2MC6A

A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase inhibitor p7
publication title A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement.
pubmed doi rcsb
source organism Xanthomonas phage xp10
molecule tags Transcription
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.560 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mc6A00
2MC5A 2MC6A
chains in the Genus database with same CATH superfamily
5AASA 4F9CB 3JTZA 3L00A 4IJDA 3M99B 1J5EE 2LV2A 4L5NC 2EOQA 2K7IA 4B3RE 4HEIA 5AC5A 1X6HA 3VYXA 2EOIA 2I13A 2EMWA 2RSIA 4P78A 4WFTA 3EPHA 5LL6R 2M4IA 2LE2A 2HHHE 4M9VC 4F6MA 4BC7A 2DGCA 2EN3A 3J7AG 4OOGC 2UXCE 1LLMC 2ENHA 2YTQA 2EWLA 2EOMA 1UBDC 4LFAE 4DR4E 3C6MA 2LTSA 4X9JA 3EPLA 4B3TE 2DB2A 2B7TA 4BHBA 4NHRA 3JU0A 1ZR9A 5FLXC 1A1IA 4JI5E 4R8OA 4KHPE 2UUAE 2L92A 1NEIA 4GEQB 4O24A 4JV5E 2EMBA 2ENCA 2YZTA 4MLVA 2EMXA 1EH8A 2EN7A 1WHQA 2EQ1A 4X62E 1IBME 3VK6A 2Q8UA 2L2NA 5TSEA 4F2JC 2GLIA 4BMJA 2V86A 1T39A 3IWDA 5A6AA 2CPNA 4DV2E 4DR7E 3EQ1A 4R2RA 2M1SA 2VQEE 2EM9A 1T38A 3AUZA 2LRSA 3KZYA 1B69A 2EPXA 1YYOA 1RMDA 2WZOA 4DV0E 2KOUA 4YY3E 2WBSA 2YTNA 4DV7E 2YU8A 1WHNA 3K6QA 4X65E 1Z1BA 5IT9C 4M0VA 4DV5E 1WJPA 4LU9A 1YUIA 4BC9A 1AAYA 2ZM6E 1T4NA 2EPPA 4F9BB 4K0KE 2GPIA 2JWOA 2LBSB 2EMAA 2EOSA 1JK1A 3LMLA 1STUA 2EMCA 2YTPA 4O4KA 4X66E 2UXBE 4ZYEA 3HXLA 2EQ3A 2UUBE 1IMUA 2EN2A 2JP9A 2VE7C 4ZYGA 4ZYHA 1X48A 1YUJA 4WPYA 1HNWE 2N8XA 2J7JA 4NZVA 1N34E 3C6KA 2HC5A 1QU6A 2LTRA 4DR1E 2EPCA 2JXPA 2I9IA 3THNA 2YRHA 2MC6A 4R2CA 2E72A 2JOBA 5A6JA 2EOOA 2FTXB 2EOJA 4DR2E 1WXRA 1YSAC 2UUCE 5KL2A 1KJKA 2RPCA 1L4SA 3IWCA 2L2MA 3ZOQB 2YTJA 3J81C 1SR9A 5CFFE 2EPKX 2EM2A 5AE1A 4BCAA 3UK3C 1X3CA 2ELZA 1P47A 2NA2A 4TUIA 1FKAE 4WXCA 2RTXA 4WX9A 4DUZE 1PDAA 3MSWA 2YTEA 4JI7E 3DJWA 3IWBA 4R03A 2NUEA 4LFBE 2RS6A 2L33A 2F4VE 1YFHA 1N3GA 1ZAAC 4NXME 1A1FA 2D9HA 4Q35B 4X8WA 2L3JA 4DV1E 4DR3E 1F2IG 5AE3A 1A1KA 2YRKA 3VHTB 2N3GA 2EPAA 2EPUA 2EOHA 4GKJE 2WBTA 2EM6A 3BBGA 2EM7A 4JYAE 2EPMX 2MKDA 5AC4A 2EL5A 2EOXA 2YRMA 2EZ6A 2UXDE 4ZYDA 3ECRA 3MHSC 3P1XA 1ZU1A 4JI1E 1HR0E 1X6EA 2YT4A 4DV4E 2LO3A 4DV6E 4BBYA 2EMFA 1DQ3A 2LUQA 3DF6A 1X6FA 4KWYA 2L2KB 3VYYA 3BIDA 2NUFA 4DUYE 1BB8A 2ELYA 1PKPA 5ADZA 2EP3A 2M7QA 2R1FA 3F6GA 2EMYA 1YPNA 2EMIA 2EOYA 5A6KA 5LMNE 3RMPA 2DMYA 4GKKE 2CTDA 5A6BD 2CSHA 1TF3A 4DV3E 1MEYC 1ZBQA 2V8QB 2YTIA 2JPAA 2EMHA 4WSGA 1KYQA 1FJGE 4LF9E 1TF6A 1IBKE 2YSOA 2JR1A 2G7HA 4LFCE 2EN6A 2EN8A 3HPZA 2EMZA 5BR8E 2RS7A 2IHR1 2L3CA 2YTGA 3ADIA 1J26A 4NXNE 3ADJA 1EH6A 4P7DA 2DRPA 3T1HE 4R2AA 1UILA 2JYAA 4DKKA 1ZBTA 3J80C 2F8BA 3KWRA 4F9AB 1AH5A 4B3ME 2MC5A 1HNXE 4HTGA 4N4RB 5KL3A 2H36X 3FIGA 2EJ4A 2LCEA 4BHCA 4DR5E 2EM3A 4LF4E 4LF5E 5DNYA 2M9AA 2YPNA 2LJUA 1IBLE 1IQSA 4DR6E 1GTKA 4LTYA 1A1GA 1O0WA 2GHFA 3JAMC 4F54A 1BBOA 1PJSA 5A6BA 2A25A 2JVAA 1SFEA 2EOZA 2DSYA 4IS1C 5IXMB 2HGHA 2EM0A 2EOEA 3F6HA 4R2SA 1YYKA 2DIXA 4M2ZA 2LUPB 1N36E 1RQ0A 2B3TB 1PJTA 1XMOE 2WCC3 4R2QA 4I8OA 2VF1A 2EMLA 1I94E 4L8NA 2MDGA 4O5GA 2LT7A 5IWAE 3C4BA 4LF8E 3HQ1A 2UU9E 2YTFA 2EPNA 2EM4A 3KZZA 4DMIA 2LJHA 2EM8A 3AV0A 4R2EA 1X47A 2DMIA 1IQOA 3LLHA 2BB8A 2DLKA 4YHHE 2LVHA 2PRTA 2EPRA 2LMZA 3HPSA 2EM5A 4MLQA 5LLQA 1BBGA 1XNQE 1DGCA 1N32E 4AQYE 4JI8E 2BBGA 2RQLA 5A69A 1N33E 2YTOA 1EH7A 1XNRE 2RSMA 1DI2A 2VQFE 4WSPA 2EN4A 4WXDA 5AE2A 2V83A 2ODRD 3ADGA 4GZNC 1HNZE 2K4VA 1PJQA 2FGGA 2YTDA 2VRDA 1T4OA 2YWQA 1XMQE 1A1LA 2B7VA 4JI0E 4BS9A 4JI2E 4WYQB 2EMKA 2EPZA 2MDRA 2EPLX 2V85A 4RHBB 2L6MA 4FK5C 3EPKA 3C4TA 1RC7A 5T6JA 1YYWA 1GZ6A 3THOB 2EL6A 2EL4A 1MGTA 1JK2A 4O43A 2EPOA 2HJJA 1UHZA 3T1YE 3BF2A 2DLQA 4KZSA 2EORA 2V87A 2N3HA 2YSPA 2KONA 4B3SE 4RH8A 4R2DA 2E5LE 4TUGA 4JI6E 1X5WA 5KL5A 3HTXA 3BGHA 2EN1A 4J8ZA 4LF6E 1QNTA 2V89A 1T4LB 4Q28A 2EMGA 3MHHC 3QG5C 2WBUA 4M30A 2JOXA 2MKNA 2FV4B 5KL6A 1NCSA 3OMLA 2B9DA 3TQMA 5A2QC 3ADLA 4LF7E 5LMUE 2ADRA 2E1MA 4JI4E 5KL7A 3OTOE 2JY9A 2EE8A 1G2DC 4R2PA 2ODRC 3J7Yp 1A1HA 2CT1A 1UN6B 2NABA 2R76A 1X49A 2EQ0A 5KL4A 2KHXA 2NUGA 4F6NA 4OX9E 2EOFA 1TN9A 3EPJA 1WRJA 2YU5A 3H09A 1EKZA 1A1JA 4X64E 5IV8B 1G2FC 2L8TA 1GQEA 4JI3E 1YZ9A 2ENAA 2V88A 5F3WA
chains in the Genus database with same CATH topology
2M7QA 5AASA 2UUBE 1XNRE 3F6GA 3RMPA 2RSMA 4F9CB 5LMNE 1DI2A 2VQFE 2DMYA 4WSPA 3JTZA 4GKKE 5AE2A 2V83A 2VE7C 2ODRD 3ADGA 4DV3E 1X48A 1J5EE 1HNZE 1ZBQA 4WPYA 1HNWE 2K4VA 2FGGA 2V8QB 4L5NC 5ADZA 4B3RE 1FJGE 1T4OA 1N34E 4LF9E 1QU6A 2LTRA 4DR1E 1XMQE 1IBKE 2JR1A 2B7VA 2MC6A 4JI0E 2G7HA 4BS9A 2L3CA 4JI2E 3HPZA 4LFCE 4WYQB 2RS7A 2IHR1 5BR8E 2JOBA 3ADIA 2MDRA 1J26A 4P78A 2V85A 2FTXB 3ADJA 4NXNE 4P7DA 4WFTA 4DR2E 1WXRA 2L6MA 5LL6R 3T1HE 2UUCE 2M4IA 1UILA 3C4TA 2LE2A 4DKKA 1ZBTA 3J80C 1RC7A 3IWCA 2L2MA 5T6JA 3ZOQB 2F8BA 2HHHE 3KWRA 4F9AB 3J81C 1YYWA 1GZ6A 1SR9A 4B3ME 2MC5A 4BC7A 5CFFE 1HNXE 3J7AG 4OOGC 1UHZA 5AE1A 2UXCE 3T1YE 4BCAA 2EWLA 2H36X 3FIGA 4KZSA 2NA2A 4DR5E 4LF4E 4LFAE 4LF5E 4DR4E 2V87A 4TUIA 2LTSA 5DNYA 2N3HA 1FKAE 4B3SE 2KONA 2DB2A 2RTXA 2B7TA 4DUZE 1IBLE 4B3TE 4K0KE 2E5LE 4TUGA 3JU0A 3MSWA 4DR6E 4LTYA 1O0WA 5F3WA 3JAMC 4JI6E 4F54A 3HTXA 5FLXC 4JI7E 3DJWA 2JVAA 4JI5E 3IWBA 4J8ZA 4R03A 4LF6E 2DSYA 4R8OA 2NUEA 2RS6A 2V89A 2L33A 2L92A 1T4LB 2UUAE 4Q28A 2F4VE 4KHPE 4LFBE 3F6HA 4GEQB 4JV5E 4NXME 2YZTA 1YYKA 2L3JA 2DIXA 4X8WA 4DV1E 4DR3E 4M30A 3VYXA 2JOXA 4M2ZA 2UXBE 2LUPB 5AE3A 1RQ0A 1WHQA 2FV4B 1N36E 3OMLA 2B3TB 4X62E 2B9DA 1XMOE 2N3GA 3VK6A 1IBME 4I8OA 2L2NA 2VF1A 5A2QC 1I94E 4L8NA 3ADLA 4LF7E 4GKJE 4BMJA 2V86A 5LMUE 2E1MA 5IWAE 3IWDA 4JI4E 3OTOE 3C4BA 4LF8E 3HQ1A 2UU9E 4JYAE 2CPNA 4DV2E 4DR7E 2EZ6A 2JY9A 2UXDE 4DMIA 2M1SA 3P1XA 2LJHA 4JI1E 2VQEE 1HR0E 2YT4A 3AV0A 1X47A 4DV4E 2ODRC 3AUZA 3J7Yp 4DV6E 2LRSA 4BBYA 3LLHA 1DQ3A 4YHHE 2LUQA 3DF6A 1YYOA 2WZOA 4DV0E 2KOUA 2LMZA 1X49A 2KHXA 4YY3E 2NUGA 4DV7E 1WHNA 3HPSA 4OX9E 3K6QA 4X65E 5IT9C 4M0VA 4DV5E 4LU9A 2L2KB 4BC9A 2ZM6E 1T4NA 1XNQE 4F9BB 3H09A 1EKZA 2JWOA 3VYYA 4X64E 4AQYE 1N32E 4JI8E 2LBSB 2L8TA 2NUFA 1GQEA 4JI3E 4DUYE 3LMLA 1YZ9A 1STUA 1N33E 2V88A 1PKPA 4X66E 3HXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC5 A;  2MC6 A; 
#chains in the Genus database with same CATH topology
 5AAS A;  4F9C B;  3JTZ A;  3L00 A;  4IJD A;  3M99 B;  1J5E E;  2LV2 A;  4L5N C;  2EOQ A;  2K7I A;  4B3R E;  4HEI A;  5AC5 A;  1X6H A;  3VYX A;  2EOI A;  2I13 A;  2EMW A;  2RSI A;  4P78 A;  4WFT A;  3EPH A;  5LL6 R;  2M4I A;  2LE2 A;  2HHH E;  4M9V C;  4F6M A;  4BC7 A;  2DGC A;  2EN3 A;  3J7A G;  4OOG C;  2UXC E;  1LLM C;  2ENH A;  2YTQ A;  2EWL A;  2EOM A;  1UBD C;  4LFA E;  4DR4 E;  3C6M A;  2LTS A;  4X9J A;  3EPL A;  4B3T E;  2DB2 A;  2B7T A;  4BHB A;  4NHR A;  3JU0 A;  1ZR9 A;  5FLX C;  1A1I A;  4JI5 E;  4R8O A;  4KHP E;  2UUA E;  2L92 A;  1NEI A;  4GEQ B;  4O24 A;  4JV5 E;  2EMB A;  2ENC A;  2YZT A;  4MLV A;  2EMX A;  1EH8 A;  2EN7 A;  1WHQ A;  2EQ1 A;  4X62 E;  1IBM E;  3VK6 A;  2Q8U A;  2L2N A;  5TSE A;  4F2J C;  2GLI A;  4BMJ A;  2V86 A;  1T39 A;  3IWD A;  5A6A A;  2CPN A;  4DV2 E;  4DR7 E;  3EQ1 A;  4R2R A;  2M1S A;  2VQE E;  2EM9 A;  1T38 A;  3AUZ A;  2LRS A;  3KZY A;  1B69 A;  2EPX A;  1YYO A;  1RMD A;  2WZO A;  4DV0 E;  2KOU A;  4YY3 E;  2WBS A;  2YTN A;  4DV7 E;  2YU8 A;  1WHN A;  3K6Q A;  4X65 E;  1Z1B A;  5IT9 C;  4M0V A;  4DV5 E;  1WJP A;  4LU9 A;  1YUI A;  4BC9 A;  1AAY A;  2ZM6 E;  1T4N A;  2EPP A;  4F9B B;  4K0K E;  2GPI A;  2JWO A;  2LBS B;  2EMA A;  2EOS A;  1JK1 A;  3LML A;  1STU A;  2EMC A;  2YTP A;  4O4K A;  4X66 E;  2UXB E;  4ZYE A;  3HXL A;  2EQ3 A;  2UUB E;  1IMU A;  2EN2 A;  2JP9 A;  2VE7 C;  4ZYG A;  4ZYH A;  1X48 A;  1YUJ A;  4WPY A;  1HNW E;  2N8X A;  2J7J A;  4NZV A;  1N34 E;  3C6K A;  2HC5 A;  1QU6 A;  2LTR A;  4DR1 E;  2EPC A;  2JXP A;  2I9I A;  3THN A;  2YRH A;  2MC6 A;  4R2C A;  2E72 A;  2JOB A;  5A6J A;  2EOO A;  2FTX B;  2EOJ A;  4DR2 E;  1WXR A;  1YSA C;  2UUC E;  5KL2 A;  1KJK A;  2RPC A;  1L4S A;  3IWC A;  2L2M A;  3ZOQ B;  2YTJ A;  3J81 C;  1SR9 A;  5CFF E;  2EPK X;  2EM2 A;  5AE1 A;  4BCA A;  3UK3 C;  1X3C A;  2ELZ A;  1P47 A;  2NA2 A;  4TUI A;  1FKA E;  4WXC A;  2RTX A;  4WX9 A;  4DUZ E;  1PDA A;  3MSW A;  2YTE A;  4JI7 E;  3DJW A;  3IWB A;  4R03 A;  2NUE A;  4LFB E;  2RS6 A;  2L33 A;  2F4V E;  1YFH A;  1N3G A;  1ZAA C;  4NXM E;  1A1F A;  2D9H A;  4Q35 B;  4X8W A;  2L3J A;  4DV1 E;  4DR3 E;  1F2I G;  5AE3 A;  1A1K A;  2YRK A;  3VHT B;  2N3G A;  2EPA A;  2EPU A;  2EOH A;  4GKJ E;  2WBT A;  2EM6 A;  3BBG A;  2EM7 A;  4JYA E;  2EPM X;  2MKD A;  5AC4 A;  2EL5 A;  2EOX A;  2YRM A;  2EZ6 A;  2UXD E;  4ZYD A;  3ECR A;  3MHS C;  3P1X A;  1ZU1 A;  4JI1 E;  1HR0 E;  1X6E A;  2YT4 A;  4DV4 E;  2LO3 A;  4DV6 E;  4BBY A;  2EMF A;  1DQ3 A;  2LUQ A;  3DF6 A;  1X6F A;  4KWY A;  2L2K B;  3VYY A;  3BID A;  2NUF A;  4DUY E;  1BB8 A;  2ELY A;  1PKP A;  5ADZ A;  2EP3 A;  2M7Q A;  2R1F A;  3F6G A;  2EMY A;  1YPN A;  2EMI A;  2EOY A;  5A6K A;  5LMN E;  3RMP A;  2DMY A;  4GKK E;  2CTD A;  5A6B D;  2CSH A;  1TF3 A;  4DV3 E;  1MEY C;  1ZBQ A;  2V8Q B;  2YTI A;  2JPA A;  2EMH A;  4WSG A;  1KYQ A;  1FJG E;  4LF9 E;  1TF6 A;  1IBK E;  2YSO A;  2JR1 A;  2G7H A;  4LFC E;  2EN6 A;  2EN8 A;  3HPZ A;  2EMZ A;  5BR8 E;  2RS7 A;  2IHR 1;  2L3C A;  2YTG A;  3ADI A;  1J26 A;  4NXN E;  3ADJ A;  1EH6 A;  4P7D A;  2DRP A;  3T1H E;  4R2A A;  1UIL A;  2JYA A;  4DKK A;  1ZBT A;  3J80 C;  2F8B A;  3KWR A;  4F9A B;  1AH5 A;  4B3M E;  2MC5 A;  1HNX E;  4HTG A;  4N4R B;  5KL3 A;  2H36 X;  3FIG A;  2EJ4 A;  2LCE A;  4BHC A;  4DR5 E;  2EM3 A;  4LF4 E;  4LF5 E;  5DNY A;  2M9A A;  2YPN A;  2LJU A;  1IBL E;  1IQS A;  4DR6 E;  1GTK A;  4LTY A;  1A1G A;  1O0W A;  2GHF A;  3JAM C;  4F54 A;  1BBO A;  1PJS A;  5A6B A;  2A25 A;  2JVA A;  1SFE A;  2EOZ A;  2DSY A;  4IS1 C;  5IXM B;  2HGH A;  2EM0 A;  2EOE A;  3F6H A;  4R2S A;  1YYK A;  2DIX A;  4M2Z A;  2LUP B;  1N36 E;  1RQ0 A;  2B3T B;  1PJT A;  1XMO E;  2WCC 3;  4R2Q A;  4I8O A;  2VF1 A;  2EML A;  1I94 E;  4L8N A;  2MDG A;  4O5G A;  2LT7 A;  5IWA E;  3C4B A;  4LF8 E;  3HQ1 A;  2UU9 E;  2YTF A;  2EPN A;  2EM4 A;  3KZZ A;  4DMI A;  2LJH A;  2EM8 A;  3AV0 A;  4R2E A;  1X47 A;  2DMI A;  1IQO A;  3LLH A;  2BB8 A;  2DLK A;  4YHH E;  2LVH A;  2PRT A;  2EPR A;  2LMZ A;  3HPS A;  2EM5 A;  4MLQ A;  5LLQ A;  1BBG A;  1XNQ E;  1DGC A;  1N32 E;  4AQY E;  4JI8 E;  2BBG A;  2RQL A;  5A69 A;  1N33 E;  2YTO A;  1EH7 A;  1XNR E;  2RSM A;  1DI2 A;  2VQF E;  4WSP A;  2EN4 A;  4WXD A;  5AE2 A;  2V83 A;  2ODR D;  3ADG A;  4GZN C;  1HNZ E;  2K4V A;  1PJQ A;  2FGG A;  2YTD A;  2VRD A;  1T4O A;  2YWQ A;  1XMQ E;  1A1L A;  2B7V A;  4JI0 E;  4BS9 A;  4JI2 E;  4WYQ B;  2EMK A;  2EPZ A;  2MDR A;  2EPL X;  2V85 A;  4RHB B;  2L6M A;  4FK5 C;  3EPK A;  3C4T A;  1RC7 A;  5T6J A;  1YYW A;  1GZ6 A;  3THO B;  2EL6 A;  2EL4 A;  1MGT A;  1JK2 A;  4O43 A;  2EPO A;  2HJJ A;  1UHZ A;  3T1Y E;  3BF2 A;  2DLQ A;  4KZS A;  2EOR A;  2V87 A;  2N3H A;  2YSP A;  2KON A;  4B3S E;  4RH8 A;  4R2D A;  2E5L E;  4TUG A;  4JI6 E;  1X5W A;  5KL5 A;  3HTX A;  3BGH A;  2EN1 A;  4J8Z A;  4LF6 E;  1QNT A;  2V89 A;  1T4L B;  4Q28 A;  2EMG A;  3MHH C;  3QG5 C;  2WBU A;  4M30 A;  2JOX A;  2MKN A;  2FV4 B;  5KL6 A;  1NCS A;  3OML A;  2B9D A;  3TQM A;  5A2Q C;  3ADL A;  4LF7 E;  5LMU E;  2ADR A;  2E1M A;  4JI4 E;  5KL7 A;  3OTO E;  2JY9 A;  2EE8 A;  1G2D C;  4R2P A;  2ODR C;  3J7Y p;  1A1H A;  2CT1 A;  1UN6 B;  2NAB A;  2R76 A;  1X49 A;  2EQ0 A;  5KL4 A;  2KHX A;  2NUG A;  4F6N A;  4OX9 E;  2EOF A;  1TN9 A;  3EPJ A;  1WRJ A;  2YU5 A;  3H09 A;  1EKZ A;  1A1J A;  4X64 E;  5IV8 B;  1G2F C;  2L8T A;  1GQE A;  4JI3 E;  1YZ9 A;  2ENA A;  2V88 A;  5F3W A; 
#chains in the Genus database with same CATH homology
 2M7Q A;  5AAS A;  2UUB E;  1XNR E;  3F6G A;  3RMP A;  2RSM A;  4F9C B;  5LMN E;  1DI2 A;  2VQF E;  2DMY A;  4WSP A;  3JTZ A;  4GKK E;  5AE2 A;  2V83 A;  2VE7 C;  2ODR D;  3ADG A;  4DV3 E;  1X48 A;  1J5E E;  1HNZ E;  1ZBQ A;  4WPY A;  1HNW E;  2K4V A;  2FGG A;  2V8Q B;  4L5N C;  5ADZ A;  4B3R E;  1FJG E;  1T4O A;  1N34 E;  4LF9 E;  1QU6 A;  2LTR A;  4DR1 E;  1XMQ E;  1IBK E;  2JR1 A;  2B7V A;  2MC6 A;  4JI0 E;  2G7H A;  4BS9 A;  2L3C A;  4JI2 E;  3HPZ A;  4LFC E;  4WYQ B;  2RS7 A;  2IHR 1;  5BR8 E;  2JOB A;  3ADI A;  2MDR A;  1J26 A;  4P78 A;  2V85 A;  2FTX B;  3ADJ A;  4NXN E;  4P7D A;  4WFT A;  4DR2 E;  1WXR A;  2L6M A;  5LL6 R;  3T1H E;  2UUC E;  2M4I A;  1UIL A;  3C4T A;  2LE2 A;  4DKK A;  1ZBT A;  3J80 C;  1RC7 A;  3IWC A;  2L2M A;  5T6J A;  3ZOQ B;  2F8B A;  2HHH E;  3KWR A;  4F9A B;  3J81 C;  1YYW A;  1GZ6 A;  1SR9 A;  4B3M E;  2MC5 A;  4BC7 A;  5CFF E;  1HNX E;  3J7A G;  4OOG C;  1UHZ A;  5AE1 A;  2UXC E;  3T1Y E;  4BCA A;  2EWL A;  2H36 X;  3FIG A;  4KZS A;  2NA2 A;  4DR5 E;  4LF4 E;  4LFA E;  4LF5 E;  4DR4 E;  2V87 A;  4TUI A;  2LTS A;  5DNY A;  2N3H A;  1FKA E;  4B3S E;  2KON A;  2DB2 A;  2RTX A;  2B7T A;  4DUZ E;  1IBL E;  4B3T E;  4K0K E;  2E5L E;  4TUG A;  3JU0 A;  3MSW A;  4DR6 E;  4LTY A;  1O0W A;  5F3W A;  3JAM C;  4JI6 E;  4F54 A;  3HTX A;  5FLX C;  4JI7 E;  3DJW A;  2JVA A;  4JI5 E;  3IWB A;  4J8Z A;  4R03 A;  4LF6 E;  2DSY A;  4R8O A;  2NUE A;  2RS6 A;  2V89 A;  2L33 A;  2L92 A;  1T4L B;  2UUA E;  4Q28 A;  2F4V E;  4KHP E;  4LFB E;  3F6H A;  4GEQ B;  4JV5 E;  4NXM E;  2YZT A;  1YYK A;  2L3J A;  2DIX A;  4X8W A;  4DV1 E;  4DR3 E;  4M30 A;  3VYX A;  2JOX A;  4M2Z A;  2UXB E;  2LUP B;  5AE3 A;  1RQ0 A;  1WHQ A;  2FV4 B;  1N36 E;  3OML A;  2B3T B;  4X62 E;  2B9D A;  1XMO E;  2N3G A;  3VK6 A;  1IBM E;  4I8O A;  2L2N A;  2VF1 A;  5A2Q C;  1I94 E;  4L8N A;  3ADL A;  4LF7 E;  4GKJ E;  4BMJ A;  2V86 A;  5LMU E;  2E1M A;  5IWA E;  3IWD A;  4JI4 E;  3OTO E;  3C4B A;  4LF8 E;  3HQ1 A;  2UU9 E;  4JYA E;  2CPN A;  4DV2 E;  4DR7 E;  2EZ6 A;  2JY9 A;  2UXD E;  4DMI A;  2M1S A;  3P1X A;  2LJH A;  4JI1 E;  2VQE E;  1HR0 E;  2YT4 A;  3AV0 A;  1X47 A;  4DV4 E;  2ODR C;  3AUZ A;  3J7Y p;  4DV6 E;  2LRS A;  4BBY A;  3LLH A;  1DQ3 A;  4YHH E;  2LUQ A;  3DF6 A;  1YYO A;  2WZO A;  4DV0 E;  2KOU A;  2LMZ A;  1X49 A;  2KHX A;  4YY3 E;  2NUG A;  4DV7 E;  1WHN A;  3HPS A;  4OX9 E;  3K6Q A;  4X65 E;  5IT9 C;  4M0V A;  4DV5 E;  4LU9 A;  2L2K B;  4BC9 A;  2ZM6 E;  1T4N A;  1XNQ E;  4F9B B;  3H09 A;  1EKZ A;  2JWO A;  3VYY A;  4X64 E;  4AQY E;  1N32 E;  4JI8 E;  2LBS B;  2L8T A;  2NUF A;  1GQE A;  4JI3 E;  4DUY E;  3LML A;  1YZ9 A;  1STU A;  1N33 E;  2V88 A;  1PKP A;  4X66 E;  3HXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...