2EM3A

Solution structure of the c2h2 type zinc finger (region 640-672) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECKVCSKAFTQKAHLAQHQKTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 640-672) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em3A00
2EQ1A 2EMFA 2ELZA 2YTPA 4R2DA 2EN3A 4F6NA 2EL5A 4R2EA 1KJKA 2YTDA 2DLKA 2EOZA 2YTFA 2YTIA 4X9JA 2YTQA 2CSHA 2ENCA 4R2AA 4GZNC 2EMWA 2EMAA 2WBSA 4IS1C 2EE8A 2EPAA 1ZU1A 2EPPA 3EPKA 2CTDA 2NABA 2YTGA 2DMIA 2LCEA 2YRHA 2YSPA 2LT7A 2EQ3A 2EM7A 1UN6B 1A1JA 2EL6A 2YRKA 1DGCA 2EQ0A 2EPUA 2YTOA 1NCSA 1UBDC 1P47A 2EMKA 1BBOA 2EL4A 2EMLA 2MDGA 1A1LA 2EN1A 2EOSA 4R2SA 1AAYA 2YU8A 1G2FC 2EM9A 1A1IA 3EPLA 1TN9A 1A1KA 2RSIA 2EMYA 2JP9A 2JPAA 2EOYA 1YUIA 5KL4A 2WBTA 4IJDA 2R1FA 2LV2A 5KL2A 2EM0A 2EOMA 1YSAC 2EMCA 1X3CA 4FK5C 4R2PA 2CT1A 2EPXA 2RPCA 1YUJA 2EMZA 2EOJA 2LVHA 2EM8A 2WBUA 2EOXA 5KL7A 2WCC3 1A1FA 2LO3A 2EPRA 2EM6A 1WJPA 2EPCA 2A25A 1A1HA 2DRPA 2EOEA 2EM3A 2EJ4A 3MHSC 4R2RA 1JK1A 5KL3A 1RMDA 4WSGA 2YSOA 2EPZA 4F2JC 2EM2A 2YRMA 5KL5A 1MEYC 1TF3A 2M9AA 2E72A 2YTJA 2GHFA 3EPJA 2DGCA 2EMHA 2EN4A 2EM5A 3UK3C 2EOFA 3MHHC 2EN8A 2EMGA 2MKDA 2EOIA 2VRDA 5KL6A 4R2QA 2EOOA 2EMXA 1JK2A 3M99B 2I13A 2ELYA 2EOQA 4R2CA 1A1GA 2EORA 2ADRA 2EN2A 1ZR9A 4F6MA 2EN7A 1B69A 2EN6A 2BB8A 2HGHA 2ENAA 1X6HA 2MKNA 1X5WA 1X6FA 4M9VC 2J7JA 2EM4A 1BB8A 2PRTA 1X6EA 2YU5A 2ENHA 2GLIA 3EPHA 1Z1BA 2YTEA 1G2DC 2D9HA 2DLQA 1ZAAC 1TF6A 2EP3A 2YTNA 1F2IG 2EOHA 2EMIA 1LLMC 3VHTB 2EMBA
chains in the Genus database with same CATH superfamily
2EQ1A 2EMFA 2ELZA 4X62E 2EN3A 2EL5A 1KJKA 3QG5C 2YTDA 4R03A 2DLKA 2YTIA 2RS7A 2YTFA 1I94E 2YTQA 2CSHA 1PDAA 1FKAE 2FV4B 4KWYA 2EPNA 3BIDA 3ADJA 5ADZA 2LCEA 2FTXB 1T39A 2YRHA 4DV1E 1UN6B 1PKPA 2EL6A 4P7DA 1DGCA 2EQ0A 4R8OA 2L2KB 2F4VE 2LJUA 1HNZE 2UUCE 1BBOA 2V89A 2MDGA 3HQ1A 2EN1A 4BC9A 4F9CB 2RSIA 2ODRD 2JP9A 3C4TA 2JYAA 1AH5A 4IJDA 3AUZA 5F3WA 5T6JA 2HJJA 5KL2A 1IBME 4DR7E 2EZ6A 2LJHA 2VQFE 3J7Yp 4ZYDA 4LFBE 2CT1A 4X64E 2RPCA 4LU9A 3P1XA 5KL7A 4GKKE 2CPNA 2ODRC 2EPRA 2UXDE 4WFTA 1J26A 1WHNA 4DR3E 3HPZA 2DRPA 2UXCE 3HXLA 2V8QB 3VYXA 1PJSA 1RMDA 2YSOA 2EPZA 4LFCE 2L2MA 5KL5A 2YTJA 4NZVA 3EPJA 3IWCA 2L8TA 3EQ1A 4WX9A 2EOFA 2IHR1 2EN8A 3J81C 4GEQB 5KL6A 4YY3E 4Q28A 4X65E 2V85A 1IQOA 2DB2A 4AQYE 2EMXA 3ECRA 4R2CA 1X49A 2JR1A 2ADRA 4P78A 4ZYEA 2EN2A 2NA2A 2EPKX 3H09A 3VK6A 5A6BA 1B69A 2EN6A 2ENAA 4I8OA 1X5WA 4ZYGA 5AE3A 4M9VC 1BB8A 1X6EA 5A6JA 2GLIA 2B7VA 5LLQA 5LMNE 2Q8UA 4B3ME 5AE2A 2EP3A 4DR6E 2EMBA 1T4OA 3JAMC 2YT4A 4DUZE 4F6NA 4R2EA 2M1SA 1HNWE 4JI0E 2EOZA 2L33A 4LF4E 1ZBQA 2WBSA 1IBKE 3EPKA 2JOBA 4WXCA 2YTGA 2EPMX 2DMIA 5AASA 5AC4A 1IMUA 3F6GA 2YRKA 2YTOA 1X48A 1UBDC 1N34E 3J80C 2EMLA 2JXPA 3JTZA 1A1LA 4NXNE 3DF6A 2EM9A 1XMOE 3EPLA 2FGGA 1A1KA 2JPAA 2V86A 4DKKA 1YUIA 2WBTA 3THNA 4LF9E 2LV2A 3T1YE 2RSMA 3ADLA 1X3CA 5IV8B 4FK5C 4F9BB 4R2PA 2UXBE 4L8NA 4K0KE 2I9IA 2EMZA 3ZOQB 4X8WA 2MDRA 2F8BA 4DV2E 1WHQA 2UUBE 3JU0A 1L4SA 2WBUA 5A6AA 2LO3A 1FJGE 2LE2A 5DNYA 5LMUE 2EM3A 2EJ4A 4R2RA 5KL3A 1YPNA 2LMZA 2EM2A 2L2NA 3THOB 2DSYA 1YZ9A 2E72A 4O5GA 3ADGA 2DGCA 1O0WA 2LTRA 3K6QA 1N33E 4O43A 3MHHC 3ADIA 1QNTA 2K7IA 4R2QA 1YYOA 1YYWA 4M2ZA 1XMQE 2KHXA 1A1GA 3HTXA 4M30A 2WZOA 3DJWA 1SR9A 2M7QA 2JVAA 2BB8A 3OMLA 1XNRE 4OOGC 3HPSA 1T38A 4JI1E 4DMIA 2YTEA 4BHBA 2RTXA 1TF6A 5IXMB 2K4VA 2LUQA 2L6MA 1T4NA 1EH8A 2YTPA 4NHRA 4R2DA 5A6BD 5LL6R 4RHBB 4BMJA 4X9JA 3MSWA 4O24A 4MLQA 2ENCA 2RQLA 1HNXE 2YZTA 2EMAA 5BR8E 4IS1C 2EPAA 4LTYA 3IWBA 1PJQA 1HR0E 4DR4E 2EQ3A 1A1JA 3VYYA 2EPUA 1NCSA 4JI5E 2EMKA 4JYAE 2LUPB 2EL4A 2EOSA 4R2SA 2VQEE 1AAYA 1G2FC 4BCAA 2YWQA 4WYQB 4WXDA 2EOYA 4JV5E 5KL4A 1QU6A 5IWAE 2V88A 4GKJE 2EM0A 1YSAC 2MC6A 2N3GA 4DUYE 1PJTA 2EWLA 2KOUA 1MGTA 2EPXA 5IT9C 2EOJA 2LVHA 3TQMA 1BBGA 2EM8A 3KZZA 1A1FA 2EOXA 2WCC3 2HC5A 3LLHA 2EM6A 1WJPA 2EPCA 3BF2A 4L5NC 4LF5E 5A2QC 1A1HA 1ZBTA 1KYQA 2EOEA 1JK1A 3MHSC 1J5EE 4BHCA 4LF7E 1MEYC 1WXRA 3L00A 2GHFA 2EM5A 2GPIA 4TUIA 4JI3E 1NEIA 4DV4E 2EMGA 2MKDA 4TUGA 2VRDA 1UILA 4LFAE 5A69A 2LBSB 2EOOA 4WSPA 4MLVA 2G7HA 4HEIA 1GQEA 2UU9E 3M99B 2ELYA 2LTSA 4JI8E 2ZM6E 2NUFA 4F9AB 2EPLX 4F54A 1RC7A 2B3TB 2MKNA 1X6FA 4B3SE 1YYKA 2J7JA 2EM4A 2PRTA 1IBLE 2YU5A 3J7AG 1Z1BA 2NUEA 2YTNA 4OX9E 3IWDA 1F2IG 3VHTB 1ZR9A 4N4RB 2N8XA 4JI6E 4DV5E 1YFHA 2RS6A 1IQSA 4R2AA 4GZNC 2EMWA 2EE8A 1ZU1A 2EPPA 2CTDA 2NABA 2JWOA 3BBGA 3KWRA 3C6KA 2V83A 1EH6A 5CFFE 2YSPA 2LT7A 2EM7A 3OTOE 4DR1E 1WRJA 3T1HE 1P47A 2BBGA 4B3RE 1STUA 4KZSA 5AE1A 2HHHE 2YU8A 1A1IA 3AV0A 1TN9A 2M4IA 2EMYA 5AC5A 1T4LB 1UHZA 3F6HA 2L92A 4BBYA 2YPNA 2EOMA 2EMCA 3C6MA 4KHPE 2KONA 1N32E 2MC5A 4X66E 1YUJA 2R76A 5TSEA 1DI2A 4LF6E 4ZYHA 2NUGA 2EPOA 1N3GA 4JI7E 4B3TE 4M0VA 4DV7E 4JI4E 2A25A 2DMYA 2LRSA 4WSGA 4NXME 4F2JC 2B9DA 2YRMA 1GTKA 2DIXA 1TF3A 1RQ0A 3KZYA 2M9AA 2E1MA 4DV6E 2L3JA 2EMHA 2EN4A 4YHHE 3FIGA 4DR5E 4LF8E 3UK3C 1X47A 2H36X 1N36E 2EOIA 1EH7A 4JI2E 3LMLA 2UUAE 4J8ZA 1GZ6A 4HTGA 1JK2A 5A6KA 2L3CA 4DV3E 1EKZA 2I13A 2EOQA 4BS9A 1DQ3A 2N3HA 4RH8A 2EORA 4DV0E 4F6MA 3RMPA 2EN7A 4O4KA 2VE7C 2HGHA 1X6HA 2JY9A 2V87A 1SFEA 2JOXA 5FLXC 2ENHA 3EPHA 4DR2E 2B7TA 2E5LE 2VF1A 4BC7A 4Q35B 1G2DC 2D9HA 4WPYA 3BGHA 2DLQA 1ZAAC 1XNQE 2EOHA 2EMIA 1LLMC 3C4BA 2R1FA
chains in the Genus database with same CATH topology
2EQ1A 2EMFA 2ELZA 2YTPA 4R2DA 2EN3A 4F6NA 2EL5A 4R2EA 1KJKA 2YTDA 2DLKA 2EOZA 2YTFA 2YTIA 4X9JA 2YTQA 2CSHA 2ENCA 4R2AA 4GZNC 2EMWA 2EMAA 2WBSA 4IS1C 2EE8A 2EPAA 1ZU1A 2EPPA 3EPKA 2CTDA 2NABA 2YTGA 2DMIA 2LCEA 2YRHA 2YSPA 2LT7A 2EQ3A 2EM7A 1UN6B 1A1JA 2EL6A 2YRKA 1DGCA 2EQ0A 2EPUA 2YTOA 1NCSA 1UBDC 1P47A 2EMKA 1BBOA 2EL4A 2EMLA 2MDGA 1A1LA 2EN1A 2EOSA 4R2SA 1AAYA 2YU8A 1G2FC 2EM9A 1A1IA 3EPLA 1TN9A 1A1KA 2RSIA 2EMYA 2JP9A 2JPAA 2EOYA 1YUIA 5KL4A 2WBTA 4IJDA 2R1FA 2LV2A 5KL2A 2EM0A 2EOMA 1YSAC 2EMCA 1X3CA 4FK5C 4R2PA 2CT1A 2EPXA 2RPCA 1YUJA 2EMZA 2EOJA 2LVHA 2EM8A 2WBUA 2EOXA 5KL7A 2WCC3 1A1FA 2LO3A 2EPRA 2EM6A 1WJPA 2EPCA 2A25A 1A1HA 2DRPA 2EOEA 2EM3A 2EJ4A 3MHSC 4R2RA 1JK1A 5KL3A 1RMDA 4WSGA 2YSOA 2EPZA 4F2JC 2EM2A 2YRMA 5KL5A 1MEYC 1TF3A 2M9AA 2E72A 2YTJA 2GHFA 3EPJA 2DGCA 2EMHA 2EN4A 2EM5A 3UK3C 2EOFA 3MHHC 2EN8A 2EMGA 2MKDA 2EOIA 2VRDA 5KL6A 4R2QA 2EOOA 2EMXA 1JK2A 3M99B 2I13A 2ELYA 2EOQA 4R2CA 1A1GA 2EORA 2ADRA 2EN2A 1ZR9A 4F6MA 2EN7A 1B69A 2EN6A 2BB8A 2HGHA 2ENAA 1X6HA 2MKNA 1X5WA 1X6FA 4M9VC 2J7JA 2EM4A 1BB8A 2PRTA 1X6EA 2YU5A 2ENHA 2GLIA 3EPHA 1Z1BA 2YTEA 1G2DC 2D9HA 2DLQA 1ZAAC 1TF6A 2EP3A 2YTNA 1F2IG 2EOHA 2EMIA 1LLMC 3VHTB 2EMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ1 A;  2EMF A;  2ELZ A;  2YTP A;  4R2D A;  2EN3 A;  4F6N A;  2EL5 A;  4R2E A;  1KJK A;  2YTD A;  2DLK A;  2EOZ A;  2YTF A;  2YTI A;  4X9J A;  2YTQ A;  2CSH A;  2ENC A;  4R2A A;  4GZN C;  2EMW A;  2EMA A;  2WBS A;  4IS1 C;  2EE8 A;  2EPA A;  1ZU1 A;  2EPP A;  3EPK A;  2CTD A;  2NAB A;  2YTG A;  2DMI A;  2LCE A;  2YRH A;  2YSP A;  2LT7 A;  2EQ3 A;  2EM7 A;  1UN6 B;  1A1J A;  2EL6 A;  2YRK A;  1DGC A;  2EQ0 A;  2EPU A;  2YTO A;  1NCS A;  1UBD C;  1P47 A;  2EMK A;  1BBO A;  2EL4 A;  2EML A;  2MDG A;  1A1L A;  2EN1 A;  2EOS A;  4R2S A;  1AAY A;  2YU8 A;  1G2F C;  2EM9 A;  1A1I A;  3EPL A;  1TN9 A;  1A1K A;  2RSI A;  2EMY A;  2JP9 A;  2JPA A;  2EOY A;  1YUI A;  5KL4 A;  2WBT A;  4IJD A;  2R1F A;  2LV2 A;  5KL2 A;  2EM0 A;  2EOM A;  1YSA C;  2EMC A;  1X3C A;  4FK5 C;  4R2P A;  2CT1 A;  2EPX A;  2RPC A;  1YUJ A;  2EMZ A;  2EOJ A;  2LVH A;  2EM8 A;  2WBU A;  2EOX A;  5KL7 A;  2WCC 3;  1A1F A;  2LO3 A;  2EPR A;  2EM6 A;  1WJP A;  2EPC A;  2A25 A;  1A1H A;  2DRP A;  2EOE A;  2EM3 A;  2EJ4 A;  3MHS C;  4R2R A;  1JK1 A;  5KL3 A;  1RMD A;  4WSG A;  2YSO A;  2EPZ A;  4F2J C;  2EM2 A;  2YRM A;  5KL5 A;  1MEY C;  1TF3 A;  2M9A A;  2E72 A;  2YTJ A;  2GHF A;  3EPJ A;  2DGC A;  2EMH A;  2EN4 A;  2EM5 A;  3UK3 C;  2EOF A;  3MHH C;  2EN8 A;  2EMG A;  2MKD A;  2EOI A;  2VRD A;  5KL6 A;  4R2Q A;  2EOO A;  2EMX A;  1JK2 A;  3M99 B;  2I13 A;  2ELY A;  2EOQ A;  4R2C A;  1A1G A;  2EOR A;  2ADR A;  2EN2 A;  1ZR9 A;  4F6M A;  2EN7 A;  1B69 A;  2EN6 A;  2BB8 A;  2HGH A;  2ENA A;  1X6H A;  2MKN A;  1X5W A;  1X6F A;  4M9V C;  2J7J A;  2EM4 A;  1BB8 A;  2PRT A;  1X6E A;  2YU5 A;  2ENH A;  2GLI A;  3EPH A;  1Z1B A;  2YTE A;  1G2D C;  2D9H A;  2DLQ A;  1ZAA C;  1TF6 A;  2EP3 A;  2YTN A;  1F2I G;  2EOH A;  2EMI A;  1LLM C;  3VHT B;  2EMB A; 
#chains in the Genus database with same CATH topology
 2EQ1 A;  2EMF A;  2ELZ A;  4X62 E;  2EN3 A;  2EL5 A;  1KJK A;  3QG5 C;  2YTD A;  4R03 A;  2DLK A;  2YTI A;  2RS7 A;  2YTF A;  1I94 E;  2YTQ A;  2CSH A;  1PDA A;  1FKA E;  2FV4 B;  4KWY A;  2EPN A;  3BID A;  3ADJ A;  5ADZ A;  2LCE A;  2FTX B;  1T39 A;  2YRH A;  4DV1 E;  1UN6 B;  1PKP A;  2EL6 A;  4P7D A;  1DGC A;  2EQ0 A;  4R8O A;  2L2K B;  2F4V E;  2LJU A;  1HNZ E;  2UUC E;  1BBO A;  2V89 A;  2MDG A;  3HQ1 A;  2EN1 A;  4BC9 A;  4F9C B;  2RSI A;  2ODR D;  2JP9 A;  3C4T A;  2JYA A;  1AH5 A;  4IJD A;  3AUZ A;  5F3W A;  5T6J A;  2HJJ A;  5KL2 A;  1IBM E;  4DR7 E;  2EZ6 A;  2LJH A;  2VQF E;  3J7Y p;  4ZYD A;  4LFB E;  2CT1 A;  4X64 E;  2RPC A;  4LU9 A;  3P1X A;  5KL7 A;  4GKK E;  2CPN A;  2ODR C;  2EPR A;  2UXD E;  4WFT A;  1J26 A;  1WHN A;  4DR3 E;  3HPZ A;  2DRP A;  2UXC E;  3HXL A;  2V8Q B;  3VYX A;  1PJS A;  1RMD A;  2YSO A;  2EPZ A;  4LFC E;  2L2M A;  5KL5 A;  2YTJ A;  4NZV A;  3EPJ A;  3IWC A;  2L8T A;  3EQ1 A;  4WX9 A;  2EOF A;  2IHR 1;  2EN8 A;  3J81 C;  4GEQ B;  5KL6 A;  4YY3 E;  4Q28 A;  4X65 E;  2V85 A;  1IQO A;  2DB2 A;  4AQY E;  2EMX A;  3ECR A;  4R2C A;  1X49 A;  2JR1 A;  2ADR A;  4P78 A;  4ZYE A;  2EN2 A;  2NA2 A;  2EPK X;  3H09 A;  3VK6 A;  5A6B A;  1B69 A;  2EN6 A;  2ENA A;  4I8O A;  1X5W A;  4ZYG A;  5AE3 A;  4M9V C;  1BB8 A;  1X6E A;  5A6J A;  2GLI A;  2B7V A;  5LLQ A;  5LMN E;  2Q8U A;  4B3M E;  5AE2 A;  2EP3 A;  4DR6 E;  2EMB A;  1T4O A;  3JAM C;  2YT4 A;  4DUZ E;  4F6N A;  4R2E A;  2M1S A;  1HNW E;  4JI0 E;  2EOZ A;  2L33 A;  4LF4 E;  1ZBQ A;  2WBS A;  1IBK E;  3EPK A;  2JOB A;  4WXC A;  2YTG A;  2EPM X;  2DMI A;  5AAS A;  5AC4 A;  1IMU A;  3F6G A;  2YRK A;  2YTO A;  1X48 A;  1UBD C;  1N34 E;  3J80 C;  2EML A;  2JXP A;  3JTZ A;  1A1L A;  4NXN E;  3DF6 A;  2EM9 A;  1XMO E;  3EPL A;  2FGG A;  1A1K A;  2JPA A;  2V86 A;  4DKK A;  1YUI A;  2WBT A;  3THN A;  4LF9 E;  2LV2 A;  3T1Y E;  2RSM A;  3ADL A;  1X3C A;  5IV8 B;  4FK5 C;  4F9B B;  4R2P A;  2UXB E;  4L8N A;  4K0K E;  2I9I A;  2EMZ A;  3ZOQ B;  4X8W A;  2MDR A;  2F8B A;  4DV2 E;  1WHQ A;  2UUB E;  3JU0 A;  1L4S A;  2WBU A;  5A6A A;  2LO3 A;  1FJG E;  2LE2 A;  5DNY A;  5LMU E;  2EM3 A;  2EJ4 A;  4R2R A;  5KL3 A;  1YPN A;  2LMZ A;  2EM2 A;  2L2N A;  3THO B;  2DSY A;  1YZ9 A;  2E72 A;  4O5G A;  3ADG A;  2DGC A;  1O0W A;  2LTR A;  3K6Q A;  1N33 E;  4O43 A;  3MHH C;  3ADI A;  1QNT A;  2K7I A;  4R2Q A;  1YYO A;  1YYW A;  4M2Z A;  1XMQ E;  2KHX A;  1A1G A;  3HTX A;  4M30 A;  2WZO A;  3DJW A;  1SR9 A;  2M7Q A;  2JVA A;  2BB8 A;  3OML A;  1XNR E;  4OOG C;  3HPS A;  1T38 A;  4JI1 E;  4DMI A;  2YTE A;  4BHB A;  2RTX A;  1TF6 A;  5IXM B;  2K4V A;  2LUQ A;  2L6M A;  1T4N A;  1EH8 A;  2YTP A;  4NHR A;  4R2D A;  5A6B D;  5LL6 R;  4RHB B;  4BMJ A;  4X9J A;  3MSW A;  4O24 A;  4MLQ A;  2ENC A;  2RQL A;  1HNX E;  2YZT A;  2EMA A;  5BR8 E;  4IS1 C;  2EPA A;  4LTY A;  3IWB A;  1PJQ A;  1HR0 E;  4DR4 E;  2EQ3 A;  1A1J A;  3VYY A;  2EPU A;  1NCS A;  4JI5 E;  2EMK A;  4JYA E;  2LUP B;  2EL4 A;  2EOS A;  4R2S A;  2VQE E;  1AAY A;  1G2F C;  4BCA A;  2YWQ A;  4WYQ B;  4WXD A;  2EOY A;  4JV5 E;  5KL4 A;  1QU6 A;  5IWA E;  2V88 A;  4GKJ E;  2EM0 A;  1YSA C;  2MC6 A;  2N3G A;  4DUY E;  1PJT A;  2EWL A;  2KOU A;  1MGT A;  2EPX A;  5IT9 C;  2EOJ A;  2LVH A;  3TQM A;  1BBG A;  2EM8 A;  3KZZ A;  1A1F A;  2EOX A;  2WCC 3;  2HC5 A;  3LLH A;  2EM6 A;  1WJP A;  2EPC A;  3BF2 A;  4L5N C;  4LF5 E;  5A2Q C;  1A1H A;  1ZBT A;  1KYQ A;  2EOE A;  1JK1 A;  3MHS C;  1J5E E;  4BHC A;  4LF7 E;  1MEY C;  1WXR A;  3L00 A;  2GHF A;  2EM5 A;  2GPI A;  4TUI A;  4JI3 E;  1NEI A;  4DV4 E;  2EMG A;  2MKD A;  4TUG A;  2VRD A;  1UIL A;  4LFA E;  5A69 A;  2LBS B;  2EOO A;  4WSP A;  4MLV A;  2G7H A;  4HEI A;  1GQE A;  2UU9 E;  3M99 B;  2ELY A;  2LTS A;  4JI8 E;  2ZM6 E;  2NUF A;  4F9A B;  2EPL X;  4F54 A;  1RC7 A;  2B3T B;  2MKN A;  1X6F A;  4B3S E;  1YYK A;  2J7J A;  2EM4 A;  2PRT A;  1IBL E;  2YU5 A;  3J7A G;  1Z1B A;  2NUE A;  2YTN A;  4OX9 E;  3IWD A;  1F2I G;  3VHT B;  1ZR9 A;  4N4R B;  2N8X A;  4JI6 E;  4DV5 E;  1YFH A;  2RS6 A;  1IQS A;  4R2A A;  4GZN C;  2EMW A;  2EE8 A;  1ZU1 A;  2EPP A;  2CTD A;  2NAB A;  2JWO A;  3BBG A;  3KWR A;  3C6K A;  2V83 A;  1EH6 A;  5CFF E;  2YSP A;  2LT7 A;  2EM7 A;  3OTO E;  4DR1 E;  1WRJ A;  3T1H E;  1P47 A;  2BBG A;  4B3R E;  1STU A;  4KZS A;  5AE1 A;  2HHH E;  2YU8 A;  1A1I A;  3AV0 A;  1TN9 A;  2M4I A;  2EMY A;  5AC5 A;  1T4L B;  1UHZ A;  3F6H A;  2L92 A;  4BBY A;  2YPN A;  2EOM A;  2EMC A;  3C6M A;  4KHP E;  2KON A;  1N32 E;  2MC5 A;  4X66 E;  1YUJ A;  2R76 A;  5TSE A;  1DI2 A;  4LF6 E;  4ZYH A;  2NUG A;  2EPO A;  1N3G A;  4JI7 E;  4B3T E;  4M0V A;  4DV7 E;  4JI4 E;  2A25 A;  2DMY A;  2LRS A;  4WSG A;  4NXM E;  4F2J C;  2B9D A;  2YRM A;  1GTK A;  2DIX A;  1TF3 A;  1RQ0 A;  3KZY A;  2M9A A;  2E1M A;  4DV6 E;  2L3J A;  2EMH A;  2EN4 A;  4YHH E;  3FIG A;  4DR5 E;  4LF8 E;  3UK3 C;  1X47 A;  2H36 X;  1N36 E;  2EOI A;  1EH7 A;  4JI2 E;  3LML A;  2UUA E;  4J8Z A;  1GZ6 A;  4HTG A;  1JK2 A;  5A6K A;  2L3C A;  4DV3 E;  1EKZ A;  2I13 A;  2EOQ A;  4BS9 A;  1DQ3 A;  2N3H A;  4RH8 A;  2EOR A;  4DV0 E;  4F6M A;  3RMP A;  2EN7 A;  4O4K A;  2VE7 C;  2HGH A;  1X6H A;  2JY9 A;  2V87 A;  1SFE A;  2JOX A;  5FLX C;  2ENH A;  3EPH A;  4DR2 E;  2B7T A;  2E5L E;  2VF1 A;  4BC7 A;  4Q35 B;  1G2D C;  2D9H A;  4WPY A;  3BGH A;  2DLQ A;  1ZAA C;  1XNQ E;  2EOH A;  2EMI A;  1LLM C;  3C4B A;  2R1F A; 
#chains in the Genus database with same CATH homology
 2EQ1 A;  2EMF A;  2ELZ A;  2YTP A;  4R2D A;  2EN3 A;  4F6N A;  2EL5 A;  4R2E A;  1KJK A;  2YTD A;  2DLK A;  2EOZ A;  2YTF A;  2YTI A;  4X9J A;  2YTQ A;  2CSH A;  2ENC A;  4R2A A;  4GZN C;  2EMW A;  2EMA A;  2WBS A;  4IS1 C;  2EE8 A;  2EPA A;  1ZU1 A;  2EPP A;  3EPK A;  2CTD A;  2NAB A;  2YTG A;  2DMI A;  2LCE A;  2YRH A;  2YSP A;  2LT7 A;  2EQ3 A;  2EM7 A;  1UN6 B;  1A1J A;  2EL6 A;  2YRK A;  1DGC A;  2EQ0 A;  2EPU A;  2YTO A;  1NCS A;  1UBD C;  1P47 A;  2EMK A;  1BBO A;  2EL4 A;  2EML A;  2MDG A;  1A1L A;  2EN1 A;  2EOS A;  4R2S A;  1AAY A;  2YU8 A;  1G2F C;  2EM9 A;  1A1I A;  3EPL A;  1TN9 A;  1A1K A;  2RSI A;  2EMY A;  2JP9 A;  2JPA A;  2EOY A;  1YUI A;  5KL4 A;  2WBT A;  4IJD A;  2R1F A;  2LV2 A;  5KL2 A;  2EM0 A;  2EOM A;  1YSA C;  2EMC A;  1X3C A;  4FK5 C;  4R2P A;  2CT1 A;  2EPX A;  2RPC A;  1YUJ A;  2EMZ A;  2EOJ A;  2LVH A;  2EM8 A;  2WBU A;  2EOX A;  5KL7 A;  2WCC 3;  1A1F A;  2LO3 A;  2EPR A;  2EM6 A;  1WJP A;  2EPC A;  2A25 A;  1A1H A;  2DRP A;  2EOE A;  2EM3 A;  2EJ4 A;  3MHS C;  4R2R A;  1JK1 A;  5KL3 A;  1RMD A;  4WSG A;  2YSO A;  2EPZ A;  4F2J C;  2EM2 A;  2YRM A;  5KL5 A;  1MEY C;  1TF3 A;  2M9A A;  2E72 A;  2YTJ A;  2GHF A;  3EPJ A;  2DGC A;  2EMH A;  2EN4 A;  2EM5 A;  3UK3 C;  2EOF A;  3MHH C;  2EN8 A;  2EMG A;  2MKD A;  2EOI A;  2VRD A;  5KL6 A;  4R2Q A;  2EOO A;  2EMX A;  1JK2 A;  3M99 B;  2I13 A;  2ELY A;  2EOQ A;  4R2C A;  1A1G A;  2EOR A;  2ADR A;  2EN2 A;  1ZR9 A;  4F6M A;  2EN7 A;  1B69 A;  2EN6 A;  2BB8 A;  2HGH A;  2ENA A;  1X6H A;  2MKN A;  1X5W A;  1X6F A;  4M9V C;  2J7J A;  2EM4 A;  1BB8 A;  2PRT A;  1X6E A;  2YU5 A;  2ENH A;  2GLI A;  3EPH A;  1Z1B A;  2YTE A;  1G2D C;  2D9H A;  2DLQ A;  1ZAA C;  1TF6 A;  2EP3 A;  2YTN A;  1F2I G;  2EOH A;  2EMI A;  1LLM C;  3VHT B;  2EMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...