2EM3A

Solution structure of the c2h2 type zinc finger (region 640-672) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECKVCSKAFTQKAHLAQHQKTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 640-672) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em3A00
2EOHA 1JK2A 2EPPA 5KL2A 1B69A 2CTDA 2EMHA 2EN1A 2ENCA 2EPAA 2JP9A 1A1FA 3EPJA 2RSIA 2EN6A 2MKDA 2MDGA 3UK3C 1TF6A 1A1GA 1NCSA 1YUJA 1BB8A 1A1KA 2EL5A 2EM6A 1F2IG 2YTGA 2LT7A 3EPKA 3EPLA 4X9JA 1BBOA 2M9AA 2EMFA 2EM0A 2EM2A 2EOSA 2EMKA 2EPCA 2WBSA 2EQ1A 4IJDA 2EL6A 1KJKA 2EM9A 1X6FA 2GHFA 2NABA 2EMCA 4R2AA 2YSPA 2EPRA 2WBUA 2YU5A 4R2RA 2YTQA 2CSHA 2ADRA 2PRTA 2EN4A 2E72A 2YTEA 2HGHA 2DLKA 3MHHC 2YTPA 2EOMA 2GLIA 2EMWA 2YU8A 1X6HA 2EOIA 1UBDC 4F2JC 2EQ0A 4GZNC 2EN7A 2YRKA 2DRPA 1WJPA 2EN3A 2EOXA 1A1LA 2EMBA 1TF3A 1Z1BA 1P47A 2J7JA 2EOYA 4WSGA 2I13A 1UN6B 2EM8A 2YTOA 4R2QA 2WCC3 4R2DA 2EMZA 4R2CA 5KL6A 2R1FA 2DLQA 2EORA 2YTNA 2YTIA 3M99B 2YRHA 2EMIA 2ENHA 2D9HA 3MHSC 4F6NA 1YSAC 2EPZA 2EQ3A 2JPAA 4F6MA 2EN8A 2EMYA 2ENAA 2DMIA 1MEYC 2YTDA 4R2PA 3VHTB 1G2DC 1TN9A 2YSOA 2EOFA 1DGCA 1JK1A 5KL5A 4FK5C 2EOQA 1LLMC 2EM5A 2WBTA 2DGCA 1X6EA 1A1JA 1A1IA 5KL7A 2A25A 1G2FC 2YTFA 2EMXA 2MKNA 2ELYA 2EP3A 1ZAAC 2EM3A 2EN2A 2EM4A 3EPHA 1X3CA 2EOOA 4IS1C 2YRMA 2LO3A 2EOZA 2CT1A 5KL3A 2EMAA 1ZU1A 1A1HA 2EL4A 2LV2A 4R2EA 2EM7A 1RMDA 2ELZA 2EPXA 2LCEA 2BB8A 1YUIA 1AAYA 2EJ4A 2VRDA 2YTJA 2EMLA 2RPCA 4M9VC 2EE8A 2LVHA 1X5WA 1ZR9A 4R2SA 2EPUA 5KL4A 2EOEA 2EOJA 2EMGA
chains in the Genus database with same CATH superfamily
2EOHA 2EPPA 2BBGA 2CTDA 1MGTA 4O4KA 4LF5E 4LU9A 3EPJA 2EN6A 2MKDA 2MDGA 2YWQA 1I94E 2VE7C 1QNTA 2RSMA 1BB8A 4WXCA 3ZOQB 2YTGA 3EPKA 3EPLA 4HEIA 4JI2E 5LMUE 2EMFA 5A6BA 2EM0A 4O43A 4TUGA 2WBSA 2EQ1A 4IJDA 2EL6A 3J7AG 3VK6A 4ZYDA 4B3SE 5DNYA 2UXBE 4R2AA 3VYYA 2MC5A 2YSPA 2V83A 3AV0A 4R03A 4JI5E 3TQMA 4R2RA 2CSHA 5TSEA 3FIGA 2ODRC 2Q8UA 2EOMA 5A6KA 2EOIA 2EPOA 5IT9C 4DR5E 1NEIA 1WJPA 1T39A 4LFCE 2EOXA 3EQ1A 1J26A 2EMBA 1XNRE 5F3WA 2F8BA 1Z1BA 4P78A 2EOYA 4WSGA 2I13A 1UN6B 4ZYHA 4R2CA 2N8XA 5KL6A 2R1FA 2N3GA 2EORA 3ADLA 2N3HA 4P7DA 2YRHA 1IBME 2EMIA 3J7Yp 4F9CB 1DI2A 4DR7E 4K0KE 1T38A 1J5EE 3ECRA 2L2KB 5A2QC 2EOFA 1DGCA 2UXDE 2EPNA 3F6GA 1T4NA 4BMJA 4F54A 2B7TA 2L3CA 3C6MA 1XMQE 1LLMC 4KWYA 2EZ6A 1YPNA 1A1JA 2LBSB 5AC4A 5KL7A 1ZBTA 1G2FC 4DR6E 3LLHA 4WFTA 2V87A 4LTYA 4LF8E 2EPMX 4B3TE 4OX9E 1PJQA 2EOOA 3JAMC 3F6HA 1GQEA 1L4SA 1ZU1A 5LLQA 2LV2A 2L2MA 2CPNA 2LMZA 2EPKX 4F9BB 4WPYA 1BBGA 1X5WA 5KL2A 4GKJE 2EN1A 2ENCA 2EPAA 4ZYGA 3KZZA 4HTGA 2B9DA 2RSIA 2V88A 3J80C 3T1HE 2VQFE 1TF6A 4Q28A 4GKKE 1NCSA 2RS7A 4JI8E 1YUJA 2DSYA 3THOB 1F2IG 3AUZA 4BBYA 5AE1A 1X47A 1YYOA 2FGGA 2NUEA 1KJKA 2HHHE 2GHFA 5A69A 2EMCA 5AASA 1O0WA 2YU5A 2V8QB 4O5GA 4BHCA 4WYQB 3C6KA 3BBGA 2FV4B 4KHPE 1EH7A 4LF7E 2ZM6E 1T4LB 2YPNA 1KYQA 2UUBE 2EPLX 4WXDA 2GLIA 2UUCE 4F2JC 2EQ0A 3P1XA 4I8OA 1HR0E 4GZNC 1N32E 1IQSA 2FTXB 2B7VA 1DQ3A 2WZOA 2NUFA 1N36E 4JYAE 1TF3A 2J7JA 4X8WA 2EM8A 2YTOA 4R2QA 4R2DA 2EMZA 2DMYA 4JI1E 5A6BD 5LMNE 2YTNA 2YTIA 3M99B 4J8ZA 4F6NA 4LF9E 2ENAA 2F4VE 4DV0E 2YTDA 3MSWA 4DV5E 3VHTB 1TN9A 1N3GA 2JWOA 2EOQA 5ADZA 1N33E 3KWRA 1STUA 2A25A 5LL6R 5IXMB 4NXNE 3OTOE 2EM3A 1HNXE 2K7IA 2EM4A 2RS6A 2LUPB 1EKZA 1X3CA 4IS1C 3C4BA 1WRJA 2M7QA 5KL3A 2EMAA 2EL4A 4DR4E 4BC9A 1ZBQA 2EM7A 1RMDA 2BB8A 1YUIA 2EJ4A 2VRDA 2RPCA 4M9VC 2LVHA 4BC7A 1PJTA 4N4RB 1A1IA 4DV2E 2EMGA 3IWBA 1JK2A 3K6QA 1B69A 2MDRA 2MC6A 2B3TB 2UU9E 4JV5E 4LFAE 5T6JA 1A1GA 4DR2E 2UXCE 2KHXA 4X65E 3RMPA 1A1KA 2EL5A 1QU6A 2LT7A 2M9AA 1YYWA 1WHNA 2L3JA 2VQEE 3JTZA 2EM9A 3H09A 1X6FA 2KOUA 1YFHA 4AQYE 2WBUA 1SFEA 2YTQA 4X64E 4DR3E 3L00A 2ADRA 2LE2A 2EN4A 2E72A 4JI4E 2DLKA 4MLQA 4JI0E 1PDAA 4DV1E 3HQ1A 2DIXA 2NUGA 1HNZE 2DB2A 1X6HA 5FLXC 3BIDA 2EN7A 2E1MA 2L92A 2JVAA 4LF6E 1X49A 3LMLA 2EN3A 2JOBA 4DV7E 5IWAE 5IV8B 1A1LA 3C4TA 1YYKA 3T1YE 1P47A 4WSPA 1T4OA 4NHRA 4R8OA 2ODRD 3JU0A 2WCC3 2I9IA 2DLQA 5AC5A 2ENHA 2D9HA 1YSAC 3HPSA 2JPAA 4BS9A 4F6MA 1SR9A 1XNQE 2EN8A 2EMYA 4BHBA 4B3ME 2LJUA 4Q35B 2JXPA 2RQLA 4OOGC 2YSOA 4RH8A 1JK1A 5KL5A 1UILA 4ZYEA 4FK5C 2M4IA 2EM5A 2LUQA 4DV6E 2DGCA 4JI6E 3HTXA 3DJWA 2LTSA 1HNWE 3ADIA 2MKNA 5AE3A 1ZAAC 2G7HA 5A6AA 1N34E 2YRMA 4M2ZA 2LO3A 5AE2A 2CT1A 4M30A 2JY9A 1A1HA 1GTKA 4R2EA 1FKAE 2EPXA 1EH8A 2ELZA 2LCEA 2LRSA 2R76A 1RC7A 4LF4E 1XMOE 4JI7E 2YTJA 2EMLA 3ADGA 2V89A 1ZR9A 3IWCA 4M0VA 2YT4A 5KL4A 4DUZE 2EOEA 2EOJA 1FJGE 1WHQA 2EMHA 4KZSA 2VF1A 2JP9A 1A1FA 3UK3C 2EWLA 5CFFE 4DMIA 3THNA 4MLVA 2L33A 2EM6A 1WXRA 4X9JA 1BBOA 2UUAE 2NA2A 2EM2A 2EOSA 4YY3E 4B3RE 2EMKA 4X62E 2EPCA 3HXLA 2LJHA 2NABA 3VYXA 3BF2A 2HC5A 2EPRA 4LFBE 4GEQB 5BR8E 3DF6A 2L8TA 4TUIA 2PRTA 2YTEA 2HGHA 2L2NA 3MHHC 2YTPA 1IQOA 1PJSA 2EMWA 2V86A 2YU8A 1GZ6A 4DKKA 1UBDC 4X66E 2V85A 2KONA 4BCAA 2YRKA 2DRPA 3BGHA 4O24A 4DUYE 1IMUA 1UHZA 4NZVA 4DV3E 4WX9A 3OMLA 5A6JA 3IWDA 3MHSC 2EPZA 2EQ3A 4JI3E 2HJJA 2YZTA 2DMIA 1MEYC 4R2PA 2L6MA 1G2DC 2IHR1 3QG5C 1IBKE 3HPZA 1EH6A 2WBTA 4RHBB 1X6EA 3J81C 1PKPA 4DR1E 1IBLE 2K4VA 2RTXA 2JR1A 2YTFA 4DV4E 4F9AB 2EMXA 2ELYA 2EP3A 2JOXA 4L5NC 2EN2A 2GPIA 3KZYA 1YZ9A 3EPHA 4YHHE 3ADJA 2EOZA 2LTRA 2M1SA 2E5LE 4L8NA 1AAYA 2EE8A 1RQ0A 1X48A 1AH5A 4NXME 2JYAA 2H36X 4R2SA 2EPUA
chains in the Genus database with same CATH topology
2EOHA 1JK2A 2EPPA 5KL2A 1B69A 2CTDA 2EMHA 2EN1A 2ENCA 2EPAA 2JP9A 1A1FA 3EPJA 2RSIA 2EN6A 2MKDA 2MDGA 3UK3C 1TF6A 1A1GA 1NCSA 1YUJA 1BB8A 1A1KA 2EL5A 2EM6A 1F2IG 2YTGA 2LT7A 3EPKA 3EPLA 4X9JA 1BBOA 2M9AA 2EMFA 2EM0A 2EM2A 2EOSA 2EMKA 2EPCA 2WBSA 2EQ1A 4IJDA 2EL6A 1KJKA 2EM9A 1X6FA 2GHFA 2NABA 2EMCA 4R2AA 2YSPA 2EPRA 2WBUA 2YU5A 4R2RA 2YTQA 2CSHA 2ADRA 2PRTA 2EN4A 2E72A 2YTEA 2HGHA 2DLKA 3MHHC 2YTPA 2EOMA 2GLIA 2EMWA 2YU8A 1X6HA 2EOIA 1UBDC 4F2JC 2EQ0A 4GZNC 2EN7A 2YRKA 2DRPA 1WJPA 2EN3A 2EOXA 1A1LA 2EMBA 1TF3A 1Z1BA 1P47A 2J7JA 2EOYA 4WSGA 2I13A 1UN6B 2EM8A 2YTOA 4R2QA 2WCC3 4R2DA 2EMZA 4R2CA 5KL6A 2R1FA 2DLQA 2EORA 2YTNA 2YTIA 3M99B 2YRHA 2EMIA 2ENHA 2D9HA 3MHSC 4F6NA 1YSAC 2EPZA 2EQ3A 2JPAA 4F6MA 2EN8A 2EMYA 2ENAA 2DMIA 1MEYC 2YTDA 4R2PA 3VHTB 1G2DC 1TN9A 2YSOA 2EOFA 1DGCA 1JK1A 5KL5A 4FK5C 2EOQA 1LLMC 2EM5A 2WBTA 2DGCA 1X6EA 1A1JA 1A1IA 5KL7A 2A25A 1G2FC 2YTFA 2EMXA 2MKNA 2ELYA 2EP3A 1ZAAC 2EM3A 2EN2A 2EM4A 3EPHA 1X3CA 2EOOA 4IS1C 2YRMA 2LO3A 2EOZA 2CT1A 5KL3A 2EMAA 1ZU1A 1A1HA 2EL4A 2LV2A 4R2EA 2EM7A 1RMDA 2ELZA 2EPXA 2LCEA 2BB8A 1YUIA 1AAYA 2EJ4A 2VRDA 2YTJA 2EMLA 2RPCA 4M9VC 2EE8A 2LVHA 1X5WA 1ZR9A 4R2SA 2EPUA 5KL4A 2EOEA 2EOJA 2EMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOH A;  1JK2 A;  2EPP A;  5KL2 A;  1B69 A;  2CTD A;  2EMH A;  2EN1 A;  2ENC A;  2EPA A;  2JP9 A;  1A1F A;  3EPJ A;  2RSI A;  2EN6 A;  2MKD A;  2MDG A;  3UK3 C;  1TF6 A;  1A1G A;  1NCS A;  1YUJ A;  1BB8 A;  1A1K A;  2EL5 A;  2EM6 A;  1F2I G;  2YTG A;  2LT7 A;  3EPK A;  3EPL A;  4X9J A;  1BBO A;  2M9A A;  2EMF A;  2EM0 A;  2EM2 A;  2EOS A;  2EMK A;  2EPC A;  2WBS A;  2EQ1 A;  4IJD A;  2EL6 A;  1KJK A;  2EM9 A;  1X6F A;  2GHF A;  2NAB A;  2EMC A;  4R2A A;  2YSP A;  2EPR A;  2WBU A;  2YU5 A;  4R2R A;  2YTQ A;  2CSH A;  2ADR A;  2PRT A;  2EN4 A;  2E72 A;  2YTE A;  2HGH A;  2DLK A;  3MHH C;  2YTP A;  2EOM A;  2GLI A;  2EMW A;  2YU8 A;  1X6H A;  2EOI A;  1UBD C;  4F2J C;  2EQ0 A;  4GZN C;  2EN7 A;  2YRK A;  2DRP A;  1WJP A;  2EN3 A;  2EOX A;  1A1L A;  2EMB A;  1TF3 A;  1Z1B A;  1P47 A;  2J7J A;  2EOY A;  4WSG A;  2I13 A;  1UN6 B;  2EM8 A;  2YTO A;  4R2Q A;  2WCC 3;  4R2D A;  2EMZ A;  4R2C A;  5KL6 A;  2R1F A;  2DLQ A;  2EOR A;  2YTN A;  2YTI A;  3M99 B;  2YRH A;  2EMI A;  2ENH A;  2D9H A;  3MHS C;  4F6N A;  1YSA C;  2EPZ A;  2EQ3 A;  2JPA A;  4F6M A;  2EN8 A;  2EMY A;  2ENA A;  2DMI A;  1MEY C;  2YTD A;  4R2P A;  3VHT B;  1G2D C;  1TN9 A;  2YSO A;  2EOF A;  1DGC A;  1JK1 A;  5KL5 A;  4FK5 C;  2EOQ A;  1LLM C;  2EM5 A;  2WBT A;  2DGC A;  1X6E A;  1A1J A;  1A1I A;  5KL7 A;  2A25 A;  1G2F C;  2YTF A;  2EMX A;  2MKN A;  2ELY A;  2EP3 A;  1ZAA C;  2EM3 A;  2EN2 A;  2EM4 A;  3EPH A;  1X3C A;  2EOO A;  4IS1 C;  2YRM A;  2LO3 A;  2EOZ A;  2CT1 A;  5KL3 A;  2EMA A;  1ZU1 A;  1A1H A;  2EL4 A;  2LV2 A;  4R2E A;  2EM7 A;  1RMD A;  2ELZ A;  2EPX A;  2LCE A;  2BB8 A;  1YUI A;  1AAY A;  2EJ4 A;  2VRD A;  2YTJ A;  2EML A;  2RPC A;  4M9V C;  2EE8 A;  2LVH A;  1X5W A;  1ZR9 A;  4R2S A;  2EPU A;  5KL4 A;  2EOE A;  2EOJ A;  2EMG A; 
#chains in the Genus database with same CATH topology
 2EOH A;  2EPP A;  2BBG A;  2CTD A;  1MGT A;  4O4K A;  4LF5 E;  4LU9 A;  3EPJ A;  2EN6 A;  2MKD A;  2MDG A;  2YWQ A;  1I94 E;  2VE7 C;  1QNT A;  2RSM A;  1BB8 A;  4WXC A;  3ZOQ B;  2YTG A;  3EPK A;  3EPL A;  4HEI A;  4JI2 E;  5LMU E;  2EMF A;  5A6B A;  2EM0 A;  4O43 A;  4TUG A;  2WBS A;  2EQ1 A;  4IJD A;  2EL6 A;  3J7A G;  3VK6 A;  4ZYD A;  4B3S E;  5DNY A;  2UXB E;  4R2A A;  3VYY A;  2MC5 A;  2YSP A;  2V83 A;  3AV0 A;  4R03 A;  4JI5 E;  3TQM A;  4R2R A;  2CSH A;  5TSE A;  3FIG A;  2ODR C;  2Q8U A;  2EOM A;  5A6K A;  2EOI A;  2EPO A;  5IT9 C;  4DR5 E;  1NEI A;  1WJP A;  1T39 A;  4LFC E;  2EOX A;  3EQ1 A;  1J26 A;  2EMB A;  1XNR E;  5F3W A;  2F8B A;  1Z1B A;  4P78 A;  2EOY A;  4WSG A;  2I13 A;  1UN6 B;  4ZYH A;  4R2C A;  2N8X A;  5KL6 A;  2R1F A;  2N3G A;  2EOR A;  3ADL A;  2N3H A;  4P7D A;  2YRH A;  1IBM E;  2EMI A;  3J7Y p;  4F9C B;  1DI2 A;  4DR7 E;  4K0K E;  1T38 A;  1J5E E;  3ECR A;  2L2K B;  5A2Q C;  2EOF A;  1DGC A;  2UXD E;  2EPN A;  3F6G A;  1T4N A;  4BMJ A;  4F54 A;  2B7T A;  2L3C A;  3C6M A;  1XMQ E;  1LLM C;  4KWY A;  2EZ6 A;  1YPN A;  1A1J A;  2LBS B;  5AC4 A;  5KL7 A;  1ZBT A;  1G2F C;  4DR6 E;  3LLH A;  4WFT A;  2V87 A;  4LTY A;  4LF8 E;  2EPM X;  4B3T E;  4OX9 E;  1PJQ A;  2EOO A;  3JAM C;  3F6H A;  1GQE A;  1L4S A;  1ZU1 A;  5LLQ A;  2LV2 A;  2L2M A;  2CPN A;  2LMZ A;  2EPK X;  4F9B B;  4WPY A;  1BBG A;  1X5W A;  5KL2 A;  4GKJ E;  2EN1 A;  2ENC A;  2EPA A;  4ZYG A;  3KZZ A;  4HTG A;  2B9D A;  2RSI A;  2V88 A;  3J80 C;  3T1H E;  2VQF E;  1TF6 A;  4Q28 A;  4GKK E;  1NCS A;  2RS7 A;  4JI8 E;  1YUJ A;  2DSY A;  3THO B;  1F2I G;  3AUZ A;  4BBY A;  5AE1 A;  1X47 A;  1YYO A;  2FGG A;  2NUE A;  1KJK A;  2HHH E;  2GHF A;  5A69 A;  2EMC A;  5AAS A;  1O0W A;  2YU5 A;  2V8Q B;  4O5G A;  4BHC A;  4WYQ B;  3C6K A;  3BBG A;  2FV4 B;  4KHP E;  1EH7 A;  4LF7 E;  2ZM6 E;  1T4L B;  2YPN A;  1KYQ A;  2UUB E;  2EPL X;  4WXD A;  2GLI A;  2UUC E;  4F2J C;  2EQ0 A;  3P1X A;  4I8O A;  1HR0 E;  4GZN C;  1N32 E;  1IQS A;  2FTX B;  2B7V A;  1DQ3 A;  2WZO A;  2NUF A;  1N36 E;  4JYA E;  1TF3 A;  2J7J A;  4X8W A;  2EM8 A;  2YTO A;  4R2Q A;  4R2D A;  2EMZ A;  2DMY A;  4JI1 E;  5A6B D;  5LMN E;  2YTN A;  2YTI A;  3M99 B;  4J8Z A;  4F6N A;  4LF9 E;  2ENA A;  2F4V E;  4DV0 E;  2YTD A;  3MSW A;  4DV5 E;  3VHT B;  1TN9 A;  1N3G A;  2JWO A;  2EOQ A;  5ADZ A;  1N33 E;  3KWR A;  1STU A;  2A25 A;  5LL6 R;  5IXM B;  4NXN E;  3OTO E;  2EM3 A;  1HNX E;  2K7I A;  2EM4 A;  2RS6 A;  2LUP B;  1EKZ A;  1X3C A;  4IS1 C;  3C4B A;  1WRJ A;  2M7Q A;  5KL3 A;  2EMA A;  2EL4 A;  4DR4 E;  4BC9 A;  1ZBQ A;  2EM7 A;  1RMD A;  2BB8 A;  1YUI A;  2EJ4 A;  2VRD A;  2RPC A;  4M9V C;  2LVH A;  4BC7 A;  1PJT A;  4N4R B;  1A1I A;  4DV2 E;  2EMG A;  3IWB A;  1JK2 A;  3K6Q A;  1B69 A;  2MDR A;  2MC6 A;  2B3T B;  2UU9 E;  4JV5 E;  4LFA E;  5T6J A;  1A1G A;  4DR2 E;  2UXC E;  2KHX A;  4X65 E;  3RMP A;  1A1K A;  2EL5 A;  1QU6 A;  2LT7 A;  2M9A A;  1YYW A;  1WHN A;  2L3J A;  2VQE E;  3JTZ A;  2EM9 A;  3H09 A;  1X6F A;  2KOU A;  1YFH A;  4AQY E;  2WBU A;  1SFE A;  2YTQ A;  4X64 E;  4DR3 E;  3L00 A;  2ADR A;  2LE2 A;  2EN4 A;  2E72 A;  4JI4 E;  2DLK A;  4MLQ A;  4JI0 E;  1PDA A;  4DV1 E;  3HQ1 A;  2DIX A;  2NUG A;  1HNZ E;  2DB2 A;  1X6H A;  5FLX C;  3BID A;  2EN7 A;  2E1M A;  2L92 A;  2JVA A;  4LF6 E;  1X49 A;  3LML A;  2EN3 A;  2JOB A;  4DV7 E;  5IWA E;  5IV8 B;  1A1L A;  3C4T A;  1YYK A;  3T1Y E;  1P47 A;  4WSP A;  1T4O A;  4NHR A;  4R8O A;  2ODR D;  3JU0 A;  2WCC 3;  2I9I A;  2DLQ A;  5AC5 A;  2ENH A;  2D9H A;  1YSA C;  3HPS A;  2JPA A;  4BS9 A;  4F6M A;  1SR9 A;  1XNQ E;  2EN8 A;  2EMY A;  4BHB A;  4B3M E;  2LJU A;  4Q35 B;  2JXP A;  2RQL A;  4OOG C;  2YSO A;  4RH8 A;  1JK1 A;  5KL5 A;  1UIL A;  4ZYE A;  4FK5 C;  2M4I A;  2EM5 A;  2LUQ A;  4DV6 E;  2DGC A;  4JI6 E;  3HTX A;  3DJW A;  2LTS A;  1HNW E;  3ADI A;  2MKN A;  5AE3 A;  1ZAA C;  2G7H A;  5A6A A;  1N34 E;  2YRM A;  4M2Z A;  2LO3 A;  5AE2 A;  2CT1 A;  4M30 A;  2JY9 A;  1A1H A;  1GTK A;  4R2E A;  1FKA E;  2EPX A;  1EH8 A;  2ELZ A;  2LCE A;  2LRS A;  2R76 A;  1RC7 A;  4LF4 E;  1XMO E;  4JI7 E;  2YTJ A;  2EML A;  3ADG A;  2V89 A;  1ZR9 A;  3IWC A;  4M0V A;  2YT4 A;  5KL4 A;  4DUZ E;  2EOE A;  2EOJ A;  1FJG E;  1WHQ A;  2EMH A;  4KZS A;  2VF1 A;  2JP9 A;  1A1F A;  3UK3 C;  2EWL A;  5CFF E;  4DMI A;  3THN A;  4MLV A;  2L33 A;  2EM6 A;  1WXR A;  4X9J A;  1BBO A;  2UUA E;  2NA2 A;  2EM2 A;  2EOS A;  4YY3 E;  4B3R E;  2EMK A;  4X62 E;  2EPC A;  3HXL A;  2LJH A;  2NAB A;  3VYX A;  3BF2 A;  2HC5 A;  2EPR A;  4LFB E;  4GEQ B;  5BR8 E;  3DF6 A;  2L8T A;  4TUI A;  2PRT A;  2YTE A;  2HGH A;  2L2N A;  3MHH C;  2YTP A;  1IQO A;  1PJS A;  2EMW A;  2V86 A;  2YU8 A;  1GZ6 A;  4DKK A;  1UBD C;  4X66 E;  2V85 A;  2KON A;  4BCA A;  2YRK A;  2DRP A;  3BGH A;  4O24 A;  4DUY E;  1IMU A;  1UHZ A;  4NZV A;  4DV3 E;  4WX9 A;  3OML A;  5A6J A;  3IWD A;  3MHS C;  2EPZ A;  2EQ3 A;  4JI3 E;  2HJJ A;  2YZT A;  2DMI A;  1MEY C;  4R2P A;  2L6M A;  1G2D C;  2IHR 1;  3QG5 C;  1IBK E;  3HPZ A;  1EH6 A;  2WBT A;  4RHB B;  1X6E A;  3J81 C;  1PKP A;  4DR1 E;  1IBL E;  2K4V A;  2RTX A;  2JR1 A;  2YTF A;  4DV4 E;  4F9A B;  2EMX A;  2ELY A;  2EP3 A;  2JOX A;  4L5N C;  2EN2 A;  2GPI A;  3KZY A;  1YZ9 A;  3EPH A;  4YHH E;  3ADJ A;  2EOZ A;  2LTR A;  2M1S A;  2E5L E;  4L8N A;  1AAY A;  2EE8 A;  1RQ0 A;  1X48 A;  1AH5 A;  4NXM E;  2JYA A;  2H36 X;  4R2S A;  2EPU A; 
#chains in the Genus database with same CATH homology
 2EOH A;  1JK2 A;  2EPP A;  5KL2 A;  1B69 A;  2CTD A;  2EMH A;  2EN1 A;  2ENC A;  2EPA A;  2JP9 A;  1A1F A;  3EPJ A;  2RSI A;  2EN6 A;  2MKD A;  2MDG A;  3UK3 C;  1TF6 A;  1A1G A;  1NCS A;  1YUJ A;  1BB8 A;  1A1K A;  2EL5 A;  2EM6 A;  1F2I G;  2YTG A;  2LT7 A;  3EPK A;  3EPL A;  4X9J A;  1BBO A;  2M9A A;  2EMF A;  2EM0 A;  2EM2 A;  2EOS A;  2EMK A;  2EPC A;  2WBS A;  2EQ1 A;  4IJD A;  2EL6 A;  1KJK A;  2EM9 A;  1X6F A;  2GHF A;  2NAB A;  2EMC A;  4R2A A;  2YSP A;  2EPR A;  2WBU A;  2YU5 A;  4R2R A;  2YTQ A;  2CSH A;  2ADR A;  2PRT A;  2EN4 A;  2E72 A;  2YTE A;  2HGH A;  2DLK A;  3MHH C;  2YTP A;  2EOM A;  2GLI A;  2EMW A;  2YU8 A;  1X6H A;  2EOI A;  1UBD C;  4F2J C;  2EQ0 A;  4GZN C;  2EN7 A;  2YRK A;  2DRP A;  1WJP A;  2EN3 A;  2EOX A;  1A1L A;  2EMB A;  1TF3 A;  1Z1B A;  1P47 A;  2J7J A;  2EOY A;  4WSG A;  2I13 A;  1UN6 B;  2EM8 A;  2YTO A;  4R2Q A;  2WCC 3;  4R2D A;  2EMZ A;  4R2C A;  5KL6 A;  2R1F A;  2DLQ A;  2EOR A;  2YTN A;  2YTI A;  3M99 B;  2YRH A;  2EMI A;  2ENH A;  2D9H A;  3MHS C;  4F6N A;  1YSA C;  2EPZ A;  2EQ3 A;  2JPA A;  4F6M A;  2EN8 A;  2EMY A;  2ENA A;  2DMI A;  1MEY C;  2YTD A;  4R2P A;  3VHT B;  1G2D C;  1TN9 A;  2YSO A;  2EOF A;  1DGC A;  1JK1 A;  5KL5 A;  4FK5 C;  2EOQ A;  1LLM C;  2EM5 A;  2WBT A;  2DGC A;  1X6E A;  1A1J A;  1A1I A;  5KL7 A;  2A25 A;  1G2F C;  2YTF A;  2EMX A;  2MKN A;  2ELY A;  2EP3 A;  1ZAA C;  2EM3 A;  2EN2 A;  2EM4 A;  3EPH A;  1X3C A;  2EOO A;  4IS1 C;  2YRM A;  2LO3 A;  2EOZ A;  2CT1 A;  5KL3 A;  2EMA A;  1ZU1 A;  1A1H A;  2EL4 A;  2LV2 A;  4R2E A;  2EM7 A;  1RMD A;  2ELZ A;  2EPX A;  2LCE A;  2BB8 A;  1YUI A;  1AAY A;  2EJ4 A;  2VRD A;  2YTJ A;  2EML A;  2RPC A;  4M9V C;  2EE8 A;  2LVH A;  1X5W A;  1ZR9 A;  4R2S A;  2EPU A;  5KL4 A;  2EOE A;  2EOJ A;  2EMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...