2MC6A

A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase inhibitor p7
publication title A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement.
pubmed doi rcsb
source organism Xanthomonas phage xp10
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.560 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mc6A00
2MC5A 2MC6A
chains in the Genus database with same CATH superfamily
2B7VA 2EM5A 3BF2A 4BHBA 3ADJA 4R8OA 2MDRA 5A6BA 2EN3A 2JOXA 4R2EA 1PJTA 1Z1BA 3F6HA 2EOQA 3IWBA 1STUA 1NEIA 2MC6A 5LMUE 5KL6A 5AASA 4DKKA 1J26A 5CFFE 4BC9A 2D9HA 1KYQA 2EN1A 2EMZA 1A1JA 2KONA 4WXCA 2E5LE 5IWAE 4L5NC 2EPRA 1YYWA 4I8OA 2PRTA 2EOXA 2RQLA 3THNA 4DV0E 1YUJA 2NUEA 2UXCE 1ZBQA 1X48A 4J8ZA 2N3HA 4R2CA 1T4NA 2M7QA 4GKKE 2DLQA 2EOJA 2R76A 4L8NA 2DMIA 2MC5A 2EM3A 2EQ1A 3EPHA 3K6QA 3VYXA 1X5WA 2N3GA 2WBUA 4DR3E 3RMPA 1G2DC 5AC5A 4DR6E 1A1LA 2GHFA 4KZSA 4X8WA 2YTOA 4LFAE 2V83A 2YRMA 2EN4A 2V85A 2EPMX 1L4SA 4GEQB 4OOGC 4F9BB 1GTKA 2EPKX 2UU9E 4NXNE 2KOUA 4K0KE 2Q8UA 2EOOA 1YUIA 1IBME 2LJHA 3MHSC 5LMNE 3L00A 2EORA 2N8XA 2CPNA 5IT9C 2EMAA 1BBOA 2J7JA 3FIGA 3AV0A 4IJDA 2LUQA 2F8BA 5DNYA 4KWYA 1TF3A 1HNXE 1PKPA 3BGHA 4JYAE 4LU9A 1NCSA 2E72A 4LTYA 3HQ1A 3ADIA 2YTFA 2VF1A 4NXME 4X64E 1HR0E 2V86A 2UXDE 2KHXA 2LTRA 1F2IG 2YRKA 2VE7C 3HXLA 4M30A 3C4TA 4YHHE 2EOIA 4O5GA 2MDGA 4MLVA 2RS7A 1A1FA 2EM2A 1T38A 2EP3A 4BCAA 2R1FA 1A1HA 1X6EA 2LMZA 1IMUA 2JWOA 2JVAA 1SR9A 3QG5C 4BC7A 2EMCA 4JI8E 1I94E 2ELYA 3MSWA 1WXRA 2M1SA 4LF4E 3F6GA 2EOHA 2A25A 3EPJA 2B7TA 2L6MA 4M9VC 1J5EE 1A1KA 1MEYC 2LUPB 2EM8A 3VK6A 1PJQA 1XMOE 3IWDA 3EPKA 4DV4E 1GZ6A 2ODRC 4JI4E 2EN6A 4JI1E 1QNTA 3BIDA 3IWCA 2DRPA 5AE1A 3H09A 2V8QB 2BBGA 4B3TE 5AE3A 2L2NA 2WBTA 4R2AA 4JI0E 1XNQE 1WJPA 1BB8A 3J7AG 1KJKA 5KL2A 2G7HA 3EPLA 1DGCA 2L3CA 3ZOQB 4LFBE 3TQMA 2DB2A 4F54A 1PJSA 5A6AA 2ENAA 1RQ0A 2RTXA 4Q28A 2LT7A 4DUZE 2NUGA 2L92A 1XNRE 4FK5C 3ADGA 4R2PA 4X62E 2YU8A 3ECRA 2VQEE 2RSMA 3JAMC 2WZOA 1T39A 4WFTA 3AUZA 5BR8E 2WCC3 1YYOA 4R2QA 5KL5A 3ADLA 2LJUA 1JK2A 4LF6E 2LTSA 4JI3E 4TUGA 2EPOA 4NHRA 1N36E 5A2QC 2ENHA 1PDAA 2EMKA 1O0WA 1BBGA 2L8TA 4O43A 3C6MA 4IS1C 4JI2E 1X49A 2FV4B 2EE8A 4WSGA 2EM9A 4NZVA 3VYYA 1TN9A 1UHZA 3MHHC 5AC4A 3UK3C 2EMFA 4AQYE 2EOFA 1YSAC 2RS6A 2EJ4A 4DV1E 5IV8B 2BB8A 4O24A 4X9JA 2RSIA 1YZ9A 2L2KB 5A69A 3EQ1A 2IHR1 2L33A 4HEIA 2EL5A 2LO3A 2M9AA 2EL6A 5A6KA 4JI5E 4M2ZA 3M99B 1N34E 4WXDA 1HNZE 1X6HA 3KZYA 4O4KA 4BS9A 2EOMA 4DR4E 2ADRA 5T6JA 4DV2E 2YRHA 1WHQA 2EM0A 3HTXA 2EMBA 1EH8A 4F9CB 5AE2A 4BMJA 2DIXA 2EM4A 2YU5A 1FKAE 1LLMC 3J7Yp 4WYQB 2LBSB 4B3RE 4JV5E 1JK1A 4M0VA 2DGCA 5IXMB 2EPCA 1UN6B 2EMYA 1HNWE 4N4RB 2FGGA 1N33E 1YPNA 1YFHA 2EOSA 2K4VA 1XMQE 4DR2E 2ELZA 4DV5E 3HPSA 2YPNA 3C4BA 1EKZA 1P47A 2JYAA 1RC7A 3KWRA 4B3ME 4X65E 5A6JA 2YTPA 1IBLE 1UILA 5KL3A 4LFCE 4ZYGA 2JR1A 4DR7E 4X66E 2K7IA 3JU0A 1IQOA 2EMHA 3J80C 1ZR9A 2JP9A 2L2MA 2EPNA 1ZBTA 5TSEA 4R2DA 5ADZA 4DR1E 2H36X 2CTDA 2E1MA 2EPUA 4KHPE 1GQEA 4RHBB 1WRJA 1AAYA 2MKNA 4WSPA 2V88A 4P7DA 5F3WA 1TF6A 1IBKE 2NA2A 1ZAAC 2YTGA 2F4VE 2EZ6A 2EPPA 3OTOE 3DF6A 2HJJA 3LMLA 2EOYA 2ENCA 3JTZA 1N3GA 2FTXB 4F2JC 4YY3E 4DR5E 2ZM6E 4JI7E 4P78A 4TUIA 2L3JA 4GZNC 3VHTB 4ZYEA 3OMLA 2DSYA 4LF9E 2GPIA 4RH8A 4OX9E 2GLIA 4F9AB 2EMGA 2DMYA 2EMXA 2V87A 4B3SE 2JY9A 2UXBE 4BHCA 2CT1A 1N32E 1EH7A 2JXPA 1AH5A 2JPAA 4WPYA 2EPXA 2NABA 4DMIA 2MKDA 1G2FC 5A6BD 2B3TB 2EM6A 2EQ3A 4DV7E 4WX9A 4HTGA 2EM7A 4F6NA 1IQSA 2EPZA 4DV3E 2HHHE 4JI6E 2CSHA 2HGHA 2EMWA 1X3CA 2YSPA 2YTDA 2EN8A 4ZYDA 2LVHA 4BBYA 2YTEA 3C6KA 4GKJE 2I13A 4LF5E 2HC5A 4DUYE 2EOEA 1B69A 4R2RA 2YT4A 1ZU1A 2YTNA 1A1IA 1UBDC 3THOB 2WBSA 3HPZA 5KL4A 2NUFA 2LV2A 2VQFE 2B9DA 1QU6A 4MLQA 5LLQA 4Q35B 2LRSA 2V89A 1FJGE 4LF8E 2EMIA 1A1GA 4F6MA 4R2SA 2EOZA 2LCEA 2M4IA 1SFEA 2YTJA 3T1HE 2EL4A 3LLHA 2YTIA 1DQ3A 2JOBA 1RMDA 5KL7A 3BBGA 5LL6R 2UUBE 4LF7E 2YWQA 2YTQA 2YSOA 4R03A 2EMLA 2I9IA 3DJWA 2EPLX 2ODRD 2EN7A 1X47A 2UUCE 1X6FA 1DI2A 2EWLA 4DV6E 2VRDA 2UUAE 3T1YE 3P1XA 1YYKA 3J81C 1T4LB 1WHNA 4ZYHA 1EH6A 2EN2A 2DLKA 1T4OA 2YZTA 2EQ0A 2LE2A 3KZZA 2RPCA 1MGTA 5FLXC 2EPAA
chains in the Genus database with same CATH topology
2B7VA 4BC7A 1N34E 4JI8E 1I94E 4B3SE 2JY9A 2UXBE 3MSWA 1WXRA 2M1SA 4LF4E 1N32E 3ADJA 4R8OA 2MDRA 3F6GA 4WPYA 2B7TA 2JOXA 2L6MA 1HNZE 1J5EE 3F6HA 4DMIA 4BS9A 3IWBA 1STUA 2MC6A 2LUPB 5LMUE 4DR7E 4DR4E 3VK6A 5T6JA 1XMOE 5AASA 4DKKA 2B3TB 3IWDA 4DV2E 1WHQA 4DV7E 3HTXA 1J26A 5CFFE 4BC9A 4DV4E 1GZ6A 2ODRC 4JI4E 4F9CB 5AE2A 4BMJA 4JI1E 3IWCA 2KONA 2DIXA 5AE1A 1FKAE 2E5LE 4DV3E 5IWAE 3J7Yp 4L5NC 3H09A 4WYQB 2HHHE 4JI6E 2LBSB 4B3RE 4JV5E 2V8QB 4M0VA 4B3TE 1YYWA 4I8OA 5AE3A 2L2NA 1HNWE 4DV0E 2FGGA 4JI0E 1XNQE 2NUEA 1N33E 2UXCE 3J7AG 1ZBQA 5FLXC 4BBYA 2K4VA 1XMQE 4DR2E 4GKJE 2G7HA 4DV5E 1X48A 4J8ZA 2N3HA 2L3CA 1T4NA 3ZOQB 4LF5E 4DUYE 4LFBE 2M7QA 4GKKE 3HPSA 2DB2A 3C4BA 4F54A 1EKZA 4L8NA 1RC7A 3KWRA 1RQ0A 2RTXA 2YT4A 4Q28A 4X65E 2MC5A 4DUZE 2NUGA 2L92A 1IBLE 4DR6E 3K6QA 3VYXA 2N3GA 1XNRE 3ADGA 1UILA 4DR3E 3RMPA 4X62E 4LFCE 2JR1A 3HPZA 2NUFA 2VQEE 4X66E 2RSMA 2VQFE 3JU0A 2B9DA 4KZSA 3JAMC 2WZOA 4X8WA 1QU6A 4WFTA 3AUZA 5BR8E 3J80C 1YYOA 4LFAE 2L2MA 1ZBTA 2V83A 3ADLA 2LRSA 2V85A 2V89A 1FJGE 4LF8E 4GEQB 2LTSA 4OOGC 4LF6E 4F9BB 5ADZA 4TUGA 2UU9E 4DR1E 4B3ME 4JI3E 2H36X 4NXNE 2KOUA 4K0KE 2M4IA 2E1MA 1N36E 1IBME 4KHPE 3T1HE 2LJHA 1GQEA 3LLHA 5LMNE 4WSPA 5A2QC 1DQ3A 2CPNA 2JOBA 5IT9C 2V88A 3FIGA 4P7DA 1O0WA 3AV0A 5F3WA 2LUQA 5LL6R 2F8BA 5DNYA 2UUBE 4LF7E 2L8TA 1IBKE 1HNXE 1PKPA 2NA2A 4R03A 4JI2E 1X49A 4LU9A 2F4VE 2FV4B 3DJWA 4JYAE 2ODRD 2EZ6A 1X47A 4LTYA 3DF6A 3HQ1A 3OTOE 3VYYA 3LMLA 2UUCE 3ADIA 2VF1A 4NXME 1DI2A 4X64E 2EWLA 4DV6E 1UHZA 3JTZA 2FTXB 1HR0E 2UUAE 2V86A 2UXDE 2KHXA 4YY3E 4DR5E 2LTRA 2ZM6E 2VE7C 3HXLA 4M30A 4AQYE 3C4TA 4YHHE 3P1XA 3T1YE 4JI7E 4P78A 3J81C 4TUIA 1YYKA 2L3JA 2RS6A 4DV1E 1T4LB 1WHNA 3OMLA 2RS7A 2DSYA 4LF9E 4BCAA 1YZ9A 2L2KB 4OX9E 1T4OA 2YZTA 2IHR1 2L33A 4F9AB 2DMYA 2LE2A 2LMZA 2JWOA 4JI5E 2V87A 2JVAA 4M2ZA 1SR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC5 A;  2MC6 A; 
#chains in the Genus database with same CATH topology
 2B7V A;  2EM5 A;  3BF2 A;  4BHB A;  3ADJ A;  4R8O A;  2MDR A;  5A6B A;  2EN3 A;  2JOX A;  4R2E A;  1PJT A;  1Z1B A;  3F6H A;  2EOQ A;  3IWB A;  1STU A;  1NEI A;  2MC6 A;  5LMU E;  5KL6 A;  5AAS A;  4DKK A;  1J26 A;  5CFF E;  4BC9 A;  2D9H A;  1KYQ A;  2EN1 A;  2EMZ A;  1A1J A;  2KON A;  4WXC A;  2E5L E;  5IWA E;  4L5N C;  2EPR A;  1YYW A;  4I8O A;  2PRT A;  2EOX A;  2RQL A;  3THN A;  4DV0 E;  1YUJ A;  2NUE A;  2UXC E;  1ZBQ A;  1X48 A;  4J8Z A;  2N3H A;  4R2C A;  1T4N A;  2M7Q A;  4GKK E;  2DLQ A;  2EOJ A;  2R76 A;  4L8N A;  2DMI A;  2MC5 A;  2EM3 A;  2EQ1 A;  3EPH A;  3K6Q A;  3VYX A;  1X5W A;  2N3G A;  2WBU A;  4DR3 E;  3RMP A;  1G2D C;  5AC5 A;  4DR6 E;  1A1L A;  2GHF A;  4KZS A;  4X8W A;  2YTO A;  4LFA E;  2V83 A;  2YRM A;  2EN4 A;  2V85 A;  2EPM X;  1L4S A;  4GEQ B;  4OOG C;  4F9B B;  1GTK A;  2EPK X;  2UU9 E;  4NXN E;  2KOU A;  4K0K E;  2Q8U A;  2EOO A;  1YUI A;  1IBM E;  2LJH A;  3MHS C;  5LMN E;  3L00 A;  2EOR A;  2N8X A;  2CPN A;  5IT9 C;  2EMA A;  1BBO A;  2J7J A;  3FIG A;  3AV0 A;  4IJD A;  2LUQ A;  2F8B A;  5DNY A;  4KWY A;  1TF3 A;  1HNX E;  1PKP A;  3BGH A;  4JYA E;  4LU9 A;  1NCS A;  2E72 A;  4LTY A;  3HQ1 A;  3ADI A;  2YTF A;  2VF1 A;  4NXM E;  4X64 E;  1HR0 E;  2V86 A;  2UXD E;  2KHX A;  2LTR A;  1F2I G;  2YRK A;  2VE7 C;  3HXL A;  4M30 A;  3C4T A;  4YHH E;  2EOI A;  4O5G A;  2MDG A;  4MLV A;  2RS7 A;  1A1F A;  2EM2 A;  1T38 A;  2EP3 A;  4BCA A;  2R1F A;  1A1H A;  1X6E A;  2LMZ A;  1IMU A;  2JWO A;  2JVA A;  1SR9 A;  3QG5 C;  4BC7 A;  2EMC A;  4JI8 E;  1I94 E;  2ELY A;  3MSW A;  1WXR A;  2M1S A;  4LF4 E;  3F6G A;  2EOH A;  2A25 A;  3EPJ A;  2B7T A;  2L6M A;  4M9V C;  1J5E E;  1A1K A;  1MEY C;  2LUP B;  2EM8 A;  3VK6 A;  1PJQ A;  1XMO E;  3IWD A;  3EPK A;  4DV4 E;  1GZ6 A;  2ODR C;  4JI4 E;  2EN6 A;  4JI1 E;  1QNT A;  3BID A;  3IWC A;  2DRP A;  5AE1 A;  3H09 A;  2V8Q B;  2BBG A;  4B3T E;  5AE3 A;  2L2N A;  2WBT A;  4R2A A;  4JI0 E;  1XNQ E;  1WJP A;  1BB8 A;  3J7A G;  1KJK A;  5KL2 A;  2G7H A;  3EPL A;  1DGC A;  2L3C A;  3ZOQ B;  4LFB E;  3TQM A;  2DB2 A;  4F54 A;  1PJS A;  5A6A A;  2ENA A;  1RQ0 A;  2RTX A;  4Q28 A;  2LT7 A;  4DUZ E;  2NUG A;  2L92 A;  1XNR E;  4FK5 C;  3ADG A;  4R2P A;  4X62 E;  2YU8 A;  3ECR A;  2VQE E;  2RSM A;  3JAM C;  2WZO A;  1T39 A;  4WFT A;  3AUZ A;  5BR8 E;  2WCC 3;  1YYO A;  4R2Q A;  5KL5 A;  3ADL A;  2LJU A;  1JK2 A;  4LF6 E;  2LTS A;  4JI3 E;  4TUG A;  2EPO A;  4NHR A;  1N36 E;  5A2Q C;  2ENH A;  1PDA A;  2EMK A;  1O0W A;  1BBG A;  2L8T A;  4O43 A;  3C6M A;  4IS1 C;  4JI2 E;  1X49 A;  2FV4 B;  2EE8 A;  4WSG A;  2EM9 A;  4NZV A;  3VYY A;  1TN9 A;  1UHZ A;  3MHH C;  5AC4 A;  3UK3 C;  2EMF A;  4AQY E;  2EOF A;  1YSA C;  2RS6 A;  2EJ4 A;  4DV1 E;  5IV8 B;  2BB8 A;  4O24 A;  4X9J A;  2RSI A;  1YZ9 A;  2L2K B;  5A69 A;  3EQ1 A;  2IHR 1;  2L33 A;  4HEI A;  2EL5 A;  2LO3 A;  2M9A A;  2EL6 A;  5A6K A;  4JI5 E;  4M2Z A;  3M99 B;  1N34 E;  4WXD A;  1HNZ E;  1X6H A;  3KZY A;  4O4K A;  4BS9 A;  2EOM A;  4DR4 E;  2ADR A;  5T6J A;  4DV2 E;  2YRH A;  1WHQ A;  2EM0 A;  3HTX A;  2EMB A;  1EH8 A;  4F9C B;  5AE2 A;  4BMJ A;  2DIX A;  2EM4 A;  2YU5 A;  1FKA E;  1LLM C;  3J7Y p;  4WYQ B;  2LBS B;  4B3R E;  4JV5 E;  1JK1 A;  4M0V A;  2DGC A;  5IXM B;  2EPC A;  1UN6 B;  2EMY A;  1HNW E;  4N4R B;  2FGG A;  1N33 E;  1YPN A;  1YFH A;  2EOS A;  2K4V A;  1XMQ E;  4DR2 E;  2ELZ A;  4DV5 E;  3HPS A;  2YPN A;  3C4B A;  1EKZ A;  1P47 A;  2JYA A;  1RC7 A;  3KWR A;  4B3M E;  4X65 E;  5A6J A;  2YTP A;  1IBL E;  1UIL A;  5KL3 A;  4LFC E;  4ZYG A;  2JR1 A;  4DR7 E;  4X66 E;  2K7I A;  3JU0 A;  1IQO A;  2EMH A;  3J80 C;  1ZR9 A;  2JP9 A;  2L2M A;  2EPN A;  1ZBT A;  5TSE A;  4R2D A;  5ADZ A;  4DR1 E;  2H36 X;  2CTD A;  2E1M A;  2EPU A;  4KHP E;  1GQE A;  4RHB B;  1WRJ A;  1AAY A;  2MKN A;  4WSP A;  2V88 A;  4P7D A;  5F3W A;  1TF6 A;  1IBK E;  2NA2 A;  1ZAA C;  2YTG A;  2F4V E;  2EZ6 A;  2EPP A;  3OTO E;  3DF6 A;  2HJJ A;  3LML A;  2EOY A;  2ENC A;  3JTZ A;  1N3G A;  2FTX B;  4F2J C;  4YY3 E;  4DR5 E;  2ZM6 E;  4JI7 E;  4P78 A;  4TUI A;  2L3J A;  4GZN C;  3VHT B;  4ZYE A;  3OML A;  2DSY A;  4LF9 E;  2GPI A;  4RH8 A;  4OX9 E;  2GLI A;  4F9A B;  2EMG A;  2DMY A;  2EMX A;  2V87 A;  4B3S E;  2JY9 A;  2UXB E;  4BHC A;  2CT1 A;  1N32 E;  1EH7 A;  2JXP A;  1AH5 A;  2JPA A;  4WPY A;  2EPX A;  2NAB A;  4DMI A;  2MKD A;  1G2F C;  5A6B D;  2B3T B;  2EM6 A;  2EQ3 A;  4DV7 E;  4WX9 A;  4HTG A;  2EM7 A;  4F6N A;  1IQS A;  2EPZ A;  4DV3 E;  2HHH E;  4JI6 E;  2CSH A;  2HGH A;  2EMW A;  1X3C A;  2YSP A;  2YTD A;  2EN8 A;  4ZYD A;  2LVH A;  4BBY A;  2YTE A;  3C6K A;  4GKJ E;  2I13 A;  4LF5 E;  2HC5 A;  4DUY E;  2EOE A;  1B69 A;  4R2R A;  2YT4 A;  1ZU1 A;  2YTN A;  1A1I A;  1UBD C;  3THO B;  2WBS A;  3HPZ A;  5KL4 A;  2NUF A;  2LV2 A;  2VQF E;  2B9D A;  1QU6 A;  4MLQ A;  5LLQ A;  4Q35 B;  2LRS A;  2V89 A;  1FJG E;  4LF8 E;  2EMI A;  1A1G A;  4F6M A;  4R2S A;  2EOZ A;  2LCE A;  2M4I A;  1SFE A;  2YTJ A;  3T1H E;  2EL4 A;  3LLH A;  2YTI A;  1DQ3 A;  2JOB A;  1RMD A;  5KL7 A;  3BBG A;  5LL6 R;  2UUB E;  4LF7 E;  2YWQ A;  2YTQ A;  2YSO A;  4R03 A;  2EML A;  2I9I A;  3DJW A;  2EPL X;  2ODR D;  2EN7 A;  1X47 A;  2UUC E;  1X6F A;  1DI2 A;  2EWL A;  4DV6 E;  2VRD A;  2UUA E;  3T1Y E;  3P1X A;  1YYK A;  3J81 C;  1T4L B;  1WHN A;  4ZYH A;  1EH6 A;  2EN2 A;  2DLK A;  1T4O A;  2YZT A;  2EQ0 A;  2LE2 A;  3KZZ A;  2RPC A;  1MGT A;  5FLX C;  2EPA A; 
#chains in the Genus database with same CATH homology
 2B7V A;  4BC7 A;  1N34 E;  4JI8 E;  1I94 E;  4B3S E;  2JY9 A;  2UXB E;  3MSW A;  1WXR A;  2M1S A;  4LF4 E;  1N32 E;  3ADJ A;  4R8O A;  2MDR A;  3F6G A;  4WPY A;  2B7T A;  2JOX A;  2L6M A;  1HNZ E;  1J5E E;  3F6H A;  4DMI A;  4BS9 A;  3IWB A;  1STU A;  2MC6 A;  2LUP B;  5LMU E;  4DR7 E;  4DR4 E;  3VK6 A;  5T6J A;  1XMO E;  5AAS A;  4DKK A;  2B3T B;  3IWD A;  4DV2 E;  1WHQ A;  4DV7 E;  3HTX A;  1J26 A;  5CFF E;  4BC9 A;  4DV4 E;  1GZ6 A;  2ODR C;  4JI4 E;  4F9C B;  5AE2 A;  4BMJ A;  4JI1 E;  3IWC A;  2KON A;  2DIX A;  5AE1 A;  1FKA E;  2E5L E;  4DV3 E;  5IWA E;  3J7Y p;  4L5N C;  3H09 A;  4WYQ B;  2HHH E;  4JI6 E;  2LBS B;  4B3R E;  4JV5 E;  2V8Q B;  4M0V A;  4B3T E;  1YYW A;  4I8O A;  5AE3 A;  2L2N A;  1HNW E;  4DV0 E;  2FGG A;  4JI0 E;  1XNQ E;  2NUE A;  1N33 E;  2UXC E;  3J7A G;  1ZBQ A;  5FLX C;  4BBY A;  2K4V A;  1XMQ E;  4DR2 E;  4GKJ E;  2G7H A;  4DV5 E;  1X48 A;  4J8Z A;  2N3H A;  2L3C A;  1T4N A;  3ZOQ B;  4LF5 E;  4DUY E;  4LFB E;  2M7Q A;  4GKK E;  3HPS A;  2DB2 A;  3C4B A;  4F54 A;  1EKZ A;  4L8N A;  1RC7 A;  3KWR A;  1RQ0 A;  2RTX A;  2YT4 A;  4Q28 A;  4X65 E;  2MC5 A;  4DUZ E;  2NUG A;  2L92 A;  1IBL E;  4DR6 E;  3K6Q A;  3VYX A;  2N3G A;  1XNR E;  3ADG A;  1UIL A;  4DR3 E;  3RMP A;  4X62 E;  4LFC E;  2JR1 A;  3HPZ A;  2NUF A;  2VQE E;  4X66 E;  2RSM A;  2VQF E;  3JU0 A;  2B9D A;  4KZS A;  3JAM C;  2WZO A;  4X8W A;  1QU6 A;  4WFT A;  3AUZ A;  5BR8 E;  3J80 C;  1YYO A;  4LFA E;  2L2M A;  1ZBT A;  2V83 A;  3ADL A;  2LRS A;  2V85 A;  2V89 A;  1FJG E;  4LF8 E;  4GEQ B;  2LTS A;  4OOG C;  4LF6 E;  4F9B B;  5ADZ A;  4TUG A;  2UU9 E;  4DR1 E;  4B3M E;  4JI3 E;  2H36 X;  4NXN E;  2KOU A;  4K0K E;  2M4I A;  2E1M A;  1N36 E;  1IBM E;  4KHP E;  3T1H E;  2LJH A;  1GQE A;  3LLH A;  5LMN E;  4WSP A;  5A2Q C;  1DQ3 A;  2CPN A;  2JOB A;  5IT9 C;  2V88 A;  3FIG A;  4P7D A;  1O0W A;  3AV0 A;  5F3W A;  2LUQ A;  5LL6 R;  2F8B A;  5DNY A;  2UUB E;  4LF7 E;  2L8T A;  1IBK E;  1HNX E;  1PKP A;  2NA2 A;  4R03 A;  4JI2 E;  1X49 A;  4LU9 A;  2F4V E;  2FV4 B;  3DJW A;  4JYA E;  2ODR D;  2EZ6 A;  1X47 A;  4LTY A;  3DF6 A;  3HQ1 A;  3OTO E;  3VYY A;  3LML A;  2UUC E;  3ADI A;  2VF1 A;  4NXM E;  1DI2 A;  4X64 E;  2EWL A;  4DV6 E;  1UHZ A;  3JTZ A;  2FTX B;  1HR0 E;  2UUA E;  2V86 A;  2UXD E;  2KHX A;  4YY3 E;  4DR5 E;  2LTR A;  2ZM6 E;  2VE7 C;  3HXL A;  4M30 A;  4AQY E;  3C4T A;  4YHH E;  3P1X A;  3T1Y E;  4JI7 E;  4P78 A;  3J81 C;  4TUI A;  1YYK A;  2L3J A;  2RS6 A;  4DV1 E;  1T4L B;  1WHN A;  3OML A;  2RS7 A;  2DSY A;  4LF9 E;  4BCA A;  1YZ9 A;  2L2K B;  4OX9 E;  1T4O A;  2YZT A;  2IHR 1;  2L33 A;  4F9A B;  2DMY A;  2LE2 A;  2LMZ A;  2JWO A;  4JI5 E;  2V87 A;  2JVA A;  4M2Z A;  1SR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...