2EM3A

Solution structure of the c2h2 type zinc finger (region 640-672) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECKVCSKAFTQKAHLAQHQKTHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 640-672) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em3A00
1MEYC 2EOIA 2EQ3A 2EP3A 1X3CA 1A1HA 2YTIA 1UN6B 4F2JC 1B69A 2JPAA 1X6HA 2A25A 2RSIA 5KL5A 2WBUA 2EM3A 2EN6A 2ADRA 3UK3C 1F2IG 2EOXA 2EMBA 2EMZA 2EOOA 1A1KA 1A1FA 2YRHA 2EOFA 2EL4A 4R2AA 4WSGA 2EPUA 2EJ4A 2YTQA 1Z1BA 2DMIA 1BB8A 2J7JA 2EOQA 4F6MA 2ENAA 2EMYA 2ENCA 4GZNC 2EMIA 2CT1A 2YTFA 4FK5C 1ZR9A 4X9JA 4R2EA 2CSHA 2EL5A 2YTGA 1P47A 2LV2A 1DGCA 4R2PA 2EN8A 2YTDA 2LT7A 2EPZA 1TF6A 1YUIA 2DGCA 2EN2A 2YRKA 4R2RA 1RMDA 2CTDA 2EQ1A 1TF3A 2YTEA 4R2SA 2D9HA 2BB8A 2YTJA 1TN9A 2EQ0A 2EM8A 2EOHA 1LLMC 2PRTA 2ENHA 2EN7A 3EPKA 1WJPA 2EN3A 2EN4A 2EOMA 1AAYA 2EMXA 2EPCA 4IS1C 2ELZA 2EOSA 3M99B 2EPRA 1A1GA 2VRDA 2YU5A 2EM6A 2EOEA 1A1LA 4M9VC 3EPHA 1ZU1A 1BBOA 2YU8A 1JK2A 1X6FA 2EPXA 2R1FA 1X5WA 4R2DA 2DLQA 2EM0A 2LO3A 2EM7A 2WCC3 1G2DC 1UBDC 2JP9A 5KL2A 1NCSA 2EMCA 2WBTA 2GLIA 2EE8A 2EOZA 1KJKA 2EN1A 2EOJA 3VHTB 2I13A 2RPCA 4R2CA 2YTOA 4IJDA 2EORA 2EMKA 2EMLA 2ELYA 1YUJA 2DLKA 2EM2A 2MKDA 2EL6A 2E72A 2MKNA 2EMAA 3MHSC 5KL4A 2DRPA 2MDGA 2EMHA 2GHFA 2EM9A 2EMFA 2M9AA 2NABA 2EPAA 2EM5A 1A1IA 2EPPA 1JK1A 2YTNA 2YSPA 1YSAC 5KL7A 2WBSA 3EPJA 2EMWA 5KL3A 1G2FC 2LCEA 4R2QA 1X6EA 2YTPA 1ZAAC 2HGHA 2YSOA 2EMGA 1A1JA 2EM4A 2YRMA 2EOYA 4F6NA 2LVHA 5KL6A 3EPLA 3MHHC
chains in the Genus database with same CATH superfamily
1MEYC 2EQ3A 3HXLA 3J7AG 4BHCA 2RSMA 4MLQA 4JYAE 2RSIA 5FLXC 2NUFA 5AE3A 2EN6A 2ADRA 4GKJE 1WHNA 2JY9A 2M4IA 4NXNE 4R2AA 4WSGA 2N8XA 2RS7A 4KZSA 1Z1BA 1N34E 1IMUA 4JI6E 3J81C 4F6MA 1YZ9A 4F54A 3VK6A 1J5EE 4GZNC 1YFHA 1I94E 4FK5C 5AE2A 3VYXA 4R2EA 5ADZA 2L2NA 2EN8A 3OMLA 2LT7A 1TF6A 1YUIA 2DGCA 2YRKA 3ADJA 4R2RA 1RMDA 2EQ1A 1PJSA 2YTEA 4RH8A 2BB8A 3BGHA 1TN9A 2EQ0A 4AQYE 2N3HA 2L2KB 3VYYA 3BIDA 1LLMC 5LLQA 2EN7A 3EPKA 1T4NA 2EN3A 1AAYA 4WYQB 2EPCA 4IS1C 3C6MA 2EM6A 1A1LA 4M9VC 3HQ1A 1BBOA 2YU8A 2EPXA 2R1FA 3IWCA 2DLQA 1UBDC 2EM7A 2LRSA 4DUYE 4X8WA 1NCSA 4JI1E 4YY3E 2EOZA 2EOJA 2I13A 3VHTB 2MC5A 3THOB 2RPCA 3RMPA 4IJDA 2EMKA 4JI4E 2DLKA 3H09A 2N3GA 2EM2A 2MKDA 4NZVA 2EMAA 5CFFE 2VQFE 4P7DA 1FKAE 4X64E 2DRPA 2HC5A 2GHFA 4ZYEA 4R03A 2EMFA 2YWQA 2NABA 2LTRA 2EPAA 4Q35B 1N33E 1JK1A 2I9IA 1WXRA 2UUCE 4I8OA 1AH5A 2V85A 5KL3A 2IHR1 4NXME 2HGHA 1IQSA 5F3WA 1HNZE 4R8OA 2V8QB 5A6BA 2EMGA 2L8TA 2KOUA 3JAMC 1EH8A 4J8ZA 2B3TB 2EOYA 4OOGC 2LVHA 2ZM6E 1RQ0A 4DR3E 4KWYA 2EPMX 4O5GA 5AE1A 4NHRA 1PKPA 4DV5E 2EOIA 3THNA 2EP3A 1X3CA 1A1HA 2YTIA 4F2JC 2JPAA 2JVAA 4WXDA 3UK3C 1F2IG 2EOXA 2R76A 2EMZA 4P78A 1A1KA 1A1FA 2JWOA 2DB2A 2EL4A 2EPUA 2EJ4A 1YYKA 5IXMB 4LF4E 4HTGA 2J7JA 2EOQA 2ENAA 4X66E 2ENCA 3L00A 4O24A 4X9JA 1PJTA 4F9AB 1IQOA 2EWLA 1YYWA 2UXBE 1P47A 2UXDE 3IWBA 3ADGA 2YTDA 4JI0E 1DI2A 2EN2A 3P1XA 2LMZA 2CTDA 2YZTA 2K7IA 4R2SA 2D9HA 3MSWA 2YTJA 4DV4E 2EM8A 2EOHA 1FJGE 2PRTA 4M2ZA 3QG5C 1N36E 4DMIA 2FV4B 4HEIA 2EN4A 1SFEA 3K6QA 2EOSA 2ODRD 3M99B 4LTYA 2EPRA 1A1GA 4O43A 2L6MA 1X6FA 4Q28A 2JOBA 2EM0A 4BC9A 4WPYA 1G2DC 3ADLA 4X65E 2EMCA 2V87A 4B3SE 4WFTA 4BMJA 2LBSB 1L4SA 2EORA 2HJJA 4DUZE 1YUJA 4WXCA 1EH7A 1EH6A 2E72A 2V83A 4LF9E 1UILA 5KL4A 2RTXA 4ZYHA 2LJUA 1A1IA 2EM5A 4M30A 2EPPA 2K4VA 2YSPA 1YSAC 1NEIA 5KL7A 2WBSA 4JI8E 1DQ3A 2EPOA 2LE2A 1G2FC 2LCEA 4R2QA 1X6EA 2NA2A 2YTPA 3LMLA 3AV0A 4LF7E 1MGTA 2CPNA 4BBYA 1X47A 2DIXA 2E5LE 2UUBE 2UXCE 2KONA 5KL6A 3EPLA 3HPZA 2DSYA 2V86A 4RHBB 4L5NC 4LF5E 4M0VA 2WZOA 4O4KA 1UHZA 2WBUA 2EM3A 4DV6E 5LL6R 1IBLE 2YRHA 2RS6A 5IWAE 2YTQA 2KHXA 1BB8A 2NUEA 4JI7E 2EMIA 2CT1A 3KWRA 4LF8E 3C4BA 4JI5E 2YT4A 2EL5A 4WX9A 1HNXE 3DF6A 1DGCA 2L92A 2V88A 3ADIA 2EPZA 1XNRE 1TF3A 1XMQE 2FGGA 3BBGA 3ZOQB 4GEQB 2NUGA 1HR0E 4JI2E 4DR1E 4MLVA 5A6BD 3OTOE 2EOMA 2JR1A 2ELZA 2EPLX 5DNYA 2YU5A 5A69A 4DV0E 2M7QA 2EPKX 1JK2A 4OX9E 3F6GA 2G7HA 4DV3E 4R2DA 1T39A 2WCC3 4LU9A 1ZBTA 4F9BB 2GLIA 4L8NA 5A6AA 4BHBA 1X48A 2M1SA 4R2CA 1ZBQA 5A2QC 2B7TA 4DV7E 2EMLA 2ELYA 5A6KA 3T1HE 3HPSA 4JI3E 4X62E 5BR8E 2L3JA 2MDGA 5AASA 1WHQA 3C6KA 2EMHA 2B7VA 2F4VE 5IV8B 2E1MA 4ZYDA 2RQLA 3KZZA 2YTNA 5IT9C 2EZ6A 2V89A 5LMNE 5T6JA 2MDRA 4DR6E 1X49A 4DR5E 2BBGA 2JXPA 2EM4A 2YRMA 4F6NA 4DR2E 2GPIA 2ODRC 2EPNA 1T38A 1UN6B 3EQ1A 2B9DA 5A6JA 1YYOA 1B69A 2VF1A 1X6HA 2VQEE 4DR7E 2A25A 1QU6A 1KYQA 5KL5A 4DKKA 4LF6E 3ECRA 2EMBA 2EOOA 2EOFA 2F8BA 4LFCE 4DV2E 4LFBE 2DMIA 4N4RB 2LTSA 3LLHA 1GTKA 2EMYA 4KHPE 5LMUE 2VE7C 1SR9A 3JU0A 2YTFA 2Q8UA 4B3TE 1ZR9A 3J7Yp 3HTXA 4B3RE 1PJQA 2CSHA 2LUQA 1N32E 2YTGA 2LV2A 4R2PA 1IBME 1BBGA 3DJWA 1IBKE 4DR4E 4BC7A 3JTZA 1GZ6A 1PDAA 4BS9A 4GKKE 4JV5E 3F6HA 1J26A 2ENHA 1WJPA 4BCAA 2H36X 4K0KE 2EMXA 5AC4A 2L33A 2VRDA 2EOEA 2YPNA 3EPHA 1ZU1A 1T4LB 4YHHE 3KZYA 4ZYGA 1YPNA 1X5WA 1T4OA 4F9CB 2LO3A 3TQMA 3J80C 1XNQE 3T1YE 2JP9A 5KL2A 2WBTA 2EE8A 1KJKA 2EN1A 2HHHE 1STUA 4TUIA 5AC5A 2YTOA 2JOXA 1O0WA 1N3GA 1HNWE 2EL6A 2LJHA 2FTXB 2MKNA 3MHSC 2L2MA 2UU9E 2EM9A 2JYAA 3C4TA 1RC7A 2M9AA 1QNTA 4DV1E 3BF2A 4TUGA 3EPJA 1WRJA 2DMYA 2EMWA 3AUZA 3IWDA 4LFAE 1ZAAC 3FIGA 2YSOA 2UUAE 4B3ME 1XMOE 1A1JA 2L3CA 4WSPA 2LUPB 1EKZA 5TSEA 3MHHC 2MC6A 1GQEA
chains in the Genus database with same CATH topology
1MEYC 2EOIA 2EQ3A 2EP3A 1X3CA 1A1HA 2YTIA 1UN6B 4F2JC 1B69A 2JPAA 1X6HA 2A25A 2RSIA 5KL5A 2WBUA 2EM3A 2EN6A 2ADRA 3UK3C 1F2IG 2EOXA 2EMBA 2EMZA 2EOOA 1A1KA 1A1FA 2YRHA 2EOFA 2EL4A 4R2AA 4WSGA 2EPUA 2EJ4A 2YTQA 1Z1BA 2DMIA 1BB8A 2J7JA 2EOQA 4F6MA 2ENAA 2EMYA 2ENCA 4GZNC 2EMIA 2CT1A 2YTFA 4FK5C 1ZR9A 4X9JA 4R2EA 2CSHA 2EL5A 2YTGA 1P47A 2LV2A 1DGCA 4R2PA 2EN8A 2YTDA 2LT7A 2EPZA 1TF6A 1YUIA 2DGCA 2EN2A 2YRKA 4R2RA 1RMDA 2CTDA 2EQ1A 1TF3A 2YTEA 4R2SA 2D9HA 2BB8A 2YTJA 1TN9A 2EQ0A 2EM8A 2EOHA 1LLMC 2PRTA 2ENHA 2EN7A 3EPKA 1WJPA 2EN3A 2EN4A 2EOMA 1AAYA 2EMXA 2EPCA 4IS1C 2ELZA 2EOSA 3M99B 2EPRA 1A1GA 2VRDA 2YU5A 2EM6A 2EOEA 1A1LA 4M9VC 3EPHA 1ZU1A 1BBOA 2YU8A 1JK2A 1X6FA 2EPXA 2R1FA 1X5WA 4R2DA 2DLQA 2EM0A 2LO3A 2EM7A 2WCC3 1G2DC 1UBDC 2JP9A 5KL2A 1NCSA 2EMCA 2WBTA 2GLIA 2EE8A 2EOZA 1KJKA 2EN1A 2EOJA 3VHTB 2I13A 2RPCA 4R2CA 2YTOA 4IJDA 2EORA 2EMKA 2EMLA 2ELYA 1YUJA 2DLKA 2EM2A 2MKDA 2EL6A 2E72A 2MKNA 2EMAA 3MHSC 5KL4A 2DRPA 2MDGA 2EMHA 2GHFA 2EM9A 2EMFA 2M9AA 2NABA 2EPAA 2EM5A 1A1IA 2EPPA 1JK1A 2YTNA 2YSPA 1YSAC 5KL7A 2WBSA 3EPJA 2EMWA 5KL3A 1G2FC 2LCEA 4R2QA 1X6EA 2YTPA 1ZAAC 2HGHA 2YSOA 2EMGA 1A1JA 2EM4A 2YRMA 2EOYA 4F6NA 2LVHA 5KL6A 3EPLA 3MHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEY C;  2EOI A;  2EQ3 A;  2EP3 A;  1X3C A;  1A1H A;  2YTI A;  1UN6 B;  4F2J C;  1B69 A;  2JPA A;  1X6H A;  2A25 A;  2RSI A;  5KL5 A;  2WBU A;  2EM3 A;  2EN6 A;  2ADR A;  3UK3 C;  1F2I G;  2EOX A;  2EMB A;  2EMZ A;  2EOO A;  1A1K A;  1A1F A;  2YRH A;  2EOF A;  2EL4 A;  4R2A A;  4WSG A;  2EPU A;  2EJ4 A;  2YTQ A;  1Z1B A;  2DMI A;  1BB8 A;  2J7J A;  2EOQ A;  4F6M A;  2ENA A;  2EMY A;  2ENC A;  4GZN C;  2EMI A;  2CT1 A;  2YTF A;  4FK5 C;  1ZR9 A;  4X9J A;  4R2E A;  2CSH A;  2EL5 A;  2YTG A;  1P47 A;  2LV2 A;  1DGC A;  4R2P A;  2EN8 A;  2YTD A;  2LT7 A;  2EPZ A;  1TF6 A;  1YUI A;  2DGC A;  2EN2 A;  2YRK A;  4R2R A;  1RMD A;  2CTD A;  2EQ1 A;  1TF3 A;  2YTE A;  4R2S A;  2D9H A;  2BB8 A;  2YTJ A;  1TN9 A;  2EQ0 A;  2EM8 A;  2EOH A;  1LLM C;  2PRT A;  2ENH A;  2EN7 A;  3EPK A;  1WJP A;  2EN3 A;  2EN4 A;  2EOM A;  1AAY A;  2EMX A;  2EPC A;  4IS1 C;  2ELZ A;  2EOS A;  3M99 B;  2EPR A;  1A1G A;  2VRD A;  2YU5 A;  2EM6 A;  2EOE A;  1A1L A;  4M9V C;  3EPH A;  1ZU1 A;  1BBO A;  2YU8 A;  1JK2 A;  1X6F A;  2EPX A;  2R1F A;  1X5W A;  4R2D A;  2DLQ A;  2EM0 A;  2LO3 A;  2EM7 A;  2WCC 3;  1G2D C;  1UBD C;  2JP9 A;  5KL2 A;  1NCS A;  2EMC A;  2WBT A;  2GLI A;  2EE8 A;  2EOZ A;  1KJK A;  2EN1 A;  2EOJ A;  3VHT B;  2I13 A;  2RPC A;  4R2C A;  2YTO A;  4IJD A;  2EOR A;  2EMK A;  2EML A;  2ELY A;  1YUJ A;  2DLK A;  2EM2 A;  2MKD A;  2EL6 A;  2E72 A;  2MKN A;  2EMA A;  3MHS C;  5KL4 A;  2DRP A;  2MDG A;  2EMH A;  2GHF A;  2EM9 A;  2EMF A;  2M9A A;  2NAB A;  2EPA A;  2EM5 A;  1A1I A;  2EPP A;  1JK1 A;  2YTN A;  2YSP A;  1YSA C;  5KL7 A;  2WBS A;  3EPJ A;  2EMW A;  5KL3 A;  1G2F C;  2LCE A;  4R2Q A;  1X6E A;  2YTP A;  1ZAA C;  2HGH A;  2YSO A;  2EMG A;  1A1J A;  2EM4 A;  2YRM A;  2EOY A;  4F6N A;  2LVH A;  5KL6 A;  3EPL A;  3MHH C; 
#chains in the Genus database with same CATH topology
 1MEY C;  2EQ3 A;  3HXL A;  3J7A G;  4BHC A;  2RSM A;  4MLQ A;  4JYA E;  2RSI A;  5FLX C;  2NUF A;  5AE3 A;  2EN6 A;  2ADR A;  4GKJ E;  1WHN A;  2JY9 A;  2M4I A;  4NXN E;  4R2A A;  4WSG A;  2N8X A;  2RS7 A;  4KZS A;  1Z1B A;  1N34 E;  1IMU A;  4JI6 E;  3J81 C;  4F6M A;  1YZ9 A;  4F54 A;  3VK6 A;  1J5E E;  4GZN C;  1YFH A;  1I94 E;  4FK5 C;  5AE2 A;  3VYX A;  4R2E A;  5ADZ A;  2L2N A;  2EN8 A;  3OML A;  2LT7 A;  1TF6 A;  1YUI A;  2DGC A;  2YRK A;  3ADJ A;  4R2R A;  1RMD A;  2EQ1 A;  1PJS A;  2YTE A;  4RH8 A;  2BB8 A;  3BGH A;  1TN9 A;  2EQ0 A;  4AQY E;  2N3H A;  2L2K B;  3VYY A;  3BID A;  1LLM C;  5LLQ A;  2EN7 A;  3EPK A;  1T4N A;  2EN3 A;  1AAY A;  4WYQ B;  2EPC A;  4IS1 C;  3C6M A;  2EM6 A;  1A1L A;  4M9V C;  3HQ1 A;  1BBO A;  2YU8 A;  2EPX A;  2R1F A;  3IWC A;  2DLQ A;  1UBD C;  2EM7 A;  2LRS A;  4DUY E;  4X8W A;  1NCS A;  4JI1 E;  4YY3 E;  2EOZ A;  2EOJ A;  2I13 A;  3VHT B;  2MC5 A;  3THO B;  2RPC A;  3RMP A;  4IJD A;  2EMK A;  4JI4 E;  2DLK A;  3H09 A;  2N3G A;  2EM2 A;  2MKD A;  4NZV A;  2EMA A;  5CFF E;  2VQF E;  4P7D A;  1FKA E;  4X64 E;  2DRP A;  2HC5 A;  2GHF A;  4ZYE A;  4R03 A;  2EMF A;  2YWQ A;  2NAB A;  2LTR A;  2EPA A;  4Q35 B;  1N33 E;  1JK1 A;  2I9I A;  1WXR A;  2UUC E;  4I8O A;  1AH5 A;  2V85 A;  5KL3 A;  2IHR 1;  4NXM E;  2HGH A;  1IQS A;  5F3W A;  1HNZ E;  4R8O A;  2V8Q B;  5A6B A;  2EMG A;  2L8T A;  2KOU A;  3JAM C;  1EH8 A;  4J8Z A;  2B3T B;  2EOY A;  4OOG C;  2LVH A;  2ZM6 E;  1RQ0 A;  4DR3 E;  4KWY A;  2EPM X;  4O5G A;  5AE1 A;  4NHR A;  1PKP A;  4DV5 E;  2EOI A;  3THN A;  2EP3 A;  1X3C A;  1A1H A;  2YTI A;  4F2J C;  2JPA A;  2JVA A;  4WXD A;  3UK3 C;  1F2I G;  2EOX A;  2R76 A;  2EMZ A;  4P78 A;  1A1K A;  1A1F A;  2JWO A;  2DB2 A;  2EL4 A;  2EPU A;  2EJ4 A;  1YYK A;  5IXM B;  4LF4 E;  4HTG A;  2J7J A;  2EOQ A;  2ENA A;  4X66 E;  2ENC A;  3L00 A;  4O24 A;  4X9J A;  1PJT A;  4F9A B;  1IQO A;  2EWL A;  1YYW A;  2UXB E;  1P47 A;  2UXD E;  3IWB A;  3ADG A;  2YTD A;  4JI0 E;  1DI2 A;  2EN2 A;  3P1X A;  2LMZ A;  2CTD A;  2YZT A;  2K7I A;  4R2S A;  2D9H A;  3MSW A;  2YTJ A;  4DV4 E;  2EM8 A;  2EOH A;  1FJG E;  2PRT A;  4M2Z A;  3QG5 C;  1N36 E;  4DMI A;  2FV4 B;  4HEI A;  2EN4 A;  1SFE A;  3K6Q A;  2EOS A;  2ODR D;  3M99 B;  4LTY A;  2EPR A;  1A1G A;  4O43 A;  2L6M A;  1X6F A;  4Q28 A;  2JOB A;  2EM0 A;  4BC9 A;  4WPY A;  1G2D C;  3ADL A;  4X65 E;  2EMC A;  2V87 A;  4B3S E;  4WFT A;  4BMJ A;  2LBS B;  1L4S A;  2EOR A;  2HJJ A;  4DUZ E;  1YUJ A;  4WXC A;  1EH7 A;  1EH6 A;  2E72 A;  2V83 A;  4LF9 E;  1UIL A;  5KL4 A;  2RTX A;  4ZYH A;  2LJU A;  1A1I A;  2EM5 A;  4M30 A;  2EPP A;  2K4V A;  2YSP A;  1YSA C;  1NEI A;  5KL7 A;  2WBS A;  4JI8 E;  1DQ3 A;  2EPO A;  2LE2 A;  1G2F C;  2LCE A;  4R2Q A;  1X6E A;  2NA2 A;  2YTP A;  3LML A;  3AV0 A;  4LF7 E;  1MGT A;  2CPN A;  4BBY A;  1X47 A;  2DIX A;  2E5L E;  2UUB E;  2UXC E;  2KON A;  5KL6 A;  3EPL A;  3HPZ A;  2DSY A;  2V86 A;  4RHB B;  4L5N C;  4LF5 E;  4M0V A;  2WZO A;  4O4K A;  1UHZ A;  2WBU A;  2EM3 A;  4DV6 E;  5LL6 R;  1IBL E;  2YRH A;  2RS6 A;  5IWA E;  2YTQ A;  2KHX A;  1BB8 A;  2NUE A;  4JI7 E;  2EMI A;  2CT1 A;  3KWR A;  4LF8 E;  3C4B A;  4JI5 E;  2YT4 A;  2EL5 A;  4WX9 A;  1HNX E;  3DF6 A;  1DGC A;  2L92 A;  2V88 A;  3ADI A;  2EPZ A;  1XNR E;  1TF3 A;  1XMQ E;  2FGG A;  3BBG A;  3ZOQ B;  4GEQ B;  2NUG A;  1HR0 E;  4JI2 E;  4DR1 E;  4MLV A;  5A6B D;  3OTO E;  2EOM A;  2JR1 A;  2ELZ A;  2EPL X;  5DNY A;  2YU5 A;  5A69 A;  4DV0 E;  2M7Q A;  2EPK X;  1JK2 A;  4OX9 E;  3F6G A;  2G7H A;  4DV3 E;  4R2D A;  1T39 A;  2WCC 3;  4LU9 A;  1ZBT A;  4F9B B;  2GLI A;  4L8N A;  5A6A A;  4BHB A;  1X48 A;  2M1S A;  4R2C A;  1ZBQ A;  5A2Q C;  2B7T A;  4DV7 E;  2EML A;  2ELY A;  5A6K A;  3T1H E;  3HPS A;  4JI3 E;  4X62 E;  5BR8 E;  2L3J A;  2MDG A;  5AAS A;  1WHQ A;  3C6K A;  2EMH A;  2B7V A;  2F4V E;  5IV8 B;  2E1M A;  4ZYD A;  2RQL A;  3KZZ A;  2YTN A;  5IT9 C;  2EZ6 A;  2V89 A;  5LMN E;  5T6J A;  2MDR A;  4DR6 E;  1X49 A;  4DR5 E;  2BBG A;  2JXP A;  2EM4 A;  2YRM A;  4F6N A;  4DR2 E;  2GPI A;  2ODR C;  2EPN A;  1T38 A;  1UN6 B;  3EQ1 A;  2B9D A;  5A6J A;  1YYO A;  1B69 A;  2VF1 A;  1X6H A;  2VQE E;  4DR7 E;  2A25 A;  1QU6 A;  1KYQ A;  5KL5 A;  4DKK A;  4LF6 E;  3ECR A;  2EMB A;  2EOO A;  2EOF A;  2F8B A;  4LFC E;  4DV2 E;  4LFB E;  2DMI A;  4N4R B;  2LTS A;  3LLH A;  1GTK A;  2EMY A;  4KHP E;  5LMU E;  2VE7 C;  1SR9 A;  3JU0 A;  2YTF A;  2Q8U A;  4B3T E;  1ZR9 A;  3J7Y p;  3HTX A;  4B3R E;  1PJQ A;  2CSH A;  2LUQ A;  1N32 E;  2YTG A;  2LV2 A;  4R2P A;  1IBM E;  1BBG A;  3DJW A;  1IBK E;  4DR4 E;  4BC7 A;  3JTZ A;  1GZ6 A;  1PDA A;  4BS9 A;  4GKK E;  4JV5 E;  3F6H A;  1J26 A;  2ENH A;  1WJP A;  4BCA A;  2H36 X;  4K0K E;  2EMX A;  5AC4 A;  2L33 A;  2VRD A;  2EOE A;  2YPN A;  3EPH A;  1ZU1 A;  1T4L B;  4YHH E;  3KZY A;  4ZYG A;  1YPN A;  1X5W A;  1T4O A;  4F9C B;  2LO3 A;  3TQM A;  3J80 C;  1XNQ E;  3T1Y E;  2JP9 A;  5KL2 A;  2WBT A;  2EE8 A;  1KJK A;  2EN1 A;  2HHH E;  1STU A;  4TUI A;  5AC5 A;  2YTO A;  2JOX A;  1O0W A;  1N3G A;  1HNW E;  2EL6 A;  2LJH A;  2FTX B;  2MKN A;  3MHS C;  2L2M A;  2UU9 E;  2EM9 A;  2JYA A;  3C4T A;  1RC7 A;  2M9A A;  1QNT A;  4DV1 E;  3BF2 A;  4TUG A;  3EPJ A;  1WRJ A;  2DMY A;  2EMW A;  3AUZ A;  3IWD A;  4LFA E;  1ZAA C;  3FIG A;  2YSO A;  2UUA E;  4B3M E;  1XMO E;  1A1J A;  2L3C A;  4WSP A;  2LUP B;  1EKZ A;  5TSE A;  3MHH C;  2MC6 A;  1GQE A; 
#chains in the Genus database with same CATH homology
 1MEY C;  2EOI A;  2EQ3 A;  2EP3 A;  1X3C A;  1A1H A;  2YTI A;  1UN6 B;  4F2J C;  1B69 A;  2JPA A;  1X6H A;  2A25 A;  2RSI A;  5KL5 A;  2WBU A;  2EM3 A;  2EN6 A;  2ADR A;  3UK3 C;  1F2I G;  2EOX A;  2EMB A;  2EMZ A;  2EOO A;  1A1K A;  1A1F A;  2YRH A;  2EOF A;  2EL4 A;  4R2A A;  4WSG A;  2EPU A;  2EJ4 A;  2YTQ A;  1Z1B A;  2DMI A;  1BB8 A;  2J7J A;  2EOQ A;  4F6M A;  2ENA A;  2EMY A;  2ENC A;  4GZN C;  2EMI A;  2CT1 A;  2YTF A;  4FK5 C;  1ZR9 A;  4X9J A;  4R2E A;  2CSH A;  2EL5 A;  2YTG A;  1P47 A;  2LV2 A;  1DGC A;  4R2P A;  2EN8 A;  2YTD A;  2LT7 A;  2EPZ A;  1TF6 A;  1YUI A;  2DGC A;  2EN2 A;  2YRK A;  4R2R A;  1RMD A;  2CTD A;  2EQ1 A;  1TF3 A;  2YTE A;  4R2S A;  2D9H A;  2BB8 A;  2YTJ A;  1TN9 A;  2EQ0 A;  2EM8 A;  2EOH A;  1LLM C;  2PRT A;  2ENH A;  2EN7 A;  3EPK A;  1WJP A;  2EN3 A;  2EN4 A;  2EOM A;  1AAY A;  2EMX A;  2EPC A;  4IS1 C;  2ELZ A;  2EOS A;  3M99 B;  2EPR A;  1A1G A;  2VRD A;  2YU5 A;  2EM6 A;  2EOE A;  1A1L A;  4M9V C;  3EPH A;  1ZU1 A;  1BBO A;  2YU8 A;  1JK2 A;  1X6F A;  2EPX A;  2R1F A;  1X5W A;  4R2D A;  2DLQ A;  2EM0 A;  2LO3 A;  2EM7 A;  2WCC 3;  1G2D C;  1UBD C;  2JP9 A;  5KL2 A;  1NCS A;  2EMC A;  2WBT A;  2GLI A;  2EE8 A;  2EOZ A;  1KJK A;  2EN1 A;  2EOJ A;  3VHT B;  2I13 A;  2RPC A;  4R2C A;  2YTO A;  4IJD A;  2EOR A;  2EMK A;  2EML A;  2ELY A;  1YUJ A;  2DLK A;  2EM2 A;  2MKD A;  2EL6 A;  2E72 A;  2MKN A;  2EMA A;  3MHS C;  5KL4 A;  2DRP A;  2MDG A;  2EMH A;  2GHF A;  2EM9 A;  2EMF A;  2M9A A;  2NAB A;  2EPA A;  2EM5 A;  1A1I A;  2EPP A;  1JK1 A;  2YTN A;  2YSP A;  1YSA C;  5KL7 A;  2WBS A;  3EPJ A;  2EMW A;  5KL3 A;  1G2F C;  2LCE A;  4R2Q A;  1X6E A;  2YTP A;  1ZAA C;  2HGH A;  2YSO A;  2EMG A;  1A1J A;  2EM4 A;  2YRM A;  2EOY A;  4F6N A;  2LVH A;  5KL6 A;  3EPL A;  3MHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...