2EM3A

Solution structure of the c2h2 type zinc finger (region 640-672) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECKVCSKAFTQKAHLAQHQKTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 640-672) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em3A00
1P47A 2EMYA 2LV2A 2DMIA 2YRKA 4IS1C 2EMCA 2EMGA 3MHSC 4FK5C 2EN6A 1AAYA 3EPHA 2EPPA 2ENCA 2LCEA 2YTQA 1X6HA 2VRDA 2EMIA 2EN1A 2MDGA 2EL4A 2EN8A 2EOXA 1G2FC 2JPAA 2CTDA 2D9HA 3M99B 2EP3A 2EOMA 2EN7A 2YTOA 2EM3A 1X3CA 2DGCA 4M9VC 2EM9A 2DRPA 2EL6A 4R2EA 4R2QA 2EM6A 4R2SA 2BB8A 1MEYC 4IJDA 2EMLA 2EMAA 1A1IA 2EPZA 1A1KA 1BB8A 2ENHA 1BBOA 2EN2A 2EPUA 2LO3A 2YTDA 3VHTB 4F6NA 4F6MA 4GZNC 2EL5A 1A1GA 2YTIA 3UK3C 1LLMC 2EJ4A 1TN9A 2YU5A 2EOFA 2EOZA 1TF3A 5KL4A 1X5WA 2YTGA 2EN3A 2YTPA 1F2IG 2YTEA 4R2DA 2LVHA 1NCSA 2EM2A 2EORA 2WBUA 2YTNA 1JK2A 2HGHA 1KJKA 2GHFA 5KL2A 2YSPA 2CSHA 2EQ3A 2YRHA 2RSIA 2EPCA 1X6FA 2RPCA 5KL3A 2NABA 2EOSA 1ZU1A 1YUIA 2DLQA 2EOJA 2EM8A 2EOHA 1ZR9A 1DGCA 1ZAAC 2EMBA 1A1JA 1X6EA 2EM4A 3MHHC 1UBDC 2E72A 2EMHA 1WJPA 2ENAA 2EN4A 2EOYA 3EPJA 3EPLA 2EMZA 2I13A 2WBTA 2YRMA 1RMDA 4R2RA 2EQ1A 5KL5A 2MKDA 1A1LA 2YTFA 2EM5A 2WCC3 2EMKA 2YTJA 2WBSA 2YU8A 1JK1A 2ELYA 2EMFA 2DLKA 4F2JC 5KL6A 1UN6B 2JP9A 5KL7A 2R1FA 4R2AA 4R2CA 2EOIA 2CT1A 2EMXA 2ADRA 2EE8A 2EOQA 1A1HA 2LT7A 3EPKA 1Z1BA 2EM0A 1B69A 1A1FA 2EMWA 2A25A 1G2DC 2EOEA 2EOOA 2EPXA 2EPAA 1YUJA 2YSOA 1TF6A 2MKNA 4R2PA 2EPRA 2PRTA 1YSAC 2EM7A 4X9JA 2M9AA 4WSGA 2ELZA 2EQ0A 2GLIA 2J7JA
chains in the Genus database with same CATH superfamily
4B3TE 2YZTA 2LTSA 2YRKA 2DMIA 2EMCA 2EMGA 2B7VA 2EN6A 1AAYA 4ZYHA 2EPPA 4BMJA 1YYKA 3EPHA 4LU9A 2VRDA 2IHR1 2B3TB 2EMIA 1N33E 2EL4A 2EN8A 1EH6A 2HJJA 2KONA 2NA2A 4N4RB 2JPAA 3QG5C 2YWQA 4F9BB 2L33A 1N36E 3KZYA 5TSEA 2DRPA 4R2SA 4DV3E 2L92A 4IJDA 1BBGA 1A1KA 4LF8E 3ADLA 2EPUA 2YTDA 1XNRE 2M1SA 4DUZE 4DR4E 3UK3C 2JOXA 1GZ6A 2V83A 3L00A 1LLMC 3FIGA 4DV4E 2F8BA 4BCAA 4JI6E 2YU5A 4M2ZA 1EH8A 3IWCA 1YZ9A 4DUYE 1TF3A 5KL4A 1XNQE 2YTPA 2EN3A 2YTEA 2LVHA 5A2QC 2EM2A 2EORA 2WBUA 4JI1E 1GTKA 4WFTA 1KJKA 2EPLX 2UUAE 2CSHA 3AV0A 1SR9A 1X6FA 4NZVA 5KL3A 3HQ1A 1T39A 2EOJA 2EM8A 1WHQA 1DGCA 3KZZA 1ZAAC 2LUQA 3HPSA 1UBDC 3OMLA 1DI2A 4P78A 2I13A 4LF4E 2YRMA 2FV4B 4DV5E 2EWLA 2EM5A 1HNZE 1UILA 2WBSA 2YU8A 4MLVA 3LLHA 4F2JC 2EPMX 2RS7A 4R2AA 2EOIA 1IQOA 3K6QA 2RS6A 2EM0A 2JWOA 2V8QB 3BGHA 2UXBE 2V85A 3LMLA 2UU9E 2JVAA 4KZSA 2LUPB 4LFAE 1PKPA 1T38A 4R2PA 5IXMB 1HR0E 3DJWA 4M30A 2PRTA 1IBKE 1FKAE 2HHHE 4OOGC 2DB2A 3RMPA 4DR7E 1FJGE 4B3SE 4M0VA 2FTXB 2J7JA 3TQMA 4O24A 4LF7E 4IS1C 3ADJA 4BHCA 4WXDA 4WSPA 4AQYE 2ENCA 2EZ6A 2LCEA 1N3GA 1X6HA 4DR3E 2Q8UA 4JI0E 2EN1A 3JTZA 1PJTA 2CTDA 4DR2E 2D9HA 3M99B 2EP3A 4R8OA 4Q28A 4X62E 4HEIA 3EQ1A 3KWRA 1X47A 1X3CA 4M9VC 4F54A 1N32E 2LJHA 3ADIA 3VYXA 5LMUE 2JY9A 1MEYC 2EMLA 2EMAA 1J26A 4LF6E 2ODRD 1BB8A 4B3RE 2EN2A 4LF5E 4F9AB 4JV5E 2EOZA 2V88A 2MC6A 3T1YE 5T6JA 5AC4A 1WXRA 2G7HA 1X49A 1JK2A 4X66E 1YYOA 1IQSA 2V87A 2CPNA 5F3WA 2EQ3A 2YRHA 4BHBA 2EOSA 1YUIA 5A6BA 3MHHC 3IWDA 2NUFA 4DV0E 3EPJA 2LRSA 4L8NA 4JI4E 1AH5A 4DR5E 1RMDA 2EQ1A 5KL5A 1ZBTA 2JYAA 1T4NA 4WXCA 2ELYA 2EMFA 2DLKA 2YT4A 2UXDE 2JP9A 4TUGA 3VYYA 2DIXA 4RH8A 3ECRA 4JI5E 3ADGA 2CT1A 2DMYA 2EOQA 2LT7A 3EPKA 1Z1BA 4J8ZA 4K0KE 4JI3E 1YFHA 5LL6R 2EOEA 2EOOA 3J81C 4DV6E 2EPAA 1YUJA 2B7TA 2N8XA 2MKNA 2LE2A 3H09A 3J7Yp 2EPRA 3C6KA 4BS9A 2GPIA 1PDAA 2EM7A 4Q35B 1DQ3A 4WSGA 4HTGA 3ZOQB 4NXME 2I9IA 1EH7A 3F6HA 1P47A 2EPNA 3MHSC 4FK5C 4LFBE 4JI2E 2MC5A 3C4BA 3HTXA 5AC5A 4JYAE 2YPNA 4DV1E 2EN7A 4O43A 2YTOA 1I94E 2EM3A 1O0WA 2M7QA 2EM9A 2K4VA 3BIDA 2BB8A 4ZYEA 5IV8B 2BBGA 3T1HE 4GEQB 2VQEE 2ENHA 3DF6A 2NUEA 2LO3A 4F6MA 3VHTB 1A1GA 2YTIA 3BF2A 2HC5A 1TN9A 2EOFA 4MLQA 1IBME 4RHBB 1X5WA 4NXNE 1F2IG 4ZYDA 2R76A 1NEIA 4O5GA 1NCSA 4YHHE 4DMIA 2L3CA 2HGHA 1XMQE 4DR6E 4BC9A 2GHFA 1UHZA 5BR8E 3THOB 2RSMA 2UUBE 5A6AA 2RSIA 1IBLE 2RPCA 4L5NC 4R03A 1HNWE 4F9CB 2DLQA 2JOBA 1STUA 4WYQB 2EOHA 4BBYA 1ZR9A 2EMBA 2L2MA 1A1JA 5A6BD 4X64E 2EPKX 1KYQA 4DKKA 2ENAA 2EMHA 4DR1E 2EN4A 2EOYA 2N3HA 2H36X 2WBTA 4X8WA 4R2RA 4TUIA 3C6MA 3THNA 1A1LA 2WCC3 5A6KA 3JU0A 1JK1A 5LLQA 4B3ME 2E1MA 5KL7A 2R1FA 3VK6A 2B9DA 5AE1A 2ODRC 2L8TA 1X48A 1A1HA 1RC7A 2VF1A 3J80C 1PJSA 1B69A 5LMNE 1QU6A 1A1FA 2EMWA 2A25A 2KHXA 1G2DC 1ZBQA 5IT9C 4O4KA 2F4VE 2EPXA 2V86A 4WPYA 2YSOA 4I8OA 1TF6A 4GKJE 4JI7E 4BC7A 4P7DA 2KOUA 4WX9A 1YPNA 1J5EE 1PJQA 3HPZA 2M9AA 5FLXC 4X9JA 5CFFE 2EQ0A 2GLIA 3C4TA 2EMYA 2LV2A 3IWBA 2M4IA 1GQEA 5ADZA 2LMZA 2YTQA 2L6MA 2L3JA 2JXPA 4DV2E 2MDGA 2E5LE 2EOXA 5AE3A 1G2FC 2EOMA 2LBSB 2FGGA 1T4LB 4NHRA 2DGCA 2L2NA 5A69A 2LJUA 2EL6A 4R2EA 1WHNA 4R2QA 2EM6A 2K7IA 1A1IA 2EPZA 2RTXA 3AUZA 1BBOA 4F6NA 4GZNC 2MDRA 2EL5A 2VE7C 2EJ4A 3HXLA 5AE2A 2YTGA 4YY3E 2DSYA 3JAMC 4KWYA 4R2DA 1QNTA 4ZYGA 2YTNA 4JI8E 1HNXE 5KL2A 2YSPA 1N34E 5IWAE 2WZOA 5DNYA 2EPCA 2NABA 4LTYA 1YYWA 1ZU1A 1MGTA 3F6GA 3BBGA 2NUGA 1X6EA 2EM4A 2UUCE 1L4SA 2E72A 1WJPA 5A6JA 3EPLA 4GKKE 2EMZA 3J7AG 3P1XA 2MKDA 2YTFA 4LFCE 2EMKA 2YTJA 1XMOE 4KHPE 5KL6A 2L2KB 1EKZA 2EPOA 2N3GA 1UN6B 2UXCE 4X65E 2V89A 4LF9E 4R2CA 2RQLA 2EMXA 4DV7E 2ADRA 2EE8A 5AASA 2JR1A 1SFEA 2VQFE 2LTRA 1IMUA 4OX9E 3OTOE 1YSAC 1WRJA 1T4OA 1RQ0A 2ELZA 2ZM6E 3MSWA
chains in the Genus database with same CATH topology
1P47A 2EMYA 2LV2A 2DMIA 2YRKA 4IS1C 2EMCA 2EMGA 3MHSC 4FK5C 2EN6A 1AAYA 3EPHA 2EPPA 2ENCA 2LCEA 2YTQA 1X6HA 2VRDA 2EMIA 2EN1A 2MDGA 2EL4A 2EN8A 2EOXA 1G2FC 2JPAA 2CTDA 2D9HA 3M99B 2EP3A 2EOMA 2EN7A 2YTOA 2EM3A 1X3CA 2DGCA 4M9VC 2EM9A 2DRPA 2EL6A 4R2EA 4R2QA 2EM6A 4R2SA 2BB8A 1MEYC 4IJDA 2EMLA 2EMAA 1A1IA 2EPZA 1A1KA 1BB8A 2ENHA 1BBOA 2EN2A 2EPUA 2LO3A 2YTDA 3VHTB 4F6NA 4F6MA 4GZNC 2EL5A 1A1GA 2YTIA 3UK3C 1LLMC 2EJ4A 1TN9A 2YU5A 2EOFA 2EOZA 1TF3A 5KL4A 1X5WA 2YTGA 2EN3A 2YTPA 1F2IG 2YTEA 4R2DA 2LVHA 1NCSA 2EM2A 2EORA 2WBUA 2YTNA 1JK2A 2HGHA 1KJKA 2GHFA 5KL2A 2YSPA 2CSHA 2EQ3A 2YRHA 2RSIA 2EPCA 1X6FA 2RPCA 5KL3A 2NABA 2EOSA 1ZU1A 1YUIA 2DLQA 2EOJA 2EM8A 2EOHA 1ZR9A 1DGCA 1ZAAC 2EMBA 1A1JA 1X6EA 2EM4A 3MHHC 1UBDC 2E72A 2EMHA 1WJPA 2ENAA 2EN4A 2EOYA 3EPJA 3EPLA 2EMZA 2I13A 2WBTA 2YRMA 1RMDA 4R2RA 2EQ1A 5KL5A 2MKDA 1A1LA 2YTFA 2EM5A 2WCC3 2EMKA 2YTJA 2WBSA 2YU8A 1JK1A 2ELYA 2EMFA 2DLKA 4F2JC 5KL6A 1UN6B 2JP9A 5KL7A 2R1FA 4R2AA 4R2CA 2EOIA 2CT1A 2EMXA 2ADRA 2EE8A 2EOQA 1A1HA 2LT7A 3EPKA 1Z1BA 2EM0A 1B69A 1A1FA 2EMWA 2A25A 1G2DC 2EOEA 2EOOA 2EPXA 2EPAA 1YUJA 2YSOA 1TF6A 2MKNA 4R2PA 2EPRA 2PRTA 1YSAC 2EM7A 4X9JA 2M9AA 4WSGA 2ELZA 2EQ0A 2GLIA 2J7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P47 A;  2EMY A;  2LV2 A;  2DMI A;  2YRK A;  4IS1 C;  2EMC A;  2EMG A;  3MHS C;  4FK5 C;  2EN6 A;  1AAY A;  3EPH A;  2EPP A;  2ENC A;  2LCE A;  2YTQ A;  1X6H A;  2VRD A;  2EMI A;  2EN1 A;  2MDG A;  2EL4 A;  2EN8 A;  2EOX A;  1G2F C;  2JPA A;  2CTD A;  2D9H A;  3M99 B;  2EP3 A;  2EOM A;  2EN7 A;  2YTO A;  2EM3 A;  1X3C A;  2DGC A;  4M9V C;  2EM9 A;  2DRP A;  2EL6 A;  4R2E A;  4R2Q A;  2EM6 A;  4R2S A;  2BB8 A;  1MEY C;  4IJD A;  2EML A;  2EMA A;  1A1I A;  2EPZ A;  1A1K A;  1BB8 A;  2ENH A;  1BBO A;  2EN2 A;  2EPU A;  2LO3 A;  2YTD A;  3VHT B;  4F6N A;  4F6M A;  4GZN C;  2EL5 A;  1A1G A;  2YTI A;  3UK3 C;  1LLM C;  2EJ4 A;  1TN9 A;  2YU5 A;  2EOF A;  2EOZ A;  1TF3 A;  5KL4 A;  1X5W A;  2YTG A;  2EN3 A;  2YTP A;  1F2I G;  2YTE A;  4R2D A;  2LVH A;  1NCS A;  2EM2 A;  2EOR A;  2WBU A;  2YTN A;  1JK2 A;  2HGH A;  1KJK A;  2GHF A;  5KL2 A;  2YSP A;  2CSH A;  2EQ3 A;  2YRH A;  2RSI A;  2EPC A;  1X6F A;  2RPC A;  5KL3 A;  2NAB A;  2EOS A;  1ZU1 A;  1YUI A;  2DLQ A;  2EOJ A;  2EM8 A;  2EOH A;  1ZR9 A;  1DGC A;  1ZAA C;  2EMB A;  1A1J A;  1X6E A;  2EM4 A;  3MHH C;  1UBD C;  2E72 A;  2EMH A;  1WJP A;  2ENA A;  2EN4 A;  2EOY A;  3EPJ A;  3EPL A;  2EMZ A;  2I13 A;  2WBT A;  2YRM A;  1RMD A;  4R2R A;  2EQ1 A;  5KL5 A;  2MKD A;  1A1L A;  2YTF A;  2EM5 A;  2WCC 3;  2EMK A;  2YTJ A;  2WBS A;  2YU8 A;  1JK1 A;  2ELY A;  2EMF A;  2DLK A;  4F2J C;  5KL6 A;  1UN6 B;  2JP9 A;  5KL7 A;  2R1F A;  4R2A A;  4R2C A;  2EOI A;  2CT1 A;  2EMX A;  2ADR A;  2EE8 A;  2EOQ A;  1A1H A;  2LT7 A;  3EPK A;  1Z1B A;  2EM0 A;  1B69 A;  1A1F A;  2EMW A;  2A25 A;  1G2D C;  2EOE A;  2EOO A;  2EPX A;  2EPA A;  1YUJ A;  2YSO A;  1TF6 A;  2MKN A;  4R2P A;  2EPR A;  2PRT A;  1YSA C;  2EM7 A;  4X9J A;  2M9A A;  4WSG A;  2ELZ A;  2EQ0 A;  2GLI A;  2J7J A; 
#chains in the Genus database with same CATH topology
 4B3T E;  2YZT A;  2LTS A;  2YRK A;  2DMI A;  2EMC A;  2EMG A;  2B7V A;  2EN6 A;  1AAY A;  4ZYH A;  2EPP A;  4BMJ A;  1YYK A;  3EPH A;  4LU9 A;  2VRD A;  2IHR 1;  2B3T B;  2EMI A;  1N33 E;  2EL4 A;  2EN8 A;  1EH6 A;  2HJJ A;  2KON A;  2NA2 A;  4N4R B;  2JPA A;  3QG5 C;  2YWQ A;  4F9B B;  2L33 A;  1N36 E;  3KZY A;  5TSE A;  2DRP A;  4R2S A;  4DV3 E;  2L92 A;  4IJD A;  1BBG A;  1A1K A;  4LF8 E;  3ADL A;  2EPU A;  2YTD A;  1XNR E;  2M1S A;  4DUZ E;  4DR4 E;  3UK3 C;  2JOX A;  1GZ6 A;  2V83 A;  3L00 A;  1LLM C;  3FIG A;  4DV4 E;  2F8B A;  4BCA A;  4JI6 E;  2YU5 A;  4M2Z A;  1EH8 A;  3IWC A;  1YZ9 A;  4DUY E;  1TF3 A;  5KL4 A;  1XNQ E;  2YTP A;  2EN3 A;  2YTE A;  2LVH A;  5A2Q C;  2EM2 A;  2EOR A;  2WBU A;  4JI1 E;  1GTK A;  4WFT A;  1KJK A;  2EPL X;  2UUA E;  2CSH A;  3AV0 A;  1SR9 A;  1X6F A;  4NZV A;  5KL3 A;  3HQ1 A;  1T39 A;  2EOJ A;  2EM8 A;  1WHQ A;  1DGC A;  3KZZ A;  1ZAA C;  2LUQ A;  3HPS A;  1UBD C;  3OML A;  1DI2 A;  4P78 A;  2I13 A;  4LF4 E;  2YRM A;  2FV4 B;  4DV5 E;  2EWL A;  2EM5 A;  1HNZ E;  1UIL A;  2WBS A;  2YU8 A;  4MLV A;  3LLH A;  4F2J C;  2EPM X;  2RS7 A;  4R2A A;  2EOI A;  1IQO A;  3K6Q A;  2RS6 A;  2EM0 A;  2JWO A;  2V8Q B;  3BGH A;  2UXB E;  2V85 A;  3LML A;  2UU9 E;  2JVA A;  4KZS A;  2LUP B;  4LFA E;  1PKP A;  1T38 A;  4R2P A;  5IXM B;  1HR0 E;  3DJW A;  4M30 A;  2PRT A;  1IBK E;  1FKA E;  2HHH E;  4OOG C;  2DB2 A;  3RMP A;  4DR7 E;  1FJG E;  4B3S E;  4M0V A;  2FTX B;  2J7J A;  3TQM A;  4O24 A;  4LF7 E;  4IS1 C;  3ADJ A;  4BHC A;  4WXD A;  4WSP A;  4AQY E;  2ENC A;  2EZ6 A;  2LCE A;  1N3G A;  1X6H A;  4DR3 E;  2Q8U A;  4JI0 E;  2EN1 A;  3JTZ A;  1PJT A;  2CTD A;  4DR2 E;  2D9H A;  3M99 B;  2EP3 A;  4R8O A;  4Q28 A;  4X62 E;  4HEI A;  3EQ1 A;  3KWR A;  1X47 A;  1X3C A;  4M9V C;  4F54 A;  1N32 E;  2LJH A;  3ADI A;  3VYX A;  5LMU E;  2JY9 A;  1MEY C;  2EML A;  2EMA A;  1J26 A;  4LF6 E;  2ODR D;  1BB8 A;  4B3R E;  2EN2 A;  4LF5 E;  4F9A B;  4JV5 E;  2EOZ A;  2V88 A;  2MC6 A;  3T1Y E;  5T6J A;  5AC4 A;  1WXR A;  2G7H A;  1X49 A;  1JK2 A;  4X66 E;  1YYO A;  1IQS A;  2V87 A;  2CPN A;  5F3W A;  2EQ3 A;  2YRH A;  4BHB A;  2EOS A;  1YUI A;  5A6B A;  3MHH C;  3IWD A;  2NUF A;  4DV0 E;  3EPJ A;  2LRS A;  4L8N A;  4JI4 E;  1AH5 A;  4DR5 E;  1RMD A;  2EQ1 A;  5KL5 A;  1ZBT A;  2JYA A;  1T4N A;  4WXC A;  2ELY A;  2EMF A;  2DLK A;  2YT4 A;  2UXD E;  2JP9 A;  4TUG A;  3VYY A;  2DIX A;  4RH8 A;  3ECR A;  4JI5 E;  3ADG A;  2CT1 A;  2DMY A;  2EOQ A;  2LT7 A;  3EPK A;  1Z1B A;  4J8Z A;  4K0K E;  4JI3 E;  1YFH A;  5LL6 R;  2EOE A;  2EOO A;  3J81 C;  4DV6 E;  2EPA A;  1YUJ A;  2B7T A;  2N8X A;  2MKN A;  2LE2 A;  3H09 A;  3J7Y p;  2EPR A;  3C6K A;  4BS9 A;  2GPI A;  1PDA A;  2EM7 A;  4Q35 B;  1DQ3 A;  4WSG A;  4HTG A;  3ZOQ B;  4NXM E;  2I9I A;  1EH7 A;  3F6H A;  1P47 A;  2EPN A;  3MHS C;  4FK5 C;  4LFB E;  4JI2 E;  2MC5 A;  3C4B A;  3HTX A;  5AC5 A;  4JYA E;  2YPN A;  4DV1 E;  2EN7 A;  4O43 A;  2YTO A;  1I94 E;  2EM3 A;  1O0W A;  2M7Q A;  2EM9 A;  2K4V A;  3BID A;  2BB8 A;  4ZYE A;  5IV8 B;  2BBG A;  3T1H E;  4GEQ B;  2VQE E;  2ENH A;  3DF6 A;  2NUE A;  2LO3 A;  4F6M A;  3VHT B;  1A1G A;  2YTI A;  3BF2 A;  2HC5 A;  1TN9 A;  2EOF A;  4MLQ A;  1IBM E;  4RHB B;  1X5W A;  4NXN E;  1F2I G;  4ZYD A;  2R76 A;  1NEI A;  4O5G A;  1NCS A;  4YHH E;  4DMI A;  2L3C A;  2HGH A;  1XMQ E;  4DR6 E;  4BC9 A;  2GHF A;  1UHZ A;  5BR8 E;  3THO B;  2RSM A;  2UUB E;  5A6A A;  2RSI A;  1IBL E;  2RPC A;  4L5N C;  4R03 A;  1HNW E;  4F9C B;  2DLQ A;  2JOB A;  1STU A;  4WYQ B;  2EOH A;  4BBY A;  1ZR9 A;  2EMB A;  2L2M A;  1A1J A;  5A6B D;  4X64 E;  2EPK X;  1KYQ A;  4DKK A;  2ENA A;  2EMH A;  4DR1 E;  2EN4 A;  2EOY A;  2N3H A;  2H36 X;  2WBT A;  4X8W A;  4R2R A;  4TUI A;  3C6M A;  3THN A;  1A1L A;  2WCC 3;  5A6K A;  3JU0 A;  1JK1 A;  5LLQ A;  4B3M E;  2E1M A;  5KL7 A;  2R1F A;  3VK6 A;  2B9D A;  5AE1 A;  2ODR C;  2L8T A;  1X48 A;  1A1H A;  1RC7 A;  2VF1 A;  3J80 C;  1PJS A;  1B69 A;  5LMN E;  1QU6 A;  1A1F A;  2EMW A;  2A25 A;  2KHX A;  1G2D C;  1ZBQ A;  5IT9 C;  4O4K A;  2F4V E;  2EPX A;  2V86 A;  4WPY A;  2YSO A;  4I8O A;  1TF6 A;  4GKJ E;  4JI7 E;  4BC7 A;  4P7D A;  2KOU A;  4WX9 A;  1YPN A;  1J5E E;  1PJQ A;  3HPZ A;  2M9A A;  5FLX C;  4X9J A;  5CFF E;  2EQ0 A;  2GLI A;  3C4T A;  2EMY A;  2LV2 A;  3IWB A;  2M4I A;  1GQE A;  5ADZ A;  2LMZ A;  2YTQ A;  2L6M A;  2L3J A;  2JXP A;  4DV2 E;  2MDG A;  2E5L E;  2EOX A;  5AE3 A;  1G2F C;  2EOM A;  2LBS B;  2FGG A;  1T4L B;  4NHR A;  2DGC A;  2L2N A;  5A69 A;  2LJU A;  2EL6 A;  4R2E A;  1WHN A;  4R2Q A;  2EM6 A;  2K7I A;  1A1I A;  2EPZ A;  2RTX A;  3AUZ A;  1BBO A;  4F6N A;  4GZN C;  2MDR A;  2EL5 A;  2VE7 C;  2EJ4 A;  3HXL A;  5AE2 A;  2YTG A;  4YY3 E;  2DSY A;  3JAM C;  4KWY A;  4R2D A;  1QNT A;  4ZYG A;  2YTN A;  4JI8 E;  1HNX E;  5KL2 A;  2YSP A;  1N34 E;  5IWA E;  2WZO A;  5DNY A;  2EPC A;  2NAB A;  4LTY A;  1YYW A;  1ZU1 A;  1MGT A;  3F6G A;  3BBG A;  2NUG A;  1X6E A;  2EM4 A;  2UUC E;  1L4S A;  2E72 A;  1WJP A;  5A6J A;  3EPL A;  4GKK E;  2EMZ A;  3J7A G;  3P1X A;  2MKD A;  2YTF A;  4LFC E;  2EMK A;  2YTJ A;  1XMO E;  4KHP E;  5KL6 A;  2L2K B;  1EKZ A;  2EPO A;  2N3G A;  1UN6 B;  2UXC E;  4X65 E;  2V89 A;  4LF9 E;  4R2C A;  2RQL A;  2EMX A;  4DV7 E;  2ADR A;  2EE8 A;  5AAS A;  2JR1 A;  1SFE A;  2VQF E;  2LTR A;  1IMU A;  4OX9 E;  3OTO E;  1YSA C;  1WRJ A;  1T4O A;  1RQ0 A;  2ELZ A;  2ZM6 E;  3MSW A; 
#chains in the Genus database with same CATH homology
 1P47 A;  2EMY A;  2LV2 A;  2DMI A;  2YRK A;  4IS1 C;  2EMC A;  2EMG A;  3MHS C;  4FK5 C;  2EN6 A;  1AAY A;  3EPH A;  2EPP A;  2ENC A;  2LCE A;  2YTQ A;  1X6H A;  2VRD A;  2EMI A;  2EN1 A;  2MDG A;  2EL4 A;  2EN8 A;  2EOX A;  1G2F C;  2JPA A;  2CTD A;  2D9H A;  3M99 B;  2EP3 A;  2EOM A;  2EN7 A;  2YTO A;  2EM3 A;  1X3C A;  2DGC A;  4M9V C;  2EM9 A;  2DRP A;  2EL6 A;  4R2E A;  4R2Q A;  2EM6 A;  4R2S A;  2BB8 A;  1MEY C;  4IJD A;  2EML A;  2EMA A;  1A1I A;  2EPZ A;  1A1K A;  1BB8 A;  2ENH A;  1BBO A;  2EN2 A;  2EPU A;  2LO3 A;  2YTD A;  3VHT B;  4F6N A;  4F6M A;  4GZN C;  2EL5 A;  1A1G A;  2YTI A;  3UK3 C;  1LLM C;  2EJ4 A;  1TN9 A;  2YU5 A;  2EOF A;  2EOZ A;  1TF3 A;  5KL4 A;  1X5W A;  2YTG A;  2EN3 A;  2YTP A;  1F2I G;  2YTE A;  4R2D A;  2LVH A;  1NCS A;  2EM2 A;  2EOR A;  2WBU A;  2YTN A;  1JK2 A;  2HGH A;  1KJK A;  2GHF A;  5KL2 A;  2YSP A;  2CSH A;  2EQ3 A;  2YRH A;  2RSI A;  2EPC A;  1X6F A;  2RPC A;  5KL3 A;  2NAB A;  2EOS A;  1ZU1 A;  1YUI A;  2DLQ A;  2EOJ A;  2EM8 A;  2EOH A;  1ZR9 A;  1DGC A;  1ZAA C;  2EMB A;  1A1J A;  1X6E A;  2EM4 A;  3MHH C;  1UBD C;  2E72 A;  2EMH A;  1WJP A;  2ENA A;  2EN4 A;  2EOY A;  3EPJ A;  3EPL A;  2EMZ A;  2I13 A;  2WBT A;  2YRM A;  1RMD A;  4R2R A;  2EQ1 A;  5KL5 A;  2MKD A;  1A1L A;  2YTF A;  2EM5 A;  2WCC 3;  2EMK A;  2YTJ A;  2WBS A;  2YU8 A;  1JK1 A;  2ELY A;  2EMF A;  2DLK A;  4F2J C;  5KL6 A;  1UN6 B;  2JP9 A;  5KL7 A;  2R1F A;  4R2A A;  4R2C A;  2EOI A;  2CT1 A;  2EMX A;  2ADR A;  2EE8 A;  2EOQ A;  1A1H A;  2LT7 A;  3EPK A;  1Z1B A;  2EM0 A;  1B69 A;  1A1F A;  2EMW A;  2A25 A;  1G2D C;  2EOE A;  2EOO A;  2EPX A;  2EPA A;  1YUJ A;  2YSO A;  1TF6 A;  2MKN A;  4R2P A;  2EPR A;  2PRT A;  1YSA C;  2EM7 A;  4X9J A;  2M9A A;  4WSG A;  2ELZ A;  2EQ0 A;  2GLI A;  2J7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...