2MC6A

A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase inhibitor p7
publication title A bacteriophage transcription regulator inhibits bacterial transcription initiation by sigma-factor displacement.
pubmed doi rcsb
source organism Xanthomonas phage xp10
molecule tags Transcription
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.560 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mc6A00
2MC6A 2MC5A
chains in the Genus database with same CATH superfamily
2BBGA 4NXME 1NEIA 2EE8A 4DV1E 2L2KB 4J8ZA 3HQ1A 2RS7A 5AE3A 2ELYA 5CFFE 2LJHA 4LF6E 1KYQA 3T1YE 2FTXB 2Q8UA 4MLVA 2EM6A 2HC5A 1YFHA 3C4BA 2J7JA 1RMDA 2B3TB 4YHHE 1JK2A 2GHFA 2PRTA 1XNQE 5IT9C 1UBDC 3ADLA 4MLQA 1TF3A 5A69A 3HTXA 4B3TE 4BHCA 4ZYEA 4LF7E 2EM0A 2EPOA 1RC7A 3LLHA 4M30A 2EPLX 2R1FA 2EMHA 2L8TA 1EKZA 5IWAE 3FIGA 1ZAAC 2YWQA 3L00A 4DV5E 2UUCE 2D9HA 3BF2A 2MKDA 3JU0A 4KWYA 3QG5C 2VQFE 4L8NA 4R2EA 3IWDA 3ADIA 2N3GA 4M9VC 2ENAA 1QU6A 1MGTA 4O4KA 1PJTA 2NUFA 4F9BB 2EPNA 4Q35B 2JOXA 1JK1A 4JI1E 4N4RB 1PDAA 2YTGA 2WBSA 2ODRC 4JI3E 1T4LB 2EQ1A 4LF9E 1SFEA 2EOFA 2YSPA 2DIXA 4P7DA 2EPMX 2H36X 4F6MA 2EMYA 4L5NC 2EM3A 4WXCA 3J7AG 4AQYE 2YTFA 3DJWA 4DR2E 2FGGA 1PJQA 2I13A 1XMOE 2LRSA 4O5GA 5T6JA 1T4NA 4B3RE 2V86A 2RQLA 2ODRD 3VK6A 4WYQB 4DR7E 1WHQA 2K7IA 1DQ3A 1ZBTA 4BS9A 4X64E 2EOMA 1FJGE 5AASA 3H09A 2A25A 3IWCA 3EPHA 2EL4A 2EOXA 5IXMB 4B3SE 4LFCE 1A1KA 2YTJA 5A6BA 2EPXA 2JOBA 2LJUA 3AUZA 2EMZA 3UK3C 1A1FA 1F2IG 2MDGA 4R2PA 1HNZE 1GQEA 4HTGA 4BHBA 1N34E 3TQMA 2JWOA 4JYAE 1HNWE 2EMGA 2EMKA 2B7VA 2R76A 4LU9A 2ENCA 2EP3A 5IV8B 5FLXC 1AAYA 2EZ6A 1DI2A 2V87A 1YUJA 2RPCA 1GTKA 2M4IA 5LMNE 2WBUA 4ZYHA 4ZYGA 2L6MA 2EL5A 1WXRA 4R2AA 5AE2A 1YUIA 3F6HA 2V83A 2DB2A 4B3ME 1IBLE 2EPZA 2VF1A 2EOZA 2N8XA 2NUGA 5LL6R 3K6QA 3VYYA 1YPNA 3C6KA 2HHHE 3LMLA 1Z1BA 2EL6A 1A1LA 1STUA 5A6JA 2EM4A 4DR3E 3C6MA 3J7Yp 2K4VA 3MSWA 5AE1A 2EPPA 5KL6A 2DSYA 2VRDA 2EQ3A 3EPLA 2MKNA 1DGCA 2UUAE 2JR1A 4WPYA 1UN6B 2N3HA 2BB8A 2V89A 2EN8A 2EQ0A 2EMIA 1YZ9A 4OOGC 2DLQA 2EM8A 2EPKX 2MC5A 4DV4E 2EPCA 1ZBQA 2LMZA 1NCSA 2UUBE 2VQEE 2V8QB 2YRMA 5KL5A 2LE2A 4NXNE 2YRKA 2JXPA 2ZM6E 4LF4E 1FKAE 5LLQA 2JY9A 5TSEA 2UXBE 3MHSC 2EOYA 1BBOA 4K0KE 1X6FA 3BGHA 1X6HA 3T1HE 2EOQA 2GPIA 1N36E 2KONA 2LCEA 5A6AA 1YSAC 2M7QA 2EOHA 3HPSA 4R2DA 4O24A 2EORA 2RSMA 2V88A 3P1XA 4JI2E 4X62E 1IQOA 4I8OA 2YTQA 5LMUE 3F6GA 2LTRA 3BBGA 1G2FC 3C4TA 3VYXA 4X9JA 4R2CA 2E1MA 5A6KA 1B69A 5A6BD 2EPUA 2EMFA 3IWBA 1N33E 5KL4A 2LTSA 4LF8E 2JYAA 3AV0A 1IBME 2EMXA 4WX9A 5ADZA 2HGHA 2EN4A 4R03A 4RH8A 4BC7A 3KZYA 1KJKA 4BC9A 1IQSA 2ADRA 4DR4E 5KL2A 1EH7A 4KZSA 4KHPE 2MDRA 2I9IA 3OMLA 4Q28A 1PJSA 4WSGA 4WSPA 1TF6A 4DV7E 1TN9A 2E5LE 2YRHA 4DMIA 2CT1A 3KZZA 2EPAA 2CSHA 1A1JA 4F6NA 4GKJE 2KHXA 2L3CA 2EMBA 4YY3E 1A1IA 2KOUA 3ADJA 2JP9A 3THNA 4JI4E 2EOIA 4R2SA 4F2JC 3J80C 4LFBE 4LF5E 5AC4A 4DUZE 4DV6E 3JAMC 5AC5A 2EPRA 2EOJA 4DUYE 3J81C 4JV5E 2M9AA 1EH8A 3OTOE 2YU5A 2VE7C 1X47A 2WCC3 2YTIA 2FV4B 4DR1E 2YU8A 1G2DC 1RQ0A 4M2ZA 2EMAA 1I94E 4GEQB 2UU9E 4DV0E 2YZTA 2EM9A 4NHRA 4WXDA 2JPAA 4JI8E 4ZYDA 2DRPA 4LFAE 2E72A 1T39A 4WFTA 2HJJA 3EPJA 2EN7A 1ZU1A 4F9CB 5F3WA 4RHBB 1O0WA 2JVAA 2YTOA 2NUEA 2EJ4A 4IJDA 5A2QC 5KL3A 4TUIA 1N32E 2ENHA 2EOEA 2YT4A 2MC6A 3THOB 2IHR1 1J26A 4DKKA 1EH6A 4DR5E 1BB8A 2F4VE 2LUQA 4OX9E 2EN2A 2YTDA 2NA2A 2G7HA 2EN1A 2EMCA 2ELZA 1YYKA 2B7TA 5BR8E 4DR6E 2L2MA 2B9DA 2L2NA 4NZVA 1LLMC 1WHNA 1J5EE 2CTDA 4JI5E 1N3GA 1WRJA 1HNXE 3VHTB 4F9AB 2CPNA 2EMWA 4DV2E 2EOSA 4JI6E 2LUPB 3HXLA 4IS1C 2UXDE 2WZOA 3M99B 1X49A 4HEIA 2L92A 4DV3E 4GKKE 1XNRE 3DF6A 4BCAA 2YPNA 4GZNC 2L33A 1X5WA 2DGCA 2EOOA 3ECRA 4R2RA 4X8WA 1X3CA 2GLIA 1A1GA 1AH5A 2LT7A 1GZ6A 1HR0E 4P78A 1BBGA 2LVHA 1X48A 2UXCE 1PKPA 4BBYA 1IBKE 2YTPA 2YTNA 2EM7A 2YSOA 4JI0E 1QNTA 2LO3A 3EPKA 1P47A 4BMJA 1YYWA 2EM5A 2EWLA 2RSIA 1YYOA 1ZR9A 1UHZA 2RS6A 1X6EA 2V85A 4X65E 2LV2A 4FK5C 1A1HA 1XMQE 2F8BA 1UILA 1L4SA 2EN3A 2EMLA 3RMPA 1T4OA 4R8OA 3JTZA 3MHHC 3ZOQB 4R2QA 4M0VA 1WJPA 2DMIA 4JI7E 4F54A 5KL7A 5DNYA 4O43A 3ADGA 1T38A 2DLKA 2DMYA 3KWRA 2EN6A 4LTYA 2WBTA 2RTXA 2YTEA 2L3JA 1MEYC 3BIDA 1IMUA 4X66E 2LBSB 4TUGA 3HPZA 2M1SA 1SR9A 3EQ1A 2NABA 2EM2A
chains in the Genus database with same CATH topology
4NXME 2V88A 3P1XA 1GQEA 1HNZE 4X62E 4JI2E 1O0WA 2JVAA 4I8OA 1N34E 4DV1E 5LMUE 2NUEA 3F6GA 5A2QC 2JWOA 2LTRA 4TUIA 1N32E 4JYAE 1HNWE 2L2KB 4J8ZA 3C4TA 3HQ1A 2RS7A 5AE3A 3VYXA 2YT4A 2MC6A 5CFFE 2B7VA 2E1MA 2LJHA 2IHR1 4LU9A 4LF6E 1J26A 4DKKA 4DR5E 3T1YE 2F4VE 2LUQA 5FLXC 4OX9E 2FTXB 2EZ6A 1DI2A 2V87A 2NA2A 3IWBA 1N33E 2G7HA 2LTSA 2M4IA 3C4BA 5LMNE 4LF8E 4YHHE 2B3TB 3AV0A 1IBME 1YYKA 2B7TA 2L6MA 5BR8E 1XNQE 5IT9C 5ADZA 1WXRA 3ADLA 4DR6E 3HTXA 2L2MA 4B3TE 4R03A 4LF7E 2B9DA 2L2NA 5AE2A 4BC7A 1RC7A 1WHNA 2V83A 2DB2A 3F6HA 4BC9A 3LLHA 4M30A 1J5EE 1IBLE 4B3ME 4DR4E 4JI5E 2VF1A 4KZSA 2L8TA 1EKZA 2NUGA 2MDRA 5LL6R 1HNXE 4KHPE 3OMLA 3K6QA 4Q28A 5IWAE 3VYYA 4F9AB 3FIGA 2CPNA 4WSPA 4DV2E 4DV5E 2HHHE 2UUCE 3LMLA 4DV7E 4JI6E 2E5LE 2LUPB 3HXLA 4DMIA 3JU0A 1STUA 2UXDE 2WZOA 1X49A 2VQFE 2L92A 4L8NA 4GKJE 2KHXA 2L3CA 4DV3E 3IWDA 1XNRE 3DF6A 4DR3E 4GKKE 3J7Yp 3ADIA 2N3GA 2K4VA 4BCAA 4YY3E 2KOUA 3ADJA 2L33A 1QU6A 3MSWA 5AE1A 2NUFA 4F9BB 4JI4E 4X8WA 2JOXA 4JI1E 1HR0E 2DSYA 1GZ6A 2ODRC 4JI3E 4P78A 1X48A 1T4LB 2UUAE 2JR1A 4LF9E 1FKAE 3J80C 4P7DA 1PKPA 4BBYA 2DIXA 4LF5E 4LFBE 2H36X 2UXCE 1IBKE 4WPYA 4DUZE 2N3HA 4L5NC 2V89A 4DV6E 3JAMC 4JI0E 3J7AG 1YZ9A 4DUYE 4AQYE 4BMJA 4OOGC 3J81C 1YYWA 2EWLA 2MC5A 1YYOA 4DV4E 1UHZA 3DJWA 4DR2E 2FGGA 1ZBQA 2LMZA 4JV5E 2RS6A 3OTOE 2VQEE 2V8QB 1XMOE 2VE7C 2UUBE 1X47A 2V85A 2LE2A 2FV4B 2LRSA 4X65E 4DR1E 2UU9E 4NXNE 5T6JA 1XMQE 2F8BA 1UILA 1T4NA 1RQ0A 4B3RE 2V86A 2ZM6E 3RMPA 4M2ZA 4LF4E 1I94E 1T4OA 2ODRD 4GEQB 4R8OA 3VK6A 3JTZA 2JY9A 4WYQB 1WHQA 3ZOQB 4DV0E 4DR7E 4M0VA 1DQ3A 2YZTA 1ZBTA 2UXBE 4JI7E 4F54A 4BS9A 4K0KE 4X64E 1FJGE 5AASA 4JI8E 3H09A 5DNYA 3ADGA 4LFAE 2DMYA 3IWCA 3T1HE 3KWRA 4WFTA 1N36E 4LTYA 2KONA 2RTXA 4B3SE 2L3JA 4LFCE 4X66E 2LBSB 2M7QA 4TUGA 2M1SA 3HPZA 3HPSA 2JOBA 3AUZA 1SR9A 4F9CB 2RSMA 5F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC6 A;  2MC5 A; 
#chains in the Genus database with same CATH topology
 2BBG A;  4NXM E;  1NEI A;  2EE8 A;  4DV1 E;  2L2K B;  4J8Z A;  3HQ1 A;  2RS7 A;  5AE3 A;  2ELY A;  5CFF E;  2LJH A;  4LF6 E;  1KYQ A;  3T1Y E;  2FTX B;  2Q8U A;  4MLV A;  2EM6 A;  2HC5 A;  1YFH A;  3C4B A;  2J7J A;  1RMD A;  2B3T B;  4YHH E;  1JK2 A;  2GHF A;  2PRT A;  1XNQ E;  5IT9 C;  1UBD C;  3ADL A;  4MLQ A;  1TF3 A;  5A69 A;  3HTX A;  4B3T E;  4BHC A;  4ZYE A;  4LF7 E;  2EM0 A;  2EPO A;  1RC7 A;  3LLH A;  4M30 A;  2EPL X;  2R1F A;  2EMH A;  2L8T A;  1EKZ A;  5IWA E;  3FIG A;  1ZAA C;  2YWQ A;  3L00 A;  4DV5 E;  2UUC E;  2D9H A;  3BF2 A;  2MKD A;  3JU0 A;  4KWY A;  3QG5 C;  2VQF E;  4L8N A;  4R2E A;  3IWD A;  3ADI A;  2N3G A;  4M9V C;  2ENA A;  1QU6 A;  1MGT A;  4O4K A;  1PJT A;  2NUF A;  4F9B B;  2EPN A;  4Q35 B;  2JOX A;  1JK1 A;  4JI1 E;  4N4R B;  1PDA A;  2YTG A;  2WBS A;  2ODR C;  4JI3 E;  1T4L B;  2EQ1 A;  4LF9 E;  1SFE A;  2EOF A;  2YSP A;  2DIX A;  4P7D A;  2EPM X;  2H36 X;  4F6M A;  2EMY A;  4L5N C;  2EM3 A;  4WXC A;  3J7A G;  4AQY E;  2YTF A;  3DJW A;  4DR2 E;  2FGG A;  1PJQ A;  2I13 A;  1XMO E;  2LRS A;  4O5G A;  5T6J A;  1T4N A;  4B3R E;  2V86 A;  2RQL A;  2ODR D;  3VK6 A;  4WYQ B;  4DR7 E;  1WHQ A;  2K7I A;  1DQ3 A;  1ZBT A;  4BS9 A;  4X64 E;  2EOM A;  1FJG E;  5AAS A;  3H09 A;  2A25 A;  3IWC A;  3EPH A;  2EL4 A;  2EOX A;  5IXM B;  4B3S E;  4LFC E;  1A1K A;  2YTJ A;  5A6B A;  2EPX A;  2JOB A;  2LJU A;  3AUZ A;  2EMZ A;  3UK3 C;  1A1F A;  1F2I G;  2MDG A;  4R2P A;  1HNZ E;  1GQE A;  4HTG A;  4BHB A;  1N34 E;  3TQM A;  2JWO A;  4JYA E;  1HNW E;  2EMG A;  2EMK A;  2B7V A;  2R76 A;  4LU9 A;  2ENC A;  2EP3 A;  5IV8 B;  5FLX C;  1AAY A;  2EZ6 A;  1DI2 A;  2V87 A;  1YUJ A;  2RPC A;  1GTK A;  2M4I A;  5LMN E;  2WBU A;  4ZYH A;  4ZYG A;  2L6M A;  2EL5 A;  1WXR A;  4R2A A;  5AE2 A;  1YUI A;  3F6H A;  2V83 A;  2DB2 A;  4B3M E;  1IBL E;  2EPZ A;  2VF1 A;  2EOZ A;  2N8X A;  2NUG A;  5LL6 R;  3K6Q A;  3VYY A;  1YPN A;  3C6K A;  2HHH E;  3LML A;  1Z1B A;  2EL6 A;  1A1L A;  1STU A;  5A6J A;  2EM4 A;  4DR3 E;  3C6M A;  3J7Y p;  2K4V A;  3MSW A;  5AE1 A;  2EPP A;  5KL6 A;  2DSY A;  2VRD A;  2EQ3 A;  3EPL A;  2MKN A;  1DGC A;  2UUA E;  2JR1 A;  4WPY A;  1UN6 B;  2N3H A;  2BB8 A;  2V89 A;  2EN8 A;  2EQ0 A;  2EMI A;  1YZ9 A;  4OOG C;  2DLQ A;  2EM8 A;  2EPK X;  2MC5 A;  4DV4 E;  2EPC A;  1ZBQ A;  2LMZ A;  1NCS A;  2UUB E;  2VQE E;  2V8Q B;  2YRM A;  5KL5 A;  2LE2 A;  4NXN E;  2YRK A;  2JXP A;  2ZM6 E;  4LF4 E;  1FKA E;  5LLQ A;  2JY9 A;  5TSE A;  2UXB E;  3MHS C;  2EOY A;  1BBO A;  4K0K E;  1X6F A;  3BGH A;  1X6H A;  3T1H E;  2EOQ A;  2GPI A;  1N36 E;  2KON A;  2LCE A;  5A6A A;  1YSA C;  2M7Q A;  2EOH A;  3HPS A;  4R2D A;  4O24 A;  2EOR A;  2RSM A;  2V88 A;  3P1X A;  4JI2 E;  4X62 E;  1IQO A;  4I8O A;  2YTQ A;  5LMU E;  3F6G A;  2LTR A;  3BBG A;  1G2F C;  3C4T A;  3VYX A;  4X9J A;  4R2C A;  2E1M A;  5A6K A;  1B69 A;  5A6B D;  2EPU A;  2EMF A;  3IWB A;  1N33 E;  5KL4 A;  2LTS A;  4LF8 E;  2JYA A;  3AV0 A;  1IBM E;  2EMX A;  4WX9 A;  5ADZ A;  2HGH A;  2EN4 A;  4R03 A;  4RH8 A;  4BC7 A;  3KZY A;  1KJK A;  4BC9 A;  1IQS A;  2ADR A;  4DR4 E;  5KL2 A;  1EH7 A;  4KZS A;  4KHP E;  2MDR A;  2I9I A;  3OML A;  4Q28 A;  1PJS A;  4WSG A;  4WSP A;  1TF6 A;  4DV7 E;  1TN9 A;  2E5L E;  2YRH A;  4DMI A;  2CT1 A;  3KZZ A;  2EPA A;  2CSH A;  1A1J A;  4F6N A;  4GKJ E;  2KHX A;  2L3C A;  2EMB A;  4YY3 E;  1A1I A;  2KOU A;  3ADJ A;  2JP9 A;  3THN A;  4JI4 E;  2EOI A;  4R2S A;  4F2J C;  3J80 C;  4LFB E;  4LF5 E;  5AC4 A;  4DUZ E;  4DV6 E;  3JAM C;  5AC5 A;  2EPR A;  2EOJ A;  4DUY E;  3J81 C;  4JV5 E;  2M9A A;  1EH8 A;  3OTO E;  2YU5 A;  2VE7 C;  1X47 A;  2WCC 3;  2YTI A;  2FV4 B;  4DR1 E;  2YU8 A;  1G2D C;  1RQ0 A;  4M2Z A;  2EMA A;  1I94 E;  4GEQ B;  2UU9 E;  4DV0 E;  2YZT A;  2EM9 A;  4NHR A;  4WXD A;  2JPA A;  4JI8 E;  4ZYD A;  2DRP A;  4LFA E;  2E72 A;  1T39 A;  4WFT A;  2HJJ A;  3EPJ A;  2EN7 A;  1ZU1 A;  4F9C B;  5F3W A;  4RHB B;  1O0W A;  2JVA A;  2YTO A;  2NUE A;  2EJ4 A;  4IJD A;  5A2Q C;  5KL3 A;  4TUI A;  1N32 E;  2ENH A;  2EOE A;  2YT4 A;  2MC6 A;  3THO B;  2IHR 1;  1J26 A;  4DKK A;  1EH6 A;  4DR5 E;  1BB8 A;  2F4V E;  2LUQ A;  4OX9 E;  2EN2 A;  2YTD A;  2NA2 A;  2G7H A;  2EN1 A;  2EMC A;  2ELZ A;  1YYK A;  2B7T A;  5BR8 E;  4DR6 E;  2L2M A;  2B9D A;  2L2N A;  4NZV A;  1LLM C;  1WHN A;  1J5E E;  2CTD A;  4JI5 E;  1N3G A;  1WRJ A;  1HNX E;  3VHT B;  4F9A B;  2CPN A;  2EMW A;  4DV2 E;  2EOS A;  4JI6 E;  2LUP B;  3HXL A;  4IS1 C;  2UXD E;  2WZO A;  3M99 B;  1X49 A;  4HEI A;  2L92 A;  4DV3 E;  4GKK E;  1XNR E;  3DF6 A;  4BCA A;  2YPN A;  4GZN C;  2L33 A;  1X5W A;  2DGC A;  2EOO A;  3ECR A;  4R2R A;  4X8W A;  1X3C A;  2GLI A;  1A1G A;  1AH5 A;  2LT7 A;  1GZ6 A;  1HR0 E;  4P78 A;  1BBG A;  2LVH A;  1X48 A;  2UXC E;  1PKP A;  4BBY A;  1IBK E;  2YTP A;  2YTN A;  2EM7 A;  2YSO A;  4JI0 E;  1QNT A;  2LO3 A;  3EPK A;  1P47 A;  4BMJ A;  1YYW A;  2EM5 A;  2EWL A;  2RSI A;  1YYO A;  1ZR9 A;  1UHZ A;  2RS6 A;  1X6E A;  2V85 A;  4X65 E;  2LV2 A;  4FK5 C;  1A1H A;  1XMQ E;  2F8B A;  1UIL A;  1L4S A;  2EN3 A;  2EML A;  3RMP A;  1T4O A;  4R8O A;  3JTZ A;  3MHH C;  3ZOQ B;  4R2Q A;  4M0V A;  1WJP A;  2DMI A;  4JI7 E;  4F54 A;  5KL7 A;  5DNY A;  4O43 A;  3ADG A;  1T38 A;  2DLK A;  2DMY A;  3KWR A;  2EN6 A;  4LTY A;  2WBT A;  2RTX A;  2YTE A;  2L3J A;  1MEY C;  3BID A;  1IMU A;  4X66 E;  2LBS B;  4TUG A;  3HPZ A;  2M1S A;  1SR9 A;  3EQ1 A;  2NAB A;  2EM2 A; 
#chains in the Genus database with same CATH homology
 4NXM E;  2V88 A;  3P1X A;  1GQE A;  1HNZ E;  4X62 E;  4JI2 E;  1O0W A;  2JVA A;  4I8O A;  1N34 E;  4DV1 E;  5LMU E;  2NUE A;  3F6G A;  5A2Q C;  2JWO A;  2LTR A;  4TUI A;  1N32 E;  4JYA E;  1HNW E;  2L2K B;  4J8Z A;  3C4T A;  3HQ1 A;  2RS7 A;  5AE3 A;  3VYX A;  2YT4 A;  2MC6 A;  5CFF E;  2B7V A;  2E1M A;  2LJH A;  2IHR 1;  4LU9 A;  4LF6 E;  1J26 A;  4DKK A;  4DR5 E;  3T1Y E;  2F4V E;  2LUQ A;  5FLX C;  4OX9 E;  2FTX B;  2EZ6 A;  1DI2 A;  2V87 A;  2NA2 A;  3IWB A;  1N33 E;  2G7H A;  2LTS A;  2M4I A;  3C4B A;  5LMN E;  4LF8 E;  4YHH E;  2B3T B;  3AV0 A;  1IBM E;  1YYK A;  2B7T A;  2L6M A;  5BR8 E;  1XNQ E;  5IT9 C;  5ADZ A;  1WXR A;  3ADL A;  4DR6 E;  3HTX A;  2L2M A;  4B3T E;  4R03 A;  4LF7 E;  2B9D A;  2L2N A;  5AE2 A;  4BC7 A;  1RC7 A;  1WHN A;  2V83 A;  2DB2 A;  3F6H A;  4BC9 A;  3LLH A;  4M30 A;  1J5E E;  1IBL E;  4B3M E;  4DR4 E;  4JI5 E;  2VF1 A;  4KZS A;  2L8T A;  1EKZ A;  2NUG A;  2MDR A;  5LL6 R;  1HNX E;  4KHP E;  3OML A;  3K6Q A;  4Q28 A;  5IWA E;  3VYY A;  4F9A B;  3FIG A;  2CPN A;  4WSP A;  4DV2 E;  4DV5 E;  2HHH E;  2UUC E;  3LML A;  4DV7 E;  4JI6 E;  2E5L E;  2LUP B;  3HXL A;  4DMI A;  3JU0 A;  1STU A;  2UXD E;  2WZO A;  1X49 A;  2VQF E;  2L92 A;  4L8N A;  4GKJ E;  2KHX A;  2L3C A;  4DV3 E;  3IWD A;  1XNR E;  3DF6 A;  4DR3 E;  4GKK E;  3J7Y p;  3ADI A;  2N3G A;  2K4V A;  4BCA A;  4YY3 E;  2KOU A;  3ADJ A;  2L33 A;  1QU6 A;  3MSW A;  5AE1 A;  2NUF A;  4F9B B;  4JI4 E;  4X8W A;  2JOX A;  4JI1 E;  1HR0 E;  2DSY A;  1GZ6 A;  2ODR C;  4JI3 E;  4P78 A;  1X48 A;  1T4L B;  2UUA E;  2JR1 A;  4LF9 E;  1FKA E;  3J80 C;  4P7D A;  1PKP A;  4BBY A;  2DIX A;  4LF5 E;  4LFB E;  2H36 X;  2UXC E;  1IBK E;  4WPY A;  4DUZ E;  2N3H A;  4L5N C;  2V89 A;  4DV6 E;  3JAM C;  4JI0 E;  3J7A G;  1YZ9 A;  4DUY E;  4AQY E;  4BMJ A;  4OOG C;  3J81 C;  1YYW A;  2EWL A;  2MC5 A;  1YYO A;  4DV4 E;  1UHZ A;  3DJW A;  4DR2 E;  2FGG A;  1ZBQ A;  2LMZ A;  4JV5 E;  2RS6 A;  3OTO E;  2VQE E;  2V8Q B;  1XMO E;  2VE7 C;  2UUB E;  1X47 A;  2V85 A;  2LE2 A;  2FV4 B;  2LRS A;  4X65 E;  4DR1 E;  2UU9 E;  4NXN E;  5T6J A;  1XMQ E;  2F8B A;  1UIL A;  1T4N A;  1RQ0 A;  4B3R E;  2V86 A;  2ZM6 E;  3RMP A;  4M2Z A;  4LF4 E;  1I94 E;  1T4O A;  2ODR D;  4GEQ B;  4R8O A;  3VK6 A;  3JTZ A;  2JY9 A;  4WYQ B;  1WHQ A;  3ZOQ B;  4DV0 E;  4DR7 E;  4M0V A;  1DQ3 A;  2YZT A;  1ZBT A;  2UXB E;  4JI7 E;  4F54 A;  4BS9 A;  4K0K E;  4X64 E;  1FJG E;  5AAS A;  4JI8 E;  3H09 A;  5DNY A;  3ADG A;  4LFA E;  2DMY A;  3IWC A;  3T1H E;  3KWR A;  4WFT A;  1N36 E;  4LTY A;  2KON A;  2RTX A;  4B3S E;  2L3J A;  4LFC E;  4X66 E;  2LBS B;  2M7Q A;  4TUG A;  2M1S A;  3HPZ A;  3HPS A;  2JOB A;  3AUZ A;  1SR9 A;  4F9C B;  2RSM A;  5F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...