2EM3A

Solution structure of the c2h2 type zinc finger (region 640-672) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECKVCSKAFTQKAHLAQHQKTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 640-672) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em3A00
1A1HA 3MHSC 2EN8A 2EN3A 2EM3A 2YSOA 2BB8A 2EOYA 2EMCA 2EJ4A 2PRTA 2EN6A 1UN6B 3M99B 2EPPA 1X6EA 5KL2A 5KL7A 2J7JA 2EN4A 2YTOA 2EM9A 1BB8A 2DLQA 2VRDA 4FK5C 4R2RA 5KL5A 2EN7A 2EM4A 1BBOA 2EPRA 2YU8A 2DMIA 2EPAA 1X3CA 2ELZA 2JP9A 1TN9A 2YU5A 2CT1A 1B69A 2LVHA 3EPKA 1JK1A 2EMHA 2EM2A 2YRMA 2EORA 2EOOA 2DRPA 2WBUA 2HGHA 2MKNA 2EMLA 1G2DC 2I13A 2EMZA 2EE8A 2RSIA 1MEYC 2ENHA 1ZU1A 3EPLA 1TF6A 2YTJA 2CTDA 4R2DA 2EP3A 2EM7A 2EQ1A 2LV2A 2YSPA 1P47A 2LO3A 2EMAA 2ENCA 2EMFA 2EL5A 2EOEA 2EOIA 1ZR9A 1F2IG 1RMDA 2WBTA 1X5WA 2EOXA 2YTNA 4X9JA 2EOHA 2DGCA 2EN2A 4R2SA 2YTFA 1JK2A 2EMKA 2EN1A 2LT7A 1WJPA 2E72A 2YTDA 1X6FA 1LLMC 1A1GA 2EPCA 4R2QA 1NCSA 4R2PA 4F6NA 1DGCA 3EPHA 2EM5A 2WBSA 2EQ3A 2EMGA 2EMWA 4F6MA 2R1FA 2EMYA 3VHTB 2GLIA 4IS1C 2EM0A 1A1LA 2MKDA 2EQ0A 1G2FC 2GHFA 1A1JA 2A25A 4R2CA 4F2JC 2EOSA 2YTPA 2M9AA 3EPJA 1TF3A 4IJDA 4R2AA 2EMXA 2EL6A 2CSHA 3UK3C 2DLKA 2YTIA 4M9VC 2EM8A 3MHHC 2EPXA 4WSGA 4GZNC 4R2EA 2EMIA 1A1KA 2EOQA 1Z1BA 1X6HA 2D9HA 2YTEA 2YRKA 2JPAA 1ZAAC 2MDGA 1YUIA 1UBDC 2EOFA 1KJKA 5KL6A 2YTGA 2EOZA 2WCC3 2LCEA 2ELYA 2ADRA 2EPUA 1A1FA 2EOJA 2EOMA 2EMBA 2YTQA 2RPCA 2EPZA 2YRHA 2ENAA 2EL4A 2EM6A 5KL4A 1A1IA 1AAYA 1YUJA 1YSAC 5KL3A 2NABA
chains in the Genus database with same CATH superfamily
4JI8E 5AE2A 2EM3A 2YSOA 3AV0A 1HNWE 2EJ4A 1YZ9A 1PKPA 5A6KA 1NEIA 4ZYEA 2J7JA 2EM9A 5LMNE 2ODRD 4M30A 2LUPB 2EM4A 1BBOA 2EPRA 2DMIA 2N8XA 3HPZA 4LTYA 2ELZA 4ZYHA 2LVHA 2EORA 4BC9A 2I13A 5BR8E 4DV5E 2RSIA 3IWDA 1TF6A 3EPLA 2YTJA 4R2DA 2EM7A 2EQ1A 4X64E 4LF7E 4DR4E 2LO3A 4DV1E 2B9DA 2L33A 3C6MA 1RMDA 4GKJE 4NXNE 4WSPA 3ECRA 3F6HA 2EPCA 4NXME 2K4VA 2EM5A 2JYAA 2EMWA 4F6MA 2GLIA 3T1HE 4B3ME 2EPLX 1A1LA 4NHRA 2EQ0A 1IQSA 2L6MA 5TSEA 2N3HA 2M4IA 4B3SE 4DV4E 3DF6A 5AC5A 5LL6R 5AE3A 3KZZA 4DKKA 4WSGA 2EPXA 2YT4A 4GZNC 4R2EA 1X47A 1A1KA 1UHZA 2MDRA 5FLXC 4ZYDA 2YTEA 3H09A 2MDGA 3P1XA 1UBDC 2EPOA 2EOZA 2HJJA 2LRSA 2WCC3 1IBKE 2B7VA 4R8OA 3HXLA 2JXPA 2EPUA 2EOJA 4LF4E 2UU9E 2KOUA 4F9BB 2ENAA 3ADJA 1N33E 1J5EE 5KL4A 1YUJA 1IMUA 1YSAC 3F6GA 3J7AG 3MHSC 2L92A 2DMYA 3BBGA 2EOYA 3OMLA 5A69A 2JVAA 4R03A 2EN6A 3M99B 2EPPA 2JY9A 1N32E 2EN4A 2ZM6E 4FK5C 2JOBA 3ADIA 2LMZA 2RTXA 1AH5A 1X48A 2EN7A 4B3RE 4TUIA 2V89A 1STUA 3FIGA 2YU8A 1FKAE 1X3CA 1QNTA 4F9AB 1GQEA 3EPKA 2Q8UA 1T39A 5A6AA 1JK1A 2F8BA 2MC6A 2DRPA 2YRMA 2EOOA 1IBME 2EMLA 4JI5E 2HC5A 2ENHA 2CTDA 5A6JA 1RC7A 1XMOE 4JI2E 1P47A 4GEQB 2EMAA 3C4TA 2EL5A 4BS9A 2LTRA 2WBTA 4LFCE 2EOXA 2YTNA 4K0KE 2EOHA 2KHXA 3VYXA 2UXBE 2DGCA 1JK2A 4O24A 1PJSA 1WJPA 1ZBTA 2YTDA 1X6FA 1MGTA 4KWYA 3AUZA 4F6NA 1DGCA 4J8ZA 1YYWA 2LUQA 2EQ3A 2EMGA 4BMJA 4BHCA 2NUGA 2EM0A 4Q35B 5IWAE 1BBGA 2B3TB 1N36E 2WZOA 3BF2A 1A1JA 4LF6E 4R2CA 2M9AA 5CFFE 4IJDA 1HNXE 2EMXA 2EL6A 3UK3C 2DLKA 2EWLA 3QG5C 2MC5A 5F3WA 2RQLA 4BCAA 3MHHC 3DJWA 4F54A 3ZOQB 3J7Yp 4M2ZA 1FJGE 1XNQE 2EOQA 1X6HA 2D9HA 5T6JA 5AASA 2G7HA 4WXDA 1N3GA 2NUFA 4WPYA 4DV6E 3T1YE 1KJKA 5KL6A 2YTGA 2UXDE 2LCEA 5DNYA 4WYQB 2B7TA 2RS6A 4LF8E 2UXCE 2EOMA 4NZVA 3THNA 1SFEA 2L8TA 1EH8A 2H36X 2EL4A 4DR2E 2UUAE 1A1HA 2FV4B 4X62E 2EN3A 2BB8A 4P7DA 2E1MA 4JI0E 1HNZE 2PRTA 1XNRE 1EH6A 1X6EA 4LU9A 4DR5E 2L3CA 5KL2A 3J80C 2JOXA 4HTGA 1BB8A 3HTXA 2VRDA 2V86A 4R2RA 4M0VA 5KL5A 1KYQA 1PJTA 4WFTA 4DR3E 1O0WA 2YU5A 4F9CB 3C4BA 1DI2A 3BGHA 2V8QB 2EMHA 1UILA 4YY3E 4L5NC 2NA2A 4YHHE 2HGHA 3MSWA 2EE8A 4WXCA 1MEYC 1ZU1A 2EPNA 2EP3A 5A2QC 2EPMX 4BC7A 4AQYE 1IBLE 1WXRA 2ENCA 2EMFA 2KONA 2EZ6A 2EOEA 4JYAE 1F2IG 2V88A 4X9JA 3RMPA 1T38A 4X66E 4R2SA 3JTZA 2E72A 1A1GA 1LLMC 4R2QA 1NCSA 3EPHA 5A6BA 2R1FA 2EMYA 3VHTB 2E5LE 4IS1C 4LF5E 3JU0A 3L00A 1N34E 2LE2A 1G2FC 2VF1A 4HEIA 4BBYA 4F2JC 1EKZA 2EOSA 2YTPA 5LMUE 5ADZA 1TF3A 4JI3E 4R2AA 5AE1A 2CSHA 2NUEA 2JR1A 4OOGC 2V87A 2YZTA 2VQEE 4DR7E 1I94E 3ADLA 2GPIA 5AC4A 2IHR1 2YRKA 1QU6A 1ZAAC 1YUIA 4DUZE 1RQ0A 2BBGA 2L2NA 3HPSA 2K7IA 1YYOA 4GKKE 3OTOE 2ODRC 2ELYA 1YYKA 2YPNA 2ADRA 1A1FA 1WHQA 2L2MA 4DUYE 2RSMA 2YTQA 4ZYGA 2RPCA 1GTKA 2YRHA 2LJHA 3C6KA 1A1IA 1AAYA 2VQFE 2HHHE 3K6QA 2FGGA 5KL3A 2M7QA 2DB2A 2EN8A 1T4OA 4BHBA 2N3GA 2F4VE 2EMCA 3LLHA 1UN6B 4DV3E 4TUGA 5KL7A 3KZYA 2I9IA 4RH8A 2YTOA 1PJQA 5IV8B 2DLQA 3LMLA 4X8WA 1EH7A 4O5GA 4LFBE 2L2KB 1XMQE 2DSYA 4L8NA 3TQMA 2EPKX 2EPAA 2JP9A 1TN9A 2CT1A 4WX9A 1B69A 4DR1E 1WHNA 3THOB 4DV7E 2EM2A 3VYYA 2WBUA 2LBSB 1X49A 2MKNA 1G2DC 2EMZA 4N4RB 4RHBB 5IXMB 2R76A 2VE7C 1ZBQA 1YPNA 2LV2A 2YSPA 4I8OA 2YWQA 5IT9C 4B3TE 4LF9E 2RS7A 4DV0E 4DV2E 3IWCA 2EOIA 1ZR9A 2L3JA 1X5WA 4OX9E 4DMIA 2EN2A 2YTFA 4X65E 2EMKA 2EN1A 2FTXB 2LT7A 1J26A 1L4SA 4R2PA 1DQ3A 2WBSA 4MLVA 4O43A 1YFHA 4JI6E 4P78A 1IQOA 4LFAE 3VK6A 2LJUA 2MKDA 3HQ1A 4KZSA 2DIXA 3EQ1A 4O4KA 2GHFA 1T4NA 2A25A 2UUBE 5A6BD 3EPJA 1PDAA 2JWOA 2LTSA 2YTIA 1GZ6A 2UUCE 4M9VC 2EM8A 1WRJA 4JI1E 2EMIA 1Z1BA 5LLQA 4KHPE 3IWBA 1HR0E 2JPAA 2CPNA 2EOFA 3JAMC 3KWRA 4JV5E 4JI7E 2M1SA 4DR6E 4MLQA 4Q28A 3ADGA 1SR9A 2EMBA 2EPZA 3J81C 1T4LB 2EM6A 3BIDA 2V85A 2V83A 2NABA 4JI4E
chains in the Genus database with same CATH topology
1A1HA 3MHSC 2EN8A 2EN3A 2EM3A 2YSOA 2BB8A 2EOYA 2EMCA 2EJ4A 2PRTA 2EN6A 1UN6B 3M99B 2EPPA 1X6EA 5KL2A 5KL7A 2J7JA 2EN4A 2YTOA 2EM9A 1BB8A 2DLQA 2VRDA 4FK5C 4R2RA 5KL5A 2EN7A 2EM4A 1BBOA 2EPRA 2YU8A 2DMIA 2EPAA 1X3CA 2ELZA 2JP9A 1TN9A 2YU5A 2CT1A 1B69A 2LVHA 3EPKA 1JK1A 2EMHA 2EM2A 2YRMA 2EORA 2EOOA 2DRPA 2WBUA 2HGHA 2MKNA 2EMLA 1G2DC 2I13A 2EMZA 2EE8A 2RSIA 1MEYC 2ENHA 1ZU1A 3EPLA 1TF6A 2YTJA 2CTDA 4R2DA 2EP3A 2EM7A 2EQ1A 2LV2A 2YSPA 1P47A 2LO3A 2EMAA 2ENCA 2EMFA 2EL5A 2EOEA 2EOIA 1ZR9A 1F2IG 1RMDA 2WBTA 1X5WA 2EOXA 2YTNA 4X9JA 2EOHA 2DGCA 2EN2A 4R2SA 2YTFA 1JK2A 2EMKA 2EN1A 2LT7A 1WJPA 2E72A 2YTDA 1X6FA 1LLMC 1A1GA 2EPCA 4R2QA 1NCSA 4R2PA 4F6NA 1DGCA 3EPHA 2EM5A 2WBSA 2EQ3A 2EMGA 2EMWA 4F6MA 2R1FA 2EMYA 3VHTB 2GLIA 4IS1C 2EM0A 1A1LA 2MKDA 2EQ0A 1G2FC 2GHFA 1A1JA 2A25A 4R2CA 4F2JC 2EOSA 2YTPA 2M9AA 3EPJA 1TF3A 4IJDA 4R2AA 2EMXA 2EL6A 2CSHA 3UK3C 2DLKA 2YTIA 4M9VC 2EM8A 3MHHC 2EPXA 4WSGA 4GZNC 4R2EA 2EMIA 1A1KA 2EOQA 1Z1BA 1X6HA 2D9HA 2YTEA 2YRKA 2JPAA 1ZAAC 2MDGA 1YUIA 1UBDC 2EOFA 1KJKA 5KL6A 2YTGA 2EOZA 2WCC3 2LCEA 2ELYA 2ADRA 2EPUA 1A1FA 2EOJA 2EOMA 2EMBA 2YTQA 2RPCA 2EPZA 2YRHA 2ENAA 2EL4A 2EM6A 5KL4A 1A1IA 1AAYA 1YUJA 1YSAC 5KL3A 2NABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1H A;  3MHS C;  2EN8 A;  2EN3 A;  2EM3 A;  2YSO A;  2BB8 A;  2EOY A;  2EMC A;  2EJ4 A;  2PRT A;  2EN6 A;  1UN6 B;  3M99 B;  2EPP A;  1X6E A;  5KL2 A;  5KL7 A;  2J7J A;  2EN4 A;  2YTO A;  2EM9 A;  1BB8 A;  2DLQ A;  2VRD A;  4FK5 C;  4R2R A;  5KL5 A;  2EN7 A;  2EM4 A;  1BBO A;  2EPR A;  2YU8 A;  2DMI A;  2EPA A;  1X3C A;  2ELZ A;  2JP9 A;  1TN9 A;  2YU5 A;  2CT1 A;  1B69 A;  2LVH A;  3EPK A;  1JK1 A;  2EMH A;  2EM2 A;  2YRM A;  2EOR A;  2EOO A;  2DRP A;  2WBU A;  2HGH A;  2MKN A;  2EML A;  1G2D C;  2I13 A;  2EMZ A;  2EE8 A;  2RSI A;  1MEY C;  2ENH A;  1ZU1 A;  3EPL A;  1TF6 A;  2YTJ A;  2CTD A;  4R2D A;  2EP3 A;  2EM7 A;  2EQ1 A;  2LV2 A;  2YSP A;  1P47 A;  2LO3 A;  2EMA A;  2ENC A;  2EMF A;  2EL5 A;  2EOE A;  2EOI A;  1ZR9 A;  1F2I G;  1RMD A;  2WBT A;  1X5W A;  2EOX A;  2YTN A;  4X9J A;  2EOH A;  2DGC A;  2EN2 A;  4R2S A;  2YTF A;  1JK2 A;  2EMK A;  2EN1 A;  2LT7 A;  1WJP A;  2E72 A;  2YTD A;  1X6F A;  1LLM C;  1A1G A;  2EPC A;  4R2Q A;  1NCS A;  4R2P A;  4F6N A;  1DGC A;  3EPH A;  2EM5 A;  2WBS A;  2EQ3 A;  2EMG A;  2EMW A;  4F6M A;  2R1F A;  2EMY A;  3VHT B;  2GLI A;  4IS1 C;  2EM0 A;  1A1L A;  2MKD A;  2EQ0 A;  1G2F C;  2GHF A;  1A1J A;  2A25 A;  4R2C A;  4F2J C;  2EOS A;  2YTP A;  2M9A A;  3EPJ A;  1TF3 A;  4IJD A;  4R2A A;  2EMX A;  2EL6 A;  2CSH A;  3UK3 C;  2DLK A;  2YTI A;  4M9V C;  2EM8 A;  3MHH C;  2EPX A;  4WSG A;  4GZN C;  4R2E A;  2EMI A;  1A1K A;  2EOQ A;  1Z1B A;  1X6H A;  2D9H A;  2YTE A;  2YRK A;  2JPA A;  1ZAA C;  2MDG A;  1YUI A;  1UBD C;  2EOF A;  1KJK A;  5KL6 A;  2YTG A;  2EOZ A;  2WCC 3;  2LCE A;  2ELY A;  2ADR A;  2EPU A;  1A1F A;  2EOJ A;  2EOM A;  2EMB A;  2YTQ A;  2RPC A;  2EPZ A;  2YRH A;  2ENA A;  2EL4 A;  2EM6 A;  5KL4 A;  1A1I A;  1AAY A;  1YUJ A;  1YSA C;  5KL3 A;  2NAB A; 
#chains in the Genus database with same CATH topology
 4JI8 E;  5AE2 A;  2EM3 A;  2YSO A;  3AV0 A;  1HNW E;  2EJ4 A;  1YZ9 A;  1PKP A;  5A6K A;  1NEI A;  4ZYE A;  2J7J A;  2EM9 A;  5LMN E;  2ODR D;  4M30 A;  2LUP B;  2EM4 A;  1BBO A;  2EPR A;  2DMI A;  2N8X A;  3HPZ A;  4LTY A;  2ELZ A;  4ZYH A;  2LVH A;  2EOR A;  4BC9 A;  2I13 A;  5BR8 E;  4DV5 E;  2RSI A;  3IWD A;  1TF6 A;  3EPL A;  2YTJ A;  4R2D A;  2EM7 A;  2EQ1 A;  4X64 E;  4LF7 E;  4DR4 E;  2LO3 A;  4DV1 E;  2B9D A;  2L33 A;  3C6M A;  1RMD A;  4GKJ E;  4NXN E;  4WSP A;  3ECR A;  3F6H A;  2EPC A;  4NXM E;  2K4V A;  2EM5 A;  2JYA A;  2EMW A;  4F6M A;  2GLI A;  3T1H E;  4B3M E;  2EPL X;  1A1L A;  4NHR A;  2EQ0 A;  1IQS A;  2L6M A;  5TSE A;  2N3H A;  2M4I A;  4B3S E;  4DV4 E;  3DF6 A;  5AC5 A;  5LL6 R;  5AE3 A;  3KZZ A;  4DKK A;  4WSG A;  2EPX A;  2YT4 A;  4GZN C;  4R2E A;  1X47 A;  1A1K A;  1UHZ A;  2MDR A;  5FLX C;  4ZYD A;  2YTE A;  3H09 A;  2MDG A;  3P1X A;  1UBD C;  2EPO A;  2EOZ A;  2HJJ A;  2LRS A;  2WCC 3;  1IBK E;  2B7V A;  4R8O A;  3HXL A;  2JXP A;  2EPU A;  2EOJ A;  4LF4 E;  2UU9 E;  2KOU A;  4F9B B;  2ENA A;  3ADJ A;  1N33 E;  1J5E E;  5KL4 A;  1YUJ A;  1IMU A;  1YSA C;  3F6G A;  3J7A G;  3MHS C;  2L92 A;  2DMY A;  3BBG A;  2EOY A;  3OML A;  5A69 A;  2JVA A;  4R03 A;  2EN6 A;  3M99 B;  2EPP A;  2JY9 A;  1N32 E;  2EN4 A;  2ZM6 E;  4FK5 C;  2JOB A;  3ADI A;  2LMZ A;  2RTX A;  1AH5 A;  1X48 A;  2EN7 A;  4B3R E;  4TUI A;  2V89 A;  1STU A;  3FIG A;  2YU8 A;  1FKA E;  1X3C A;  1QNT A;  4F9A B;  1GQE A;  3EPK A;  2Q8U A;  1T39 A;  5A6A A;  1JK1 A;  2F8B A;  2MC6 A;  2DRP A;  2YRM A;  2EOO A;  1IBM E;  2EML A;  4JI5 E;  2HC5 A;  2ENH A;  2CTD A;  5A6J A;  1RC7 A;  1XMO E;  4JI2 E;  1P47 A;  4GEQ B;  2EMA A;  3C4T A;  2EL5 A;  4BS9 A;  2LTR A;  2WBT A;  4LFC E;  2EOX A;  2YTN A;  4K0K E;  2EOH A;  2KHX A;  3VYX A;  2UXB E;  2DGC A;  1JK2 A;  4O24 A;  1PJS A;  1WJP A;  1ZBT A;  2YTD A;  1X6F A;  1MGT A;  4KWY A;  3AUZ A;  4F6N A;  1DGC A;  4J8Z A;  1YYW A;  2LUQ A;  2EQ3 A;  2EMG A;  4BMJ A;  4BHC A;  2NUG A;  2EM0 A;  4Q35 B;  5IWA E;  1BBG A;  2B3T B;  1N36 E;  2WZO A;  3BF2 A;  1A1J A;  4LF6 E;  4R2C A;  2M9A A;  5CFF E;  4IJD A;  1HNX E;  2EMX A;  2EL6 A;  3UK3 C;  2DLK A;  2EWL A;  3QG5 C;  2MC5 A;  5F3W A;  2RQL A;  4BCA A;  3MHH C;  3DJW A;  4F54 A;  3ZOQ B;  3J7Y p;  4M2Z A;  1FJG E;  1XNQ E;  2EOQ A;  1X6H A;  2D9H A;  5T6J A;  5AAS A;  2G7H A;  4WXD A;  1N3G A;  2NUF A;  4WPY A;  4DV6 E;  3T1Y E;  1KJK A;  5KL6 A;  2YTG A;  2UXD E;  2LCE A;  5DNY A;  4WYQ B;  2B7T A;  2RS6 A;  4LF8 E;  2UXC E;  2EOM A;  4NZV A;  3THN A;  1SFE A;  2L8T A;  1EH8 A;  2H36 X;  2EL4 A;  4DR2 E;  2UUA E;  1A1H A;  2FV4 B;  4X62 E;  2EN3 A;  2BB8 A;  4P7D A;  2E1M A;  4JI0 E;  1HNZ E;  2PRT A;  1XNR E;  1EH6 A;  1X6E A;  4LU9 A;  4DR5 E;  2L3C A;  5KL2 A;  3J80 C;  2JOX A;  4HTG A;  1BB8 A;  3HTX A;  2VRD A;  2V86 A;  4R2R A;  4M0V A;  5KL5 A;  1KYQ A;  1PJT A;  4WFT A;  4DR3 E;  1O0W A;  2YU5 A;  4F9C B;  3C4B A;  1DI2 A;  3BGH A;  2V8Q B;  2EMH A;  1UIL A;  4YY3 E;  4L5N C;  2NA2 A;  4YHH E;  2HGH A;  3MSW A;  2EE8 A;  4WXC A;  1MEY C;  1ZU1 A;  2EPN A;  2EP3 A;  5A2Q C;  2EPM X;  4BC7 A;  4AQY E;  1IBL E;  1WXR A;  2ENC A;  2EMF A;  2KON A;  2EZ6 A;  2EOE A;  4JYA E;  1F2I G;  2V88 A;  4X9J A;  3RMP A;  1T38 A;  4X66 E;  4R2S A;  3JTZ A;  2E72 A;  1A1G A;  1LLM C;  4R2Q A;  1NCS A;  3EPH A;  5A6B A;  2R1F A;  2EMY A;  3VHT B;  2E5L E;  4IS1 C;  4LF5 E;  3JU0 A;  3L00 A;  1N34 E;  2LE2 A;  1G2F C;  2VF1 A;  4HEI A;  4BBY A;  4F2J C;  1EKZ A;  2EOS A;  2YTP A;  5LMU E;  5ADZ A;  1TF3 A;  4JI3 E;  4R2A A;  5AE1 A;  2CSH A;  2NUE A;  2JR1 A;  4OOG C;  2V87 A;  2YZT A;  2VQE E;  4DR7 E;  1I94 E;  3ADL A;  2GPI A;  5AC4 A;  2IHR 1;  2YRK A;  1QU6 A;  1ZAA C;  1YUI A;  4DUZ E;  1RQ0 A;  2BBG A;  2L2N A;  3HPS A;  2K7I A;  1YYO A;  4GKK E;  3OTO E;  2ODR C;  2ELY A;  1YYK A;  2YPN A;  2ADR A;  1A1F A;  1WHQ A;  2L2M A;  4DUY E;  2RSM A;  2YTQ A;  4ZYG A;  2RPC A;  1GTK A;  2YRH A;  2LJH A;  3C6K A;  1A1I A;  1AAY A;  2VQF E;  2HHH E;  3K6Q A;  2FGG A;  5KL3 A;  2M7Q A;  2DB2 A;  2EN8 A;  1T4O A;  4BHB A;  2N3G A;  2F4V E;  2EMC A;  3LLH A;  1UN6 B;  4DV3 E;  4TUG A;  5KL7 A;  3KZY A;  2I9I A;  4RH8 A;  2YTO A;  1PJQ A;  5IV8 B;  2DLQ A;  3LML A;  4X8W A;  1EH7 A;  4O5G A;  4LFB E;  2L2K B;  1XMQ E;  2DSY A;  4L8N A;  3TQM A;  2EPK X;  2EPA A;  2JP9 A;  1TN9 A;  2CT1 A;  4WX9 A;  1B69 A;  4DR1 E;  1WHN A;  3THO B;  4DV7 E;  2EM2 A;  3VYY A;  2WBU A;  2LBS B;  1X49 A;  2MKN A;  1G2D C;  2EMZ A;  4N4R B;  4RHB B;  5IXM B;  2R76 A;  2VE7 C;  1ZBQ A;  1YPN A;  2LV2 A;  2YSP A;  4I8O A;  2YWQ A;  5IT9 C;  4B3T E;  4LF9 E;  2RS7 A;  4DV0 E;  4DV2 E;  3IWC A;  2EOI A;  1ZR9 A;  2L3J A;  1X5W A;  4OX9 E;  4DMI A;  2EN2 A;  2YTF A;  4X65 E;  2EMK A;  2EN1 A;  2FTX B;  2LT7 A;  1J26 A;  1L4S A;  4R2P A;  1DQ3 A;  2WBS A;  4MLV A;  4O43 A;  1YFH A;  4JI6 E;  4P78 A;  1IQO A;  4LFA E;  3VK6 A;  2LJU A;  2MKD A;  3HQ1 A;  4KZS A;  2DIX A;  3EQ1 A;  4O4K A;  2GHF A;  1T4N A;  2A25 A;  2UUB E;  5A6B D;  3EPJ A;  1PDA A;  2JWO A;  2LTS A;  2YTI A;  1GZ6 A;  2UUC E;  4M9V C;  2EM8 A;  1WRJ A;  4JI1 E;  2EMI A;  1Z1B A;  5LLQ A;  4KHP E;  3IWB A;  1HR0 E;  2JPA A;  2CPN A;  2EOF A;  3JAM C;  3KWR A;  4JV5 E;  4JI7 E;  2M1S A;  4DR6 E;  4MLQ A;  4Q28 A;  3ADG A;  1SR9 A;  2EMB A;  2EPZ A;  3J81 C;  1T4L B;  2EM6 A;  3BID A;  2V85 A;  2V83 A;  2NAB A;  4JI4 E; 
#chains in the Genus database with same CATH homology
 1A1H A;  3MHS C;  2EN8 A;  2EN3 A;  2EM3 A;  2YSO A;  2BB8 A;  2EOY A;  2EMC A;  2EJ4 A;  2PRT A;  2EN6 A;  1UN6 B;  3M99 B;  2EPP A;  1X6E A;  5KL2 A;  5KL7 A;  2J7J A;  2EN4 A;  2YTO A;  2EM9 A;  1BB8 A;  2DLQ A;  2VRD A;  4FK5 C;  4R2R A;  5KL5 A;  2EN7 A;  2EM4 A;  1BBO A;  2EPR A;  2YU8 A;  2DMI A;  2EPA A;  1X3C A;  2ELZ A;  2JP9 A;  1TN9 A;  2YU5 A;  2CT1 A;  1B69 A;  2LVH A;  3EPK A;  1JK1 A;  2EMH A;  2EM2 A;  2YRM A;  2EOR A;  2EOO A;  2DRP A;  2WBU A;  2HGH A;  2MKN A;  2EML A;  1G2D C;  2I13 A;  2EMZ A;  2EE8 A;  2RSI A;  1MEY C;  2ENH A;  1ZU1 A;  3EPL A;  1TF6 A;  2YTJ A;  2CTD A;  4R2D A;  2EP3 A;  2EM7 A;  2EQ1 A;  2LV2 A;  2YSP A;  1P47 A;  2LO3 A;  2EMA A;  2ENC A;  2EMF A;  2EL5 A;  2EOE A;  2EOI A;  1ZR9 A;  1F2I G;  1RMD A;  2WBT A;  1X5W A;  2EOX A;  2YTN A;  4X9J A;  2EOH A;  2DGC A;  2EN2 A;  4R2S A;  2YTF A;  1JK2 A;  2EMK A;  2EN1 A;  2LT7 A;  1WJP A;  2E72 A;  2YTD A;  1X6F A;  1LLM C;  1A1G A;  2EPC A;  4R2Q A;  1NCS A;  4R2P A;  4F6N A;  1DGC A;  3EPH A;  2EM5 A;  2WBS A;  2EQ3 A;  2EMG A;  2EMW A;  4F6M A;  2R1F A;  2EMY A;  3VHT B;  2GLI A;  4IS1 C;  2EM0 A;  1A1L A;  2MKD A;  2EQ0 A;  1G2F C;  2GHF A;  1A1J A;  2A25 A;  4R2C A;  4F2J C;  2EOS A;  2YTP A;  2M9A A;  3EPJ A;  1TF3 A;  4IJD A;  4R2A A;  2EMX A;  2EL6 A;  2CSH A;  3UK3 C;  2DLK A;  2YTI A;  4M9V C;  2EM8 A;  3MHH C;  2EPX A;  4WSG A;  4GZN C;  4R2E A;  2EMI A;  1A1K A;  2EOQ A;  1Z1B A;  1X6H A;  2D9H A;  2YTE A;  2YRK A;  2JPA A;  1ZAA C;  2MDG A;  1YUI A;  1UBD C;  2EOF A;  1KJK A;  5KL6 A;  2YTG A;  2EOZ A;  2WCC 3;  2LCE A;  2ELY A;  2ADR A;  2EPU A;  1A1F A;  2EOJ A;  2EOM A;  2EMB A;  2YTQ A;  2RPC A;  2EPZ A;  2YRH A;  2ENA A;  2EL4 A;  2EM6 A;  5KL4 A;  1A1I A;  1AAY A;  1YUJ A;  1YSA C;  5KL3 A;  2NAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...