOXA 2LVHA 1PDAA 1I94E 1HNXE 2HGHA 2V85A 2GPIA 2ODRD 2YRHA 1IBLE 4JYAE 2EM3A 3TQMA 4DUZE 4B3SE 3HXLA 3L00A 2EOZA 4BMJA 3KZYA 1TF3A 1PJQA 1O0WA 2EOOA 4WXDA 2L6MA 2DIXA 4LF4E 1ZBQA 3OTOE 2EMAA 4L5NC 3RMPA 4B3ME 2ENAA 1X48A 4JV5E 4DV7E 2YRKA 2RPCA 5TSEA 2WBTA 2EOQA 4DR5E 2L8TA 1T4NA 3BBGA 3MHSC 1G2DC 2EPKX 3ADJA 1AH5A 4WSGA 4P7DA 4P78A 2EPRA 2I9IA 2YSPA 4R8OA 2M9AA 2UXDE 1QNTA 4YY3E 4X64E 1SR9A 2EOMA 2EPMX 2YWQA 2V89A 1X6FA 2D9HA 1A1LA 2EPPA 1NEIA 2CSHA 4JI3E 4R2SA 2EMFA 2EOJA 2EM8A 2YPNA 2MDRA 1KJKA 2EN7A 1RMDA 5IV8B 2G7HA 2EOYA 2EN2A 2F8BA 4AQYE 2DLKA 2L3CA 2DMYA 4LFBE 1X6HA 1BBOA 2LJUA 2WZOA 2EPOA 1JK2A 1J26A 1UHZA 2EPUA 1F2IG 4NHRA 2L33A 1YZ9A 4O43A 1T4OA 1ZBTA 1IBKE 1FJGE 4WSPA 2LCEA 1ZR9A 4BC9A 4MLQA 1N3GA 2ELZA 5KL4A 1YPNA 1SFEA 5A69A 1EH6A 2EN1A 2MDGA 2EPXA 1AAYA 1HR0E 2JXPA 5T6JA 2JY9A 5BR8E 4GKKE 4JI8E 2LTSA 3HTXA 5ADZA 2NABA 4B3TE 3BGHA 2R76A 2R1FA 4YHHE 2EQ3A 1MEYC 2E72A 3EPLA 2E1MA 5IT9C 1T4LB 1UILA 2V88A 1UN6B 3DF6A 3ADIA 1WRJA 2DB2A 4BBYA 1WHQA 5IXMB 2RS6A 3JU0A 2VF1A 2LRSA 2N3GA 3C6MA 3P1XA 2M7QA 4R03A 2EOEA 4GKJE 2M1SA 4DV5E 2YZTA 1FKAE 2A25A 2LT7A 2EMYA 3EPJA 3HPZA 4RH8A 4R2PA 3UK3C 1IMUA 2EM9A 3VYYA 2NA2A 1G2FC 1ZU1A 2EM6A 2YT4A 1BB8A 4R2CA 1A1JA 3KWRA 3DJWA 5LMNE 1HNWE 2NUFA 3AUZA 2UU9E 4WFTA 3J81C 4O4KA 2EM5A 4Q35B 1A1IA 2EMBA 5KL5A 1BBGA 2L2MA 2EOFA 1IQSA 2B9DA 4R2EA 2EWLA 4HEIA 3JAMC 1L4SA 2V83A 3QG5C 4GZNC 2ZM6E 4WXCA 4JI7E 4R2QA 2EOHA 4X9JA 5A6BD 2GLIA 2YTEA 3ZOQB 4DR7E 1A1KA 4LF5E 4GEQB 2ADRA 2N3HA 2WBSA 2LBSB 2DLQA 4F54A 2I13A 3THOB 2LTRA 2YTNA 4IJDA 2PRTA 2JR1A 2LMZA 1YSAC 4HTGA 1T39A 3AV0A 2KOUA 1GQEA 4O24A 1X5WA 4L8NA 2MKNA 2YTFA 4ZYHA 2YTQA 3ECRA 4FK5C 5AC5A 1UBDC 1XNRE 2HC5A 4LU9A 2LJHA 1B69A 2V86A 1A1FA 4JI6E 1XNQE 1ZAAC 2EM0A 1NCSA 2EORA 5KL6A 2EL6A 1YUIA 2RQLA 2YRMA 5KL7A 1X3CA 2FGGA 5KL2A 2ELYA 2UXCE 2F4VE 4R2DA 2EPAA 2KHXA 2CT1A 1DQ3A 4RHBB 5FLXC 2ODRC 4DKKA 3H09A 4JI0E 2LUQA 4DV0E 2EMZA 2L92A 1EKZA 2KONA 2B3TB 2N8XA 1Z1BA 4JI1E 1X47A 2CTDA 2LE2A 2EOSA 5DNYA 2VQFE 4LF8E 2LO3A 2YTGA 2EMGA 1P47A 2J7JA 4F9AB 2MC6A 4O5GA 4LFCE 2EZ6A 1WHNA 2RTXA 2EMHA 2L3JA 4M30A 3IWDA 4F2JC 1GTKA 2YTDA 2JYAA 2EPNA 2B7VA 1PKPA 4LTYA 2V87A 2EMWA 3HQ1A 4X8WA 1JK1A 3VK6A 2GHFA 2H36X 4DR1E 3EPHA 2VRDA 5IWAE 4R2RA 2VE7C 3C4TA 1EH8A 2WBUA 1TF6A 2NUGA 2YU8A 3KZZA 4KZSA 1QU6A 2V8QB 2EM4A 3JTZA 3FIGA 3T1HE 2EN8A 3ADGA 2EE8A 2CPNA 2RS7A 5F3WA 1GZ6A 2EN3A 2VQEE 2E5LE 4MLVA 1N33E 2RSIA 5A6KA 4IS1C 4ZYGA 4DV6E 3J7AG 1YUJA 4JI4E 3LMLA 5KL3A 2UUCE 2MKDA 4DMIA 2L2NA 2JWOA 1PJTA 2HJJA 1DGCA 3MHHC 4M2ZA 2Q8UA 2BB8A 1A1GA 1TN9A 3LLHA 4Q28A 2JOBA 4JI2E 3IWCA 4DR4E 4K0KE 3K6QA 4LF9E 1HNZE 4WPYA 4BHBA 1X49A 2YTIA 4DV2E 3VHTB 3C4BA 1YYKA 1DI2A 4F6NA 3VYXA 3MSWA 4M9VC 5CFFE 2L2KB 4LF7E 2WCC3 2YTJA 2K4VA
chains in the Genus database with same CATH topology
4R2DA 2ENCA 2EPAA 2YRHA 3M99B 2EM3A 2CT1A 2YU5A 2EOZA 2EOEA 2EP3A 1TF3A 2EMXA 1X6EA 2EMLA 2EMZA 2A25A 2DRPA 2JP9A 2EOOA 2LT7A 1Z1BA 2EMYA 2EM2A 2JPAA 2EN4A 2CTDA 2LV2A 3EPJA 1WJPA 2EMAA 2EOSA 2EMKA 4R2PA 3UK3C 2ENAA 2LO3A 2YTGA 2EL5A 2EMGA 2EM9A 2RPCA 2YRKA 1G2FC 2WBTA 2EOQA 1ZU1A 2J7JA 1P47A 2EM6A 1BB8A 4R2CA 1A1JA 2EMHA 3MHSC 1G2DC 4F2JC 4WSGA 2YSOA 4R2AA 2EPRA 2YSPA 2EL4A 2YTDA 2M9AA 2EM5A 2ENHA 1A1IA 2EMBA 5KL5A 2EN6A 2EOFA 2EOMA 4R2EA 3EPKA 1X6FA 2D9HA 2EMWA 1LLMC 1JK1A 1A1LA 2EPPA 2CSHA 2EMIA 4R2SA 2EMFA 2GHFA 2EOJA 4GZNC 2EM8A 2EJ4A 1KJKA 2EN7A 2EQ0A 4F6MA 1RMDA 4R2QA 3EPHA 2VRDA 2EOHA 4X9JA 2EOYA 2EPZA 4R2RA 2GLIA 2EN2A 2YTEA 2WBUA 2EOIA 2YTOA 2DLKA 1A1KA 1TF6A 2ADRA 1BBOA 1X6HA 2YTPA 2YU8A 1A1HA 2WBSA 2DLQA 2EM4A 1JK2A 2EM7A 2DGCA 2I13A 2EN8A 2EPUA 1F2IG 2EE8A 2YTNA 2DMIA 4IJDA 2PRTA 2EN3A 2EPCA 1YSAC 2RSIA 1X5WA 4IS1C 2MKNA 2YTFA 1YUJA 2LCEA 2YTQA 4FK5C 1ZR9A 1UBDC 2EMCA 2ELZA 5KL4A 5KL3A 2MKDA 2EOXA 1B69A 1A1FA 2EN1A 2MDGA 2EPXA 1AAYA 1DGCA 3MHHC 2BB8A 1A1GA 1TN9A 1ZAAC 2EM0A 2NABA 1NCSA 2EORA 5KL6A 2EQ1A 2EL6A 1YUIA 2R1FA 2EQ3A 2YTIA 2YRMA 5KL7A 1MEYC 3VHTB 2LVHA 4F6NA 2E72A 3EPLA 1X3CA 4M9VC 2HGHA 5KL2A 2ELYA 1UN6B 2WCC3 2YTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2D A;  2ENC A;  2EPA A;  2YRH A;  3M99 B;  2EM3 A;  2CT1 A;  2YU5 A;  2EOZ A;  2EOE A;  2EP3 A;  1TF3 A;  2EMX A;  1X6E A;  2EML A;  2EMZ A;  2A25 A;  2DRP A;  2JP9 A;  2EOO A;  2LT7 A;  1Z1B A;  2EMY A;  2EM2 A;  2JPA A;  2EN4 A;  2CTD A;  2LV2 A;  3EPJ A;  1WJP A;  2EMA A;  2EOS A;  2EMK A;  4R2P A;  3UK3 C;  2ENA A;  2LO3 A;  2YTG A;  2EL5 A;  2EMG A;  2EM9 A;  2RPC A;  2YRK A;  1G2F C;  2WBT A;  2EOQ A;  1ZU1 A;  2J7J A;  1P47 A;  2EM6 A;  1BB8 A;  4R2C A;  1A1J A;  2EMH A;  3MHS C;  1G2D C;  4F2J C;  4WSG A;  2YSO A;  4R2A A;  2EPR A;  2YSP A;  2EL4 A;  2YTD A;  2M9A A;  2EM5 A;  2ENH A;  1A1I A;  2EMB A;  5KL5 A;  2EN6 A;  2EOF A;  2EOM A;  4R2E A;  3EPK A;  1X6F A;  2D9H A;  2EMW A;  1LLM C;  1JK1 A;  1A1L A;  2EPP A;  2CSH A;  2EMI A;  4R2S A;  2EMF A;  2GHF A;  2EOJ A;  4GZN C;  2EM8 A;  2EJ4 A;  1KJK A;  2EN7 A;  2EQ0 A;  4F6M A;  1RMD A;  4R2Q A;  3EPH A;  2VRD A;  2EOH A;  4X9J A;  2EOY A;  2EPZ A;  4R2R A;  2GLI A;  2EN2 A;  2YTE A;  2WBU A;  2EOI A;  2YTO A;  2DLK A;  1A1K A;  1TF6 A;  2ADR A;  1BBO A;  1X6H A;  2YTP A;  2YU8 A;  1A1H A;  2WBS A;  2DLQ A;  2EM4 A;  1JK2 A;  2EM7 A;  2DGC A;  2I13 A;  2EN8 A;  2EPU A;  1F2I G;  2EE8 A;  2YTN A;  2DMI A;  4IJD A;  2PRT A;  2EN3 A;  2EPC A;  1YSA C;  2RSI A;  1X5W A;  4IS1 C;  2MKN A;  2YTF A;  1YUJ A;  2LCE A;  2YTQ A;  4FK5 C;  1ZR9 A;  1UBD C;  2EMC A;  2ELZ A;  5KL4 A;  5KL3 A;  2MKD A;  2EOX A;  1B69 A;  1A1F A;  2EN1 A;  2MDG A;  2EPX A;  1AAY A;  1DGC A;  3MHH C;  2BB8 A;  1A1G A;  1TN9 A;  1ZAA C;  2EM0 A;  2NAB A;  1NCS A;  2EOR A;  5KL6 A;  2EQ1 A;  2EL6 A;  1YUI A;  2R1F A;  2EQ3 A;  2YTI A;  2YRM A;  5KL7 A;  1MEY C;  3VHT B;  2LVH A;  4F6N A;  2E72 A;  3EPL A;  1X3C A;  4M9V C;  2HGH A;  5KL2 A;  2ELY A;  1UN6 B;  2WCC 3;  2YTJ A; 
#chains in the Genus database with same CATH topology
 4F9B B;  2ENC A;  5A6J A;  3M99 B;  4DV3 E;  4OOG C;  4M0V A;  1RQ0 A;  2YU5 A;  1STU A;  4BC7 A;  3T1Y E;  1T38 A;  1YYW A;  2RSM A;  1WXR A;  2EP3 A;  2EMX A;  2NUE A;  1X6E A;  2EML A;  5AE3 A;  2DRP A;  2EPL X;  3HPS A;  4X62 E;  2JP9 A;  4LFA E;  4NXM E;  2EM2 A;  1RC7 A;  2JPA A;  4OX9 E;  2EN4 A;  5A2Q C;  2LV2 A;  1WJP A;  2EMK A;  4ZYD A;  1YFH A;  1MGT A;  2EL5 A;  3IWB A;  4KWY A;  3J80 C;  1N32 E;  3BID A;  1KYQ A;  1EH7 A;  2BBG A;  5LL6 R;  2YSO A;  4R2A A;  4J8Z A;  2EL4 A;  2ENH A;  4JI5 E;  1N34 E;  2UXB E;  2EN6 A;  3THN A;  5A6A A;  3EPK A;  2M4I A;  1LLM C;  4I8O A;  1YYO A;  1IQO A;  2HHH E;  3OML A;  3ADL A;  4TUI A;  2EMI A;  4DR6 E;  2EJ4 A;  4NXN E;  2EQ0 A;  5LMU E;  4F6M A;  4BHC A;  4X66 E;  4KHP E;  2EPZ A;  2EOI A;  2YTO A;  1N36 E;  2FTX B;  4WX9 A;  2UUA E;  2YTP A;  4TUG A;  1A1H A;  2JVA A;  4DUY E;  4B3R E;  2EM7 A;  2DGC A;  1XMQ E;  2MC5 A;  2UUB E;  5LLQ A;  2DMI A;  4WYQ B;  4LF6 E;  2EPC A;  4BS9 A;  2LUP B;  2DSY A;  5AE2 A;  5AC4 A;  2EMC A;  4BCA A;  4X65 E;  5AE1 A;  4DR3 E;  2FV4 B;  4N4R B;  3F6H A;  2B7T A;  3EQ1 A;  2EOX A;  4DV1 E;  1XMO E;  4F9C B;  3J7Y p;  4DV4 E;  3F6G A;  5AAS A;  2EQ1 A;  1PJS A;  4DR2 E;  1IBM E;  2IHR 1;  3C6K A;  3BF2 A;  2K7I A;  4NZV A;  5A6B A;  4ZYE A;  1J5E E;  2JOX A;  2LVH A;  1PDA A;  1I94 E;  1HNX E;  2HGH A;  2V85 A;  2GPI A;  2ODR D;  2YRH A;  1IBL E;  4JYA E;  2EM3 A;  3TQM A;  4DUZ E;  4B3S E;  3HXL A;  3L00 A;  2EOZ A;  4BMJ A;  3KZY A;  1TF3 A;  1PJQ A;  1O0W A;  2EOO A;  4WXD A;  2L6M A;  2DIX A;  4LF4 E;  1ZBQ A;  3OTO E;  2EMA A;  4L5N C;  3RMP A;  4B3M E;  2ENA A;  1X48 A;  4JV5 E;  4DV7 E;  2YRK A;  2RPC A;  5TSE A;  2WBT A;  2EOQ A;  4DR5 E;  2L8T A;  1T4N A;  3BBG A;  3MHS C;  1G2D C;  2EPK X;  3ADJ A;  1AH5 A;  4WSG A;  4P7D A;  4P78 A;  2EPR A;  2I9I A;  2YSP A;  4R8O A;  2M9A A;  2UXD E;  1QNT A;  4YY3 E;  4X64 E;  1SR9 A;  2EOM A;  2EPM X;  2YWQ A;  2V89 A;  1X6F A;  2D9H A;  1A1L A;  2EPP A;  1NEI A;  2CSH A;  4JI3 E;  4R2S A;  2EMF A;  2EOJ A;  2EM8 A;  2YPN A;  2MDR A;  1KJK A;  2EN7 A;  1RMD A;  5IV8 B;  2G7H A;  2EOY A;  2EN2 A;  2F8B A;  4AQY E;  2DLK A;  2L3C A;  2DMY A;  4LFB E;  1X6H A;  1BBO A;  2LJU A;  2WZO A;  2EPO A;  1JK2 A;  1J26 A;  1UHZ A;  2EPU A;  1F2I G;  4NHR A;  2L33 A;  1YZ9 A;  4O43 A;  1T4O A;  1ZBT A;  1IBK E;  1FJG E;  4WSP A;  2LCE A;  1ZR9 A;  4BC9 A;  4MLQ A;  1N3G A;  2ELZ A;  5KL4 A;  1YPN A;  1SFE A;  5A69 A;  1EH6 A;  2EN1 A;  2MDG A;  2EPX A;  1AAY A;  1HR0 E;  2JXP A;  5T6J A;  2JY9 A;  5BR8 E;  4GKK E;  4JI8 E;  2LTS A;  3HTX A;  5ADZ A;  2NAB A;  4B3T E;  3BGH A;  2R76 A;  2R1F A;  4YHH E;  2EQ3 A;  1MEY C;  2E72 A;  3EPL A;  2E1M A;  5IT9 C;  1T4L B;  1UIL A;  2V88 A;  1UN6 B;  3DF6 A;  3ADI A;  1WRJ A;  2DB2 A;  4BBY A;  1WHQ A;  5IXM B;  2RS6 A;  3JU0 A;  2VF1 A;  2LRS A;  2N3G A;  3C6M A;  3P1X A;  2M7Q A;  4R03 A;  2EOE A;  4GKJ E;  2M1S A;  4DV5 E;  2YZT A;  1FKA E;  2A25 A;  2LT7 A;  2EMY A;  3EPJ A;  3HPZ A;  4RH8 A;  4R2P A;  3UK3 C;  1IMU A;  2EM9 A;  3VYY A;  2NA2 A;  1G2F C;  1ZU1 A;  2EM6 A;  2YT4 A;  1BB8 A;  4R2C A;  1A1J A;  3KWR A;  3DJW A;  5LMN E;  1HNW E;  2NUF A;  3AUZ A;  2UU9 E;  4WFT A;  3J81 C;  4O4K A;  2EM5 A;  4Q35 B;  1A1I A;  2EMB A;  5KL5 A;  1BBG A;  2L2M A;  2EOF A;  1IQS A;  2B9D A;  4R2E A;  2EWL A;  4HEI A;  3JAM C;  1L4S A;  2V83 A;  3QG5 C;  4GZN C;  2ZM6 E;  4WXC A;  4JI7 E;  4R2Q A;  2EOH A;  4X9J A;  5A6B D;  2GLI A;  2YTE A;  3ZOQ B;  4DR7 E;  1A1K A;  4LF5 E;  4GEQ B;  2ADR A;  2N3H A;  2WBS A;  2LBS B;  2DLQ A;  4F54 A;  2I13 A;  3THO B;  2LTR A;  2YTN A;  4IJD A;  2PRT A;  2JR1 A;  2LMZ A;  1YSA C;  4HTG A;  1T39 A;  3AV0 A;  2KOU A;  1GQE A;  4O24 A;  1X5W A;  4L8N A;  2MKN A;  2YTF A;  4ZYH A;  2YTQ A;  3ECR A;  4FK5 C;  5AC5 A;  1UBD C;  1XNR E;  2HC5 A;  4LU9 A;  2LJH A;  1B69 A;  2V86 A;  1A1F A;  4JI6 E;  1XNQ E;  1ZAA C;  2EM0 A;  1NCS A;  2EOR A;  5KL6 A;  2EL6 A;  1YUI A;  2RQL A;  2YRM A;  5KL7 A;  1X3C A;  2FGG A;  5KL2 A;  2ELY A;  2UXC E;  2F4V E;  4R2D A;  2EPA A;  2KHX A;  2CT1 A;  1DQ3 A;  4RHB B;  5FLX C;  2ODR C;  4DKK A;  3H09 A;  4JI0 E;  2LUQ A;  4DV0 E;  2EMZ A;  2L92 A;  1EKZ A;  2KON A;  2B3T B;  2N8X A;  1Z1B A;  4JI1 E;  1X47 A;  2CTD A;  2LE2 A;  2EOS A;  5DNY A;  2VQF E;  4LF8 E;  2LO3 A;  2YTG A;  2EMG A;  1P47 A;  2J7J A;  4F9A B;  2MC6 A;  4O5G A;  4LFC E;  2EZ6 A;  1WHN A;  2RTX A;  2EMH A;  2L3J A;  4M30 A;  3IWD A;  4F2J C;  1GTK A;  2YTD A;  2JYA A;  2EPN A;  2B7V A;  1PKP A;  4LTY A;  2V87 A;  2EMW A;  3HQ1 A;  4X8W A;  1JK1 A;  3VK6 A;  2GHF A;  2H36 X;  4DR1 E;  3EPH A;  2VRD A;  5IWA E;  4R2R A;  2VE7 C;  3C4T A;  1EH8 A;  2WBU A;  1TF6 A;  2NUG A;  2YU8 A;  3KZZ A;  4KZS A;  1QU6 A;  2V8Q B;  2EM4 A;  3JTZ A;  3FIG A;  3T1H E;  2EN8 A;  3ADG A;  2EE8 A;  2CPN A;  2RS7 A;  5F3W A;  1GZ6 A;  2EN3 A;  2VQE E;  2E5L E;  4MLV A;  1N33 E;  2RSI A;  5A6K A;  4IS1 C;  4ZYG A;  4DV6 E;  3J7A G;  1YUJ A;  4JI4 E;  3LML A;  5KL3 A;  2UUC E;  2MKD A;  4DMI A;  2L2N A;  2JWO A;  1PJT A;  2HJJ A;  1DGC A;  3MHH C;  4M2Z A;  2Q8U A;  2BB8 A;  1A1G A;  1TN9 A;  3LLH A;  4Q28 A;  2JOB A;  4JI2 E;  3IWC A;  4DR4 E;  4K0K E;  3K6Q A;  4LF9 E;  1HNZ E;  4WPY A;  4BHB A;  1X49 A;  2YTI A;  4DV2 E;  3VHT B;  3C4B A;  1YYK A;  1DI2 A;  4F6N A;  3VYX A;  3MSW A;  4M9V C;  5CFF E;  2L2K B;  4LF7 E;  2WCC 3;  2YTJ A;  2K4V A; 
#chains in the Genus database with same CATH homology
 4R2D A;  2ENC A;  2EPA A;  2YRH A;  3M99 B;  2EM3 A;  2CT1 A;  2YU5 A;  2EOZ A;  2EOE A;  2EP3 A;  1TF3 A;  2EMX A;  1X6E A;  2EML A;  2EMZ A;  2A25 A;  2DRP A;  2JP9 A;  2EOO A;  2LT7 A;  1Z1B A;  2EMY A;  2EM2 A;  2JPA A;  2EN4 A;  2CTD A;  2LV2 A;  3EPJ A;  1WJP A;  2EMA A;  2EOS A;  2EMK A;  4R2P A;  3UK3 C;  2ENA A;  2LO3 A;  2YTG A;  2EL5 A;  2EMG A;  2EM9 A;  2RPC A;  2YRK A;  1G2F C;  2WBT A;  2EOQ A;  1ZU1 A;  2J7J A;  1P47 A;  2EM6 A;  1BB8 A;  4R2C A;  1A1J A;  2EMH A;  3MHS C;  1G2D C;  4F2J C;  4WSG A;  2YSO A;  4R2A A;  2EPR A;  2YSP A;  2EL4 A;  2YTD A;  2M9A A;  2EM5 A;  2ENH A;  1A1I A;  2EMB A;  5KL5 A;  2EN6 A;  2EOF A;  2EOM A;  4R2E A;  3EPK A;  1X6F A;  2D9H A;  2EMW A;  1LLM C;  1JK1 A;  1A1L A;  2EPP A;  2CSH A;  2EMI A;  4R2S A;  2EMF A;  2GHF A;  2EOJ A;  4GZN C;  2EM8 A;  2EJ4 A;  1KJK A;  2EN7 A;  2EQ0 A;  4F6M A;  1RMD A;  4R2Q A;  3EPH A;  2VRD A;  2EOH A;  4X9J A;  2EOY A;  2EPZ A;  4R2R A;  2GLI A;  2EN2 A;  2YTE A;  2WBU A;  2EOI A;  2YTO A;  2DLK A;  1A1K A;  1TF6 A;  2ADR A;  1BBO A;  1X6H A;  2YTP A;  2YU8 A;  1A1H A;  2WBS A;  2DLQ A;  2EM4 A;  1JK2 A;  2EM7 A;  2DGC A;  2I13 A;  2EN8 A;  2EPU A;  1F2I G;  2EE8 A;  2YTN A;  2DMI A;  4IJD A;  2PRT A;  2EN3 A;  2EPC A;  1YSA C;  2RSI A;  1X5W A;  4IS1 C;  2MKN A;  2YTF A;  1YUJ A;  2LCE A;  2YTQ A;  4FK5 C;  1ZR9 A;  1UBD C;  2EMC A;  2ELZ A;  5KL4 A;  5KL3 A;  2MKD A;  2EOX A;  1B69 A;  1A1F A;  2EN1 A;  2MDG A;  2EPX A;  1AAY A;  1DGC A;  3MHH C;  2BB8 A;  1A1G A;  1TN9 A;  1ZAA C;  2EM0 A;  2NAB A;  1NCS A;  2EOR A;  5KL6 A;  2EQ1 A;  2EL6 A;  1YUI A;  2R1F A;  2EQ3 A;  2YTI A;  2YRM A;  5KL7 A;  1MEY C;  3VHT B;  2LVH A;  4F6N A;  2E72 A;  3EPL A;  1X3C A;  4M9V C;  2HGH A;  5KL2 A;  2ELY A;  1UN6 B;  2WCC 3;  2YTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...