2EPPA

Solution structure of the first c2h2 type zinc finger domain of zinc finger protein 278
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
b'GSSGSSGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POZ-, AT hook-, and zinc finger-containing protein 1
publication title Solution structure of the first C2H2 type zinc finger domain of Zinc finger protein 278
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eppA01
2VRDA 2EQ3A 2LVHA 2EMBA 2WBTA 2PRTA 2EL5A 2EN6A 2EM8A 1B69A 2E72A 2MKDA 2EMHA 2NABA 1UN6B 2HGHA 1A1IA 1JK1A 2DRPA 2YTFA 2I13A 2A25A 2EOXA 2RSIA 2YRMA 2M9AA 1ZAAC 3M99B 2EPPA 4WSGA 2YTQA 1X3CA 2EM4A 1LLMC 1F2IG 1YSAC 4IS1C 2EMFA 1A1JA 2YTIA 1X6EA 2EPRA 1P47A 2EJ4A 2EOOA 1WJPA 3UK3C 2JPAA 2EN3A 5KL7A 2CSHA 2EL4A 4R2PA 4R2QA 5KL2A 3EPHA 2EN1A 1MEYC 2EOQA 2RPCA 2EORA 2EOJA 4F2JC 2DLQA 2YU8A 2YSOA 4R2CA 3EPJA 1UBDC 4R2DA 2EPUA 2LO3A 3VHTB 2EMGA 2YSPA 2EN7A 4IJDA 1TF3A 2ENAA 2GLIA 1BBOA 2GHFA 2EL6A 2CT1A 2ADRA 2ENHA 1A1FA 2DLKA 2EOSA 2EOFA 1A1HA 2JP9A 1X6HA 2EM5A 2EM7A 2DMIA 2EP3A 2EM6A 1ZR9A 2EOIA 2EOHA 2EMAA 2EMYA 4F6NA 2EMKA 1NCSA 2EOMA 2EMXA 2EN4A 5KL3A 2EQ0A 5KL6A 2BB8A 3EPLA 1ZU1A 4F6MA 4GZNC 1A1GA 2DGCA 4R2SA 2LV2A 2ELZA 2YU5A 2D9HA 1TF6A 1BB8A 2EMIA 2LCEA 1YUIA 5KL4A 2EM9A 2YTGA 1AAYA 2EN8A 2EMCA 2YTNA 2WCC3 2EQ1A 1TN9A 2YRHA 2YTPA 2J7JA 4R2RA 2YTDA 2EM2A 2EM3A 2MDGA 2YTJA 1JK2A 2WBSA 2EOZA 1G2FC 1DGCA 2CTDA 2MKNA 3MHSC 1KJKA 3EPKA 2LT7A 2YTOA 4R2AA 2EMZA 5KL5A 1RMDA 2EPXA 4FK5C 2EPCA 1YUJA 2EPAA 1X5WA 2EE8A 2EMWA 2YRKA 1A1LA 2EMLA 1Z1BA 4M9VC 2EPZA 2EM0A 3MHHC 2WBUA 2EN2A 2EOEA 2ELYA 1A1KA 4X9JA 2ENCA 4R2EA 2R1FA 2EOYA 1G2DC 2YTEA 1X6FA
chains in the Genus database with same CATH superfamily
4M0VA 5A6KA 2WBTA 2EMBA 2EM8A 2MKDA 4X62E 2FGGA 4TUGA 2K7IA 1KYQA 2EPMX 3EQ1A 4JI1E 4DV4E 3C6KA 3M99B 3J80C 4KHPE 2EPPA 2MDRA 2N3HA 1HNXE 4IS1C 2EMFA 1A1JA 2HJJA 4LF9E 5CFFE 4DR6E 1P47A 1SR9A 2EPNA 2HHHE 2JPAA 2VE7C 5KL7A 2CSHA 3F6GA 4R2PA 4DV5E 4JYAE 5AE3A 2K4VA 1YYOA 2EZ6A 2RPCA 4X64E 3EPJA 3KWRA 4JV5E 1WHNA 1IBLE 1EH6A 4K0KE 2L2KB 2LJHA 4R03A 5F3WA 4DMIA 3HXLA 2FV4B 2GLIA 2ENAA 2ODRC 4BS9A 2CT1A 2L8TA 1XNQE 2LTSA 1T39A 2EP3A 2DMIA 2F8BA 2EOIA 2NUGA 2DSYA 2EOMA 2L2MA 1IMUA 2EQ0A 3JAMC 5A69A 2DGCA 2LV2A 2ELZA 1EH8A 2JWOA 4DV0E 1TF6A 1BB8A 4KZSA 2LCEA 1WXRA 2BBGA 1HR0E 2KONA 5LMNE 2YWQA 1AAYA 3JU0A 2EMCA 4YHHE 2B9DA 4JI7E 4O43A 2JR1A 2J7JA 4R2RA 2E1MA 2EM2A 2EM3A 2YTJA 5AC5A 1G2FC 4DR3E 4LF7E 2UU9E 2UXBE 3F6HA 2LMZA 2V8QB 3MHSC 4DR2E 4MLQA 2V87A 1BBGA 2RS6A 2KHXA 4DUZE 2UUCE 4RH8A 4R8OA 4BHCA 4M9VC 2RSMA 4GEQB 2EOEA 2ELYA 4X9JA 4R2EA 2VRDA 2PRTA 1XNRE 2HGHA 2YT4A 4DR5E 4WX9A 1PJTA 4WYQB 2DRPA 1PKPA 1GZ6A 2A25A 2RSIA 2YRMA 4J8ZA 4GKKE 4L8NA 4B3SE 4M30A 2MC6A 4DR7E 2V88A 4WXCA 3J7AG 2YTQA 2DMYA 2JXPA 1LLMC 2IHR1 1J5EE 4JI0E 2I9IA 3QG5C 1T38A 1X6EA 1RC7A 3HPZA 4JI3E 1N33E 2RTXA 1FJGE 5KL2A 1MEYC 4DR1E 5T6JA 3T1YE 4NXNE 4R2CA 2YSOA 1PJSA 3H09A 1UBDC 4R2DA 2LO3A 3IWBA 4WSPA 2EMGA 5IWAE 2YSPA 1AH5A 2RQLA 2EL6A 2ADRA 4KWYA 1UILA 2EM5A 2EM7A 4P7DA 1ZR9A 4BC7A 2EOHA 5TSEA 3RMPA 2EMYA 4F6NA 3BF2A 1X49A 1X48A 5KL6A 2BB8A 3K6QA 4ZYHA 3EPLA 4DV6E 4F6MA 4GZNC 1DI2A 4BMJA 4R2SA 2B7VA 2YU5A 4LFAE 4LTYA 4RHBB 1I94E 5DNYA 1HNZE 4JI5E 2UXCE 2EMIA 1N36E 4ZYDA 5A6BA 2YPNA 2EPOA 2YTGA 2JOBA 3LLHA 2EN8A 2YTNA 3KZYA 5LL6R 3T1HE 4BHBA 3L00A 3FIGA 4JI6E 4NXME 3VK6A 1L4SA 1WHQA 3HPSA 2YZTA 1JK2A 1PDAA 2LE2A 2JYAA 1N32E 5A6BD 2MKNA 2NUFA 5AE1A 3EPKA 4Q35B 2VF1A 4JI4E 1GQEA 2NUEA 4R2AA 1RMDA 2EWLA 2EPXA 1N3GA 2EPCA 2L3JA 2EE8A 1ZBQA 2MC5A 5BR8E 2L2NA 4Q28A 2EPZA 2EM0A 3VYYA 2L6MA 3J81C 2WBUA 2EN2A 1IBME 1A1KA 2R1FA 2EOYA 1XMOE 2EPLX 2EQ3A 2EL5A 1ZBTA 2EN6A 1DQ3A 2CPNA 2FTXB 4DR4E 4X66E 3OTOE 2YTFA 2EOXA 2M9AA 1T4NA 1J26A 4X65E 3HTXA 2WZOA 4WSGA 3BIDA 1X3CA 4ZYEA 2F4VE 2EM4A 1F2IG 1YSAC 2EPRA 2EJ4A 2NA2A 4O4KA 1WJPA 3UK3C 1STUA 1FKAE 1G2DC 2G7HA 2EL4A 5LLQA 4R2QA 3EPHA 2EOQA 2EOJA 4F2JC 2DLQA 2YU8A 4HTGA 2EPUA 4DV2E 2JY9A 2L3CA 3VHTB 2L33A 1QU6A 4IJDA 4F9BB 1TF3A 2GHFA 2ENHA 2JP9A 2JOXA 2EOFA 1IBKE 1A1HA 1X6HA 2LRSA 2EM6A 2VQEE 5A6AA 1NCSA 2EN4A 5KL3A 4B3RE 1ZU1A 2ZM6E 1YYKA 2HC5A 3ADGA 2LBSB 4NHRA 4B3TE 2EPKX 1X47A 1YUIA 3AV0A 1YYWA 1YFHA 1NEIA 1GTKA 2EQ1A 3J7Yp 2YRHA 2V89A 2KOUA 3JTZA 2YTDA 4JI2E 2JVAA 2M4IA 3C6MA 1T4LB 2B7TA 1YZ9A 2CTDA 4NZVA 3THNA 4DUYE 1KJKA 2DIXA 4DKKA 3VYXA 2UUAE 2YTOA 4X8WA 3C4BA 2V86A 1YUJA 2UXDE 2EPAA 2YRKA 1IQOA 4GKJE 1A1LA 4MLVA 4M2ZA 4I8OA 2V85A 1T4OA 5IV8B 1EH7A 1HNWE 4BCAA 3ADLA 2LVHA 4O24A 1B69A 2E72A 2EMHA 2NABA 1UN6B 4HEIA 4LFCE 1A1IA 2B3TB 1JK1A 4B3ME 3ADIA 5A2QC 2I13A 3P1XA 4LF4E 4JI8E 3ECRA 5FLXC 1MGTA 1ZAAC 4OX9E 2LJUA 4ZYGA 4TUIA 3BGHA 4F54A 2YTIA 1RQ0A 5LMUE 3ZOQB 1WRJA 5AASA 2EOOA 3TQMA 4BC9A 2EN3A 2LUQA 2EN1A 1IQSA 2VQFE 1SFEA 2EORA 3C4TA 4DV3E 1YPNA 3IWCA 3DJWA 4LF6E 4BBYA 5AC4A 2M1SA 3BBGA 4F9CB 2EN7A 1PJQA 1BBOA 1A1FA 2DLKA 2EOSA 3KZZA 4YY3E 5IT9C 2EMAA 4WXDA 2EMKA 3OMLA 2N3GA 2EMXA 4WPYA 2GPIA 3ADJA 1A1GA 4N4RB 4DV1E 4LF8E 1O0WA 2D9HA 1EKZA 3AUZA 3LMLA 2V83A 4LF5E 5KL4A 2E5LE 4WFTA 2EM9A 4P78A 2WCC3 4OOGC 5IXMB 3IWDA 2YTPA 1TN9A 4DV7E 4LU9A 2UUBE 2MDGA 2R76A 5A6JA 4O5GA 4F9AB 2WBSA 2EOZA 1DGCA 1QNTA 2RS7A 4LFBE 3DF6A 2H36X 4AQYE 2LT7A 2EMZA 5KL5A 3HQ1A 4L5NC 4FK5C 1UHZA 2M7QA 1X5WA 2LTRA 2EMWA 2DB2A 2EMLA 3MSWA 1Z1BA 3MHHC 3THOB 2ODRD 1XMQE 2ENCA 2LUPB 1N34E 5AE2A 2L92A 2Q8UA 2YTEA 2N8XA 5ADZA 1X6FA
chains in the Genus database with same CATH topology
2VRDA 2EQ3A 2LVHA 2EMBA 2WBTA 2PRTA 2EL5A 2EN6A 2EM8A 1B69A 2E72A 2MKDA 2EMHA 2NABA 1UN6B 2HGHA 1A1IA 1JK1A 2DRPA 2YTFA 2I13A 2A25A 2EOXA 2RSIA 2YRMA 2M9AA 1ZAAC 3M99B 2EPPA 4WSGA 2YTQA 1X3CA 2EM4A 1LLMC 1F2IG 1YSAC 4IS1C 2EMFA 1A1JA 2YTIA 1X6EA 2EPRA 1P47A 2EJ4A 2EOOA 1WJPA 3UK3C 2JPAA 2EN3A 5KL7A 2CSHA 2EL4A 4R2PA 4R2QA 5KL2A 3EPHA 2EN1A 1MEYC 2EOQA 2RPCA 2EORA 2EOJA 4F2JC 2DLQA 2YU8A 2YSOA 4R2CA 3EPJA 1UBDC 4R2DA 2EPUA 2LO3A 3VHTB 2EMGA 2YSPA 2EN7A 4IJDA 1TF3A 2ENAA 2GLIA 1BBOA 2GHFA 2EL6A 2CT1A 2ADRA 2ENHA 1A1FA 2DLKA 2EOSA 2EOFA 1A1HA 2JP9A 1X6HA 2EM5A 2EM7A 2DMIA 2EP3A 2EM6A 1ZR9A 2EOIA 2EOHA 2EMAA 2EMYA 4F6NA 2EMKA 1NCSA 2EOMA 2EMXA 2EN4A 5KL3A 2EQ0A 5KL6A 2BB8A 3EPLA 1ZU1A 4F6MA 4GZNC 1A1GA 2DGCA 4R2SA 2LV2A 2ELZA 2YU5A 2D9HA 1TF6A 1BB8A 2EMIA 2LCEA 1YUIA 5KL4A 2EM9A 2YTGA 1AAYA 2EN8A 2EMCA 2YTNA 2WCC3 2EQ1A 1TN9A 2YRHA 2YTPA 2J7JA 4R2RA 2YTDA 2EM2A 2EM3A 2MDGA 2YTJA 1JK2A 2WBSA 2EOZA 1G2FC 1DGCA 2CTDA 2MKNA 3MHSC 1KJKA 3EPKA 2LT7A 2YTOA 4R2AA 2EMZA 5KL5A 1RMDA 2EPXA 4FK5C 2EPCA 1YUJA 2EPAA 1X5WA 2EE8A 2EMWA 2YRKA 1A1LA 2EMLA 1Z1BA 4M9VC 2EPZA 2EM0A 3MHHC 2WBUA 2EN2A 2EOEA 2ELYA 1A1KA 4X9JA 2ENCA 4R2EA 2R1FA 2EOYA 1G2DC 2YTEA 1X6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRD A;  2EQ3 A;  2LVH A;  2EMB A;  2WBT A;  2PRT A;  2EL5 A;  2EN6 A;  2EM8 A;  1B69 A;  2E72 A;  2MKD A;  2EMH A;  2NAB A;  1UN6 B;  2HGH A;  1A1I A;  1JK1 A;  2DRP A;  2YTF A;  2I13 A;  2A25 A;  2EOX A;  2RSI A;  2YRM A;  2M9A A;  1ZAA C;  3M99 B;  2EPP A;  4WSG A;  2YTQ A;  1X3C A;  2EM4 A;  1LLM C;  1F2I G;  1YSA C;  4IS1 C;  2EMF A;  1A1J A;  2YTI A;  1X6E A;  2EPR A;  1P47 A;  2EJ4 A;  2EOO A;  1WJP A;  3UK3 C;  2JPA A;  2EN3 A;  5KL7 A;  2CSH A;  2EL4 A;  4R2P A;  4R2Q A;  5KL2 A;  3EPH A;  2EN1 A;  1MEY C;  2EOQ A;  2RPC A;  2EOR A;  2EOJ A;  4F2J C;  2DLQ A;  2YU8 A;  2YSO A;  4R2C A;  3EPJ A;  1UBD C;  4R2D A;  2EPU A;  2LO3 A;  3VHT B;  2EMG A;  2YSP A;  2EN7 A;  4IJD A;  1TF3 A;  2ENA A;  2GLI A;  1BBO A;  2GHF A;  2EL6 A;  2CT1 A;  2ADR A;  2ENH A;  1A1F A;  2DLK A;  2EOS A;  2EOF A;  1A1H A;  2JP9 A;  1X6H A;  2EM5 A;  2EM7 A;  2DMI A;  2EP3 A;  2EM6 A;  1ZR9 A;  2EOI A;  2EOH A;  2EMA A;  2EMY A;  4F6N A;  2EMK A;  1NCS A;  2EOM A;  2EMX A;  2EN4 A;  5KL3 A;  2EQ0 A;  5KL6 A;  2BB8 A;  3EPL A;  1ZU1 A;  4F6M A;  4GZN C;  1A1G A;  2DGC A;  4R2S A;  2LV2 A;  2ELZ A;  2YU5 A;  2D9H A;  1TF6 A;  1BB8 A;  2EMI A;  2LCE A;  1YUI A;  5KL4 A;  2EM9 A;  2YTG A;  1AAY A;  2EN8 A;  2EMC A;  2YTN A;  2WCC 3;  2EQ1 A;  1TN9 A;  2YRH A;  2YTP A;  2J7J A;  4R2R A;  2YTD A;  2EM2 A;  2EM3 A;  2MDG A;  2YTJ A;  1JK2 A;  2WBS A;  2EOZ A;  1G2F C;  1DGC A;  2CTD A;  2MKN A;  3MHS C;  1KJK A;  3EPK A;  2LT7 A;  2YTO A;  4R2A A;  2EMZ A;  5KL5 A;  1RMD A;  2EPX A;  4FK5 C;  2EPC A;  1YUJ A;  2EPA A;  1X5W A;  2EE8 A;  2EMW A;  2YRK A;  1A1L A;  2EML A;  1Z1B A;  4M9V C;  2EPZ A;  2EM0 A;  3MHH C;  2WBU A;  2EN2 A;  2EOE A;  2ELY A;  1A1K A;  4X9J A;  2ENC A;  4R2E A;  2R1F A;  2EOY A;  1G2D C;  2YTE A;  1X6F A; 
#chains in the Genus database with same CATH topology
 4M0V A;  5A6K A;  2WBT A;  2EMB A;  2EM8 A;  2MKD A;  4X62 E;  2FGG A;  4TUG A;  2K7I A;  1KYQ A;  2EPM X;  3EQ1 A;  4JI1 E;  4DV4 E;  3C6K A;  3M99 B;  3J80 C;  4KHP E;  2EPP A;  2MDR A;  2N3H A;  1HNX E;  4IS1 C;  2EMF A;  1A1J A;  2HJJ A;  4LF9 E;  5CFF E;  4DR6 E;  1P47 A;  1SR9 A;  2EPN A;  2HHH E;  2JPA A;  2VE7 C;  5KL7 A;  2CSH A;  3F6G A;  4R2P A;  4DV5 E;  4JYA E;  5AE3 A;  2K4V A;  1YYO A;  2EZ6 A;  2RPC A;  4X64 E;  3EPJ A;  3KWR A;  4JV5 E;  1WHN A;  1IBL E;  1EH6 A;  4K0K E;  2L2K B;  2LJH A;  4R03 A;  5F3W A;  4DMI A;  3HXL A;  2FV4 B;  2GLI A;  2ENA A;  2ODR C;  4BS9 A;  2CT1 A;  2L8T A;  1XNQ E;  2LTS A;  1T39 A;  2EP3 A;  2DMI A;  2F8B A;  2EOI A;  2NUG A;  2DSY A;  2EOM A;  2L2M A;  1IMU A;  2EQ0 A;  3JAM C;  5A69 A;  2DGC A;  2LV2 A;  2ELZ A;  1EH8 A;  2JWO A;  4DV0 E;  1TF6 A;  1BB8 A;  4KZS A;  2LCE A;  1WXR A;  2BBG A;  1HR0 E;  2KON A;  5LMN E;  2YWQ A;  1AAY A;  3JU0 A;  2EMC A;  4YHH E;  2B9D A;  4JI7 E;  4O43 A;  2JR1 A;  2J7J A;  4R2R A;  2E1M A;  2EM2 A;  2EM3 A;  2YTJ A;  5AC5 A;  1G2F C;  4DR3 E;  4LF7 E;  2UU9 E;  2UXB E;  3F6H A;  2LMZ A;  2V8Q B;  3MHS C;  4DR2 E;  4MLQ A;  2V87 A;  1BBG A;  2RS6 A;  2KHX A;  4DUZ E;  2UUC E;  4RH8 A;  4R8O A;  4BHC A;  4M9V C;  2RSM A;  4GEQ B;  2EOE A;  2ELY A;  4X9J A;  4R2E A;  2VRD A;  2PRT A;  1XNR E;  2HGH A;  2YT4 A;  4DR5 E;  4WX9 A;  1PJT A;  4WYQ B;  2DRP A;  1PKP A;  1GZ6 A;  2A25 A;  2RSI A;  2YRM A;  4J8Z A;  4GKK E;  4L8N A;  4B3S E;  4M30 A;  2MC6 A;  4DR7 E;  2V88 A;  4WXC A;  3J7A G;  2YTQ A;  2DMY A;  2JXP A;  1LLM C;  2IHR 1;  1J5E E;  4JI0 E;  2I9I A;  3QG5 C;  1T38 A;  1X6E A;  1RC7 A;  3HPZ A;  4JI3 E;  1N33 E;  2RTX A;  1FJG E;  5KL2 A;  1MEY C;  4DR1 E;  5T6J A;  3T1Y E;  4NXN E;  4R2C A;  2YSO A;  1PJS A;  3H09 A;  1UBD C;  4R2D A;  2LO3 A;  3IWB A;  4WSP A;  2EMG A;  5IWA E;  2YSP A;  1AH5 A;  2RQL A;  2EL6 A;  2ADR A;  4KWY A;  1UIL A;  2EM5 A;  2EM7 A;  4P7D A;  1ZR9 A;  4BC7 A;  2EOH A;  5TSE A;  3RMP A;  2EMY A;  4F6N A;  3BF2 A;  1X49 A;  1X48 A;  5KL6 A;  2BB8 A;  3K6Q A;  4ZYH A;  3EPL A;  4DV6 E;  4F6M A;  4GZN C;  1DI2 A;  4BMJ A;  4R2S A;  2B7V A;  2YU5 A;  4LFA E;  4LTY A;  4RHB B;  1I94 E;  5DNY A;  1HNZ E;  4JI5 E;  2UXC E;  2EMI A;  1N36 E;  4ZYD A;  5A6B A;  2YPN A;  2EPO A;  2YTG A;  2JOB A;  3LLH A;  2EN8 A;  2YTN A;  3KZY A;  5LL6 R;  3T1H E;  4BHB A;  3L00 A;  3FIG A;  4JI6 E;  4NXM E;  3VK6 A;  1L4S A;  1WHQ A;  3HPS A;  2YZT A;  1JK2 A;  1PDA A;  2LE2 A;  2JYA A;  1N32 E;  5A6B D;  2MKN A;  2NUF A;  5AE1 A;  3EPK A;  4Q35 B;  2VF1 A;  4JI4 E;  1GQE A;  2NUE A;  4R2A A;  1RMD A;  2EWL A;  2EPX A;  1N3G A;  2EPC A;  2L3J A;  2EE8 A;  1ZBQ A;  2MC5 A;  5BR8 E;  2L2N A;  4Q28 A;  2EPZ A;  2EM0 A;  3VYY A;  2L6M A;  3J81 C;  2WBU A;  2EN2 A;  1IBM E;  1A1K A;  2R1F A;  2EOY A;  1XMO E;  2EPL X;  2EQ3 A;  2EL5 A;  1ZBT A;  2EN6 A;  1DQ3 A;  2CPN A;  2FTX B;  4DR4 E;  4X66 E;  3OTO E;  2YTF A;  2EOX A;  2M9A A;  1T4N A;  1J26 A;  4X65 E;  3HTX A;  2WZO A;  4WSG A;  3BID A;  1X3C A;  4ZYE A;  2F4V E;  2EM4 A;  1F2I G;  1YSA C;  2EPR A;  2EJ4 A;  2NA2 A;  4O4K A;  1WJP A;  3UK3 C;  1STU A;  1FKA E;  1G2D C;  2G7H A;  2EL4 A;  5LLQ A;  4R2Q A;  3EPH A;  2EOQ A;  2EOJ A;  4F2J C;  2DLQ A;  2YU8 A;  4HTG A;  2EPU A;  4DV2 E;  2JY9 A;  2L3C A;  3VHT B;  2L33 A;  1QU6 A;  4IJD A;  4F9B B;  1TF3 A;  2GHF A;  2ENH A;  2JP9 A;  2JOX A;  2EOF A;  1IBK E;  1A1H A;  1X6H A;  2LRS A;  2EM6 A;  2VQE E;  5A6A A;  1NCS A;  2EN4 A;  5KL3 A;  4B3R E;  1ZU1 A;  2ZM6 E;  1YYK A;  2HC5 A;  3ADG A;  2LBS B;  4NHR A;  4B3T E;  2EPK X;  1X47 A;  1YUI A;  3AV0 A;  1YYW A;  1YFH A;  1NEI A;  1GTK A;  2EQ1 A;  3J7Y p;  2YRH A;  2V89 A;  2KOU A;  3JTZ A;  2YTD A;  4JI2 E;  2JVA A;  2M4I A;  3C6M A;  1T4L B;  2B7T A;  1YZ9 A;  2CTD A;  4NZV A;  3THN A;  4DUY E;  1KJK A;  2DIX A;  4DKK A;  3VYX A;  2UUA E;  2YTO A;  4X8W A;  3C4B A;  2V86 A;  1YUJ A;  2UXD E;  2EPA A;  2YRK A;  1IQO A;  4GKJ E;  1A1L A;  4MLV A;  4M2Z A;  4I8O A;  2V85 A;  1T4O A;  5IV8 B;  1EH7 A;  1HNW E;  4BCA A;  3ADL A;  2LVH A;  4O24 A;  1B69 A;  2E72 A;  2EMH A;  2NAB A;  1UN6 B;  4HEI A;  4LFC E;  1A1I A;  2B3T B;  1JK1 A;  4B3M E;  3ADI A;  5A2Q C;  2I13 A;  3P1X A;  4LF4 E;  4JI8 E;  3ECR A;  5FLX C;  1MGT A;  1ZAA C;  4OX9 E;  2LJU A;  4ZYG A;  4TUI A;  3BGH A;  4F54 A;  2YTI A;  1RQ0 A;  5LMU E;  3ZOQ B;  1WRJ A;  5AAS A;  2EOO A;  3TQM A;  4BC9 A;  2EN3 A;  2LUQ A;  2EN1 A;  1IQS A;  2VQF E;  1SFE A;  2EOR A;  3C4T A;  4DV3 E;  1YPN A;  3IWC A;  3DJW A;  4LF6 E;  4BBY A;  5AC4 A;  2M1S A;  3BBG A;  4F9C B;  2EN7 A;  1PJQ A;  1BBO A;  1A1F A;  2DLK A;  2EOS A;  3KZZ A;  4YY3 E;  5IT9 C;  2EMA A;  4WXD A;  2EMK A;  3OML A;  2N3G A;  2EMX A;  4WPY A;  2GPI A;  3ADJ A;  1A1G A;  4N4R B;  4DV1 E;  4LF8 E;  1O0W A;  2D9H A;  1EKZ A;  3AUZ A;  3LML A;  2V83 A;  4LF5 E;  5KL4 A;  2E5L E;  4WFT A;  2EM9 A;  4P78 A;  2WCC 3;  4OOG C;  5IXM B;  3IWD A;  2YTP A;  1TN9 A;  4DV7 E;  4LU9 A;  2UUB E;  2MDG A;  2R76 A;  5A6J A;  4O5G A;  4F9A B;  2WBS A;  2EOZ A;  1DGC A;  1QNT A;  2RS7 A;  4LFB E;  3DF6 A;  2H36 X;  4AQY E;  2LT7 A;  2EMZ A;  5KL5 A;  3HQ1 A;  4L5N C;  4FK5 C;  1UHZ A;  2M7Q A;  1X5W A;  2LTR A;  2EMW A;  2DB2 A;  2EML A;  3MSW A;  1Z1B A;  3MHH C;  3THO B;  2ODR D;  1XMQ E;  2ENC A;  2LUP B;  1N34 E;  5AE2 A;  2L92 A;  2Q8U A;  2YTE A;  2N8X A;  5ADZ A;  1X6F A; 
#chains in the Genus database with same CATH homology
 2VRD A;  2EQ3 A;  2LVH A;  2EMB A;  2WBT A;  2PRT A;  2EL5 A;  2EN6 A;  2EM8 A;  1B69 A;  2E72 A;  2MKD A;  2EMH A;  2NAB A;  1UN6 B;  2HGH A;  1A1I A;  1JK1 A;  2DRP A;  2YTF A;  2I13 A;  2A25 A;  2EOX A;  2RSI A;  2YRM A;  2M9A A;  1ZAA C;  3M99 B;  2EPP A;  4WSG A;  2YTQ A;  1X3C A;  2EM4 A;  1LLM C;  1F2I G;  1YSA C;  4IS1 C;  2EMF A;  1A1J A;  2YTI A;  1X6E A;  2EPR A;  1P47 A;  2EJ4 A;  2EOO A;  1WJP A;  3UK3 C;  2JPA A;  2EN3 A;  5KL7 A;  2CSH A;  2EL4 A;  4R2P A;  4R2Q A;  5KL2 A;  3EPH A;  2EN1 A;  1MEY C;  2EOQ A;  2RPC A;  2EOR A;  2EOJ A;  4F2J C;  2DLQ A;  2YU8 A;  2YSO A;  4R2C A;  3EPJ A;  1UBD C;  4R2D A;  2EPU A;  2LO3 A;  3VHT B;  2EMG A;  2YSP A;  2EN7 A;  4IJD A;  1TF3 A;  2ENA A;  2GLI A;  1BBO A;  2GHF A;  2EL6 A;  2CT1 A;  2ADR A;  2ENH A;  1A1F A;  2DLK A;  2EOS A;  2EOF A;  1A1H A;  2JP9 A;  1X6H A;  2EM5 A;  2EM7 A;  2DMI A;  2EP3 A;  2EM6 A;  1ZR9 A;  2EOI A;  2EOH A;  2EMA A;  2EMY A;  4F6N A;  2EMK A;  1NCS A;  2EOM A;  2EMX A;  2EN4 A;  5KL3 A;  2EQ0 A;  5KL6 A;  2BB8 A;  3EPL A;  1ZU1 A;  4F6M A;  4GZN C;  1A1G A;  2DGC A;  4R2S A;  2LV2 A;  2ELZ A;  2YU5 A;  2D9H A;  1TF6 A;  1BB8 A;  2EMI A;  2LCE A;  1YUI A;  5KL4 A;  2EM9 A;  2YTG A;  1AAY A;  2EN8 A;  2EMC A;  2YTN A;  2WCC 3;  2EQ1 A;  1TN9 A;  2YRH A;  2YTP A;  2J7J A;  4R2R A;  2YTD A;  2EM2 A;  2EM3 A;  2MDG A;  2YTJ A;  1JK2 A;  2WBS A;  2EOZ A;  1G2F C;  1DGC A;  2CTD A;  2MKN A;  3MHS C;  1KJK A;  3EPK A;  2LT7 A;  2YTO A;  4R2A A;  2EMZ A;  5KL5 A;  1RMD A;  2EPX A;  4FK5 C;  2EPC A;  1YUJ A;  2EPA A;  1X5W A;  2EE8 A;  2EMW A;  2YRK A;  1A1L A;  2EML A;  1Z1B A;  4M9V C;  2EPZ A;  2EM0 A;  3MHH C;  2WBU A;  2EN2 A;  2EOE A;  2ELY A;  1A1K A;  4X9J A;  2ENC A;  4R2E A;  2R1F A;  2EOY A;  1G2D C;  2YTE A;  1X6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...