2EN4A

Solution structure of the c2h2 type zinc finger (region 284-316) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTKEKPYKCYECGKAFRTRSNLTTHQVIHTGEKRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 284-316) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en4A01
2EORA 2WBUA 2DLQA 2EPXA 1DGCA 2EM6A 2EQ0A 2NABA 2ELYA 2EMAA 2EN4A 2LCEA 4WSGA 1TF6A 1A1KA 1X6HA 2EN6A 2YSOA 4R2CA 1A1FA 2EOYA 2MKDA 2EOMA 2BB8A 2CSHA 2EM4A 2YTDA 2CTDA 2PRTA 2EN7A 2EQ3A 2J7JA 2EN8A 2A25A 5KL3A 4FK5C 2EL5A 2EL4A 1BB8A 2YSPA 1LLMC 3UK3C 1A1HA 4F6NA 2VRDA 2MDGA 1A1IA 1TN9A 4IJDA 2YTQA 1X5WA 1RMDA 2WCC3 1UN6B 2EMKA 4R2SA 2DLKA 2EMFA 2MKNA 1KJKA 2E72A 4X9JA 4F6MA 3M99B 1WJPA 2YTJA 2EMCA 1X6EA 2RPCA 1YUJA 2YTNA 1TF3A 5KL2A 3EPJA 1NCSA 2I13A 2EOIA 2YTPA 1ZU1A 5KL4A 2EM7A 2EOSA 1YSAC 2ENHA 4F2JC 3VHTB 2EM5A 2EN2A 2EM2A 2WBSA 2EOZA 4M9VC 2ENCA 2YTGA 2ELZA 1AAYA 2EPAA 2EMLA 2EMYA 1JK1A 2DRPA 3MHSC 2EJ4A 2M9AA 2EM8A 2EM9A 1MEYC 2EOXA 4R2QA 2EPZA 1P47A 4GZNC 5KL5A 2EMHA 2YTEA 2EPUA 2YTIA 1A1LA 2EL6A 4R2DA 1G2FC 2GLIA 2EMGA 2EMXA 2WBTA 3EPLA 2EMZA 2HGHA 2EE8A 2D9HA 3MHHC 2EOEA 2JP9A 2LV2A 1F2IG 1A1JA 2YRHA 2EMWA 2LO3A 2EOHA 2YU8A 1JK2A 1BBOA 2YRMA 1G2DC 2EN3A 1X6FA 1A1GA 2EOOA 2DMIA 4IS1C 2YU5A 2YRKA 2LVHA 1UBDC 2EMIA 2EPCA 1X3CA 2CT1A 4R2PA 2EM3A 2JPAA 2EQ1A 5KL6A 2ENAA 2EPPA 4R2AA 2EPRA 2YTFA 2R1FA 2EOQA 1B69A 2EN1A 2LT7A 1Z1BA 2EOFA 2DGCA 3EPKA 2ADRA 2EP3A 4R2EA 3EPHA 2EOJA 2YTOA 2EM0A 4R2RA 1ZR9A 1YUIA 1ZAAC 2EMBA 2RSIA 2GHFA 5KL7A
chains in the Genus database with same CATH superfamily
2WBUA 4HTGA 3J7Yp 2JYAA 4Q28A 2YPNA 2EM6A 4X66E 2EQ0A 2EN4A 2LCEA 1A1KA 4J8ZA 1YPNA 3IWCA 4R2CA 4OX9E 2EOMA 4F9BB 2EM4A 2CTDA 2M4IA 4GEQB 1T4NA 4LF7E 2A25A 5KL3A 1ZBTA 2EPKX 2KONA 1BB8A 2HJJA 2YSPA 1LLMC 1A1HA 4LFCE 4DR4E 1PKPA 2ODRD 1XMQE 3JAMC 1T39A 5LL6R 1X5WA 2WCC3 2CPNA 1STUA 2L6MA 2LUPB 4R03A 3BBGA 5AE3A 3J81C 4RHBB 3HQ1A 4DV6E 4F6MA 2YTJA 2RPCA 4LTYA 1X48A 4WX9A 4DUYE 5KL2A 2K7IA 2MC5A 1J26A 5BR8E 4NZVA 3KZYA 2E1MA 2EM7A 5AE2A 1YSAC 4BBYA 4TUIA 4JI5E 4F2JC 2EN2A 2K4VA 3KZZA 3LMLA 4M0VA 2ENCA 1PJTA 2ELZA 2V87A 1AAYA 2EMYA 1IBLE 2EM9A 2EWLA 2UU9E 4LFBE 1MEYC 3TQMA 2EMHA 2EPUA 3DJWA 2EMZA 2JVAA 4JI3E 3MHHC 5ADZA 4GKKE 2JP9A 2UUCE 1DI2A 1HR0E 2L8TA 3BGHA 1F2IG 4KHPE 4O24A 5AC5A 2YU8A 1G2DC 4M2ZA 4IS1C 2YU5A 2LVHA 3BF2A 1IQSA 4M30A 2EPCA 2I9IA 1WXRA 1IQOA 4R2PA 4DV3E 2JPAA 2LRSA 3OTOE 3HPSA 2VE7C 4R2AA 3HPZA 3H09A 2LTSA 1T4LB 2LT7A 2EOFA 1KYQA 2VQFE 1BBGA 1YUIA 2V85A 1X49A 2L2MA 2DLQA 5IWAE 4BCAA 4KZSA 4LFAE 1N33E 1TF6A 3J7AG 4JI2E 2UXDE 2DMYA 2EN6A 1IBME 1A1FA 2EOYA 3T1HE 1I94E 2DIXA 4B3TE 2YTDA 2EQ3A 2L2KB 2EN8A 4JV5E 1UILA 5LMUE 2EL5A 4TUGA 2MDGA 2N8XA 2EZ6A 4IJDA 4K0KE 2G7HA 3JU0A 1EH6A 2FV4B 1UN6B 4R2SA 2NA2A 3BIDA 2B3TB 1WHNA 2MDRA 3C6MA 3DF6A 1KJKA 4BHCA 4X9JA 1SR9A 3M99B 4O4KA 2LUQA 5AE1A 4L5NC 2EPLX 2YWQA 1NCSA 1WHQA 5T6JA 2YTPA 2RTXA 2EOSA 2NUFA 2EM5A 2EOZA 2LTRA 4ZYEA 2B7TA 1FKAE 3HTXA 2YTGA 4WFTA 4B3SE 1PDAA 1EH7A 3MHSC 1YZ9A 4JYAE 2M9AA 3C6KA 2N3GA 2EOXA 1P47A 2EPZA 4GZNC 3ADGA 5KL5A 1YYOA 2JR1A 2EL6A 2IHR1 2ODRC 3ADLA 2GLIA 3IWBA 2EMGA 2EMXA 2WBTA 4BC9A 1NEIA 4WXCA 2UUBE 2D9HA 2EOEA 2JOXA 5F3WA 3IWDA 3F6HA 4WSPA 4F9AB 2L3JA 1A1JA 2KOUA 3ADJA 2JWOA 3P1XA 2EMWA 2EOHA 1BBOA 4NXME 1XNQE 2YRMA 4GKJE 2EN3A 3C4TA 3ADIA 3F6GA 4F9CB 2YRKA 4X62E 1UBDC 4HEIA 4JI4E 2LE2A 2UUAE 1WRJA 2EQ1A 4LU9A 2DB2A 2ENAA 5A6BD 3FIGA 5AASA 2L33A 1B69A 4DR2E 4X65E 1IBKE 3EPKA 2DSYA 4YY3E 2EP3A 4R2EA 2RQLA 2YTOA 4P78A 4R2RA 2UXCE 1ZR9A 5A6AA 1ZAAC 4X8WA 2RSIA 4DUZE 2GHFA 4R8OA 2EORA 4F54A 3KWRA 1YYKA 1DGCA 3AV0A 4ZYHA 2R76A 2NABA 2ELYA 4WSGA 1X6HA 3LLHA 2MKDA 1HNXE 4AQYE 2BB8A 2PRTA 2EN7A 3C4BA 2EPMX 2J7JA 2MC6A 4KWYA 4BS9A 4FK5C 5A6JA 2LBSB 2FGGA 3K6QA 4F6NA 2VRDA 1A1IA 1TN9A 2EPOA 1T4OA 4O43A 4LF9E 2YTQA 1RMDA 2Q8UA 1EKZA 1WJPA 1X6EA 2B9DA 1YUJA 2YTNA 3AUZA 5IXMB 4DV4E 3EPJA 5A6BA 5A2QC 2EOIA 5FLXC 2FTXB 1ZU1A 5CFFE 3EQ1A 2V88A 2EM2A 5IV8B 2WBSA 2LJUA 1AH5A 2KHXA 2EPAA 2L92A 1EH8A 3THOB 4WXDA 4B3ME 1YYWA 2V8QB 2YTEA 1A1LA 4NXNE 2EPNA 4DR5E 4NHRA 1L4SA 1FJGE 4DMIA 4R2DA 3EPLA 4MLQA 2EE8A 2ZM6E 4JI0E 5DNYA 2YRHA 1JK2A 4JI1E 4OOGC 2JOBA 1X6FA 1A1GA 2DMIA 3MSWA 1PJSA 4L8NA 2NUEA 2UXBE 2RS6A 1N36E 3QG5C 3OMLA 4LF4E 2EM3A 5KL6A 2HHHE 2EPPA 2EPRA 5LMNE 4ZYDA 2EOQA 3RMPA 2ADRA 2YT4A 4O5GA 4BC7A 3EPHA 2EOJA 2EM0A 4ZYGA 2M1SA 4RH8A 2EMBA 4BMJA 2B7VA 5KL7A 2V89A 1N3GA 1ZBQA 2EPXA 4Q35B 2E5LE 4DV0E 1QU6A 2EMAA 2V83A 2V86A 4DKKA 2VQEE 5A69A 2YSOA 4YHHE 1RC7A 1RQ0A 4DV5E 2RS7A 2L2NA 5IT9C 1O0WA 2CSHA 2BBGA 2H36X 2M7QA 2N3HA 2EL4A 2F4VE 1T38A 3UK3C 3J80C 1DQ3A 2L3CA 2EMKA 4DR6E 3VK6A 4P7DA 2F8BA 2DLKA 2EMFA 2MKNA 2E72A 2EMCA 1TF3A 4JI7E 2WZOA 4LF6E 2I13A 1N34E 5KL4A 4DR3E 2ENHA 3VHTB 5A6KA 2RSMA 2GPIA 4M9VC 1MGTA 1X47A 1IMUA 1HNZE 2EMLA 1JK1A 3JTZA 2DRPA 2EJ4A 2EM8A 1QNTA 4R2QA 2YTIA 2NUGA 4DV1E 1SFEA 5TSEA 1G2FC 4LF8E 1YFHA 2YZTA 1GZ6A 2HGHA 2LJHA 2JXPA 4B3RE 2LV2A 5LLQA 1N32E 4BHBA 3HXLA 4WYQB 2HC5A 2LO3A 3ZOQB 3ECRA 2EOOA 1XNRE 4X64E 1J5EE 4DR7E 2VF1A 5AC4A 4WPYA 2EMIA 1UHZA 1X3CA 2CT1A 3THNA 3VYXA 4N4RB 1XMOE 1GQEA 3T1YE 4I8OA 2YTFA 2R1FA 2LMZA 4DV2E 4MLVA 2EN1A 3VYYA 1Z1BA 2DGCA 4JI8E 1PJQA 4JI6E 2JY9A 3L00A 4LF5E 4DV7E 4DR1E 1GTKA 1HNWE
chains in the Genus database with same CATH topology
2EORA 2WBUA 2DLQA 2EPXA 1DGCA 2EM6A 2EQ0A 2NABA 2ELYA 2EMAA 2EN4A 2LCEA 4WSGA 1TF6A 1A1KA 1X6HA 2EN6A 2YSOA 4R2CA 1A1FA 2EOYA 2MKDA 2EOMA 2BB8A 2CSHA 2EM4A 2YTDA 2CTDA 2PRTA 2EN7A 2EQ3A 2J7JA 2EN8A 2A25A 5KL3A 4FK5C 2EL5A 2EL4A 1BB8A 2YSPA 1LLMC 3UK3C 1A1HA 4F6NA 2VRDA 2MDGA 1A1IA 1TN9A 4IJDA 2YTQA 1X5WA 1RMDA 2WCC3 1UN6B 2EMKA 4R2SA 2DLKA 2EMFA 2MKNA 1KJKA 2E72A 4X9JA 4F6MA 3M99B 1WJPA 2YTJA 2EMCA 1X6EA 2RPCA 1YUJA 2YTNA 1TF3A 5KL2A 3EPJA 1NCSA 2I13A 2EOIA 2YTPA 1ZU1A 5KL4A 2EM7A 2EOSA 1YSAC 2ENHA 4F2JC 3VHTB 2EM5A 2EN2A 2EM2A 2WBSA 2EOZA 4M9VC 2ENCA 2YTGA 2ELZA 1AAYA 2EPAA 2EMLA 2EMYA 1JK1A 2DRPA 3MHSC 2EJ4A 2M9AA 2EM8A 2EM9A 1MEYC 2EOXA 4R2QA 2EPZA 1P47A 4GZNC 5KL5A 2EMHA 2YTEA 2EPUA 2YTIA 1A1LA 2EL6A 4R2DA 1G2FC 2GLIA 2EMGA 2EMXA 2WBTA 3EPLA 2EMZA 2HGHA 2EE8A 2D9HA 3MHHC 2EOEA 2JP9A 2LV2A 1F2IG 1A1JA 2YRHA 2EMWA 2LO3A 2EOHA 2YU8A 1JK2A 1BBOA 2YRMA 1G2DC 2EN3A 1X6FA 1A1GA 2EOOA 2DMIA 4IS1C 2YU5A 2YRKA 2LVHA 1UBDC 2EMIA 2EPCA 1X3CA 2CT1A 4R2PA 2EM3A 2JPAA 2EQ1A 5KL6A 2ENAA 2EPPA 4R2AA 2EPRA 2YTFA 2R1FA 2EOQA 1B69A 2EN1A 2LT7A 1Z1BA 2EOFA 2DGCA 3EPKA 2ADRA 2EP3A 4R2EA 3EPHA 2EOJA 2YTOA 2EM0A 4R2RA 1ZR9A 1YUIA 1ZAAC 2EMBA 2RSIA 2GHFA 5KL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOR A;  2WBU A;  2DLQ A;  2EPX A;  1DGC A;  2EM6 A;  2EQ0 A;  2NAB A;  2ELY A;  2EMA A;  2EN4 A;  2LCE A;  4WSG A;  1TF6 A;  1A1K A;  1X6H A;  2EN6 A;  2YSO A;  4R2C A;  1A1F A;  2EOY A;  2MKD A;  2EOM A;  2BB8 A;  2CSH A;  2EM4 A;  2YTD A;  2CTD A;  2PRT A;  2EN7 A;  2EQ3 A;  2J7J A;  2EN8 A;  2A25 A;  5KL3 A;  4FK5 C;  2EL5 A;  2EL4 A;  1BB8 A;  2YSP A;  1LLM C;  3UK3 C;  1A1H A;  4F6N A;  2VRD A;  2MDG A;  1A1I A;  1TN9 A;  4IJD A;  2YTQ A;  1X5W A;  1RMD A;  2WCC 3;  1UN6 B;  2EMK A;  4R2S A;  2DLK A;  2EMF A;  2MKN A;  1KJK A;  2E72 A;  4X9J A;  4F6M A;  3M99 B;  1WJP A;  2YTJ A;  2EMC A;  1X6E A;  2RPC A;  1YUJ A;  2YTN A;  1TF3 A;  5KL2 A;  3EPJ A;  1NCS A;  2I13 A;  2EOI A;  2YTP A;  1ZU1 A;  5KL4 A;  2EM7 A;  2EOS A;  1YSA C;  2ENH A;  4F2J C;  3VHT B;  2EM5 A;  2EN2 A;  2EM2 A;  2WBS A;  2EOZ A;  4M9V C;  2ENC A;  2YTG A;  2ELZ A;  1AAY A;  2EPA A;  2EML A;  2EMY A;  1JK1 A;  2DRP A;  3MHS C;  2EJ4 A;  2M9A A;  2EM8 A;  2EM9 A;  1MEY C;  2EOX A;  4R2Q A;  2EPZ A;  1P47 A;  4GZN C;  5KL5 A;  2EMH A;  2YTE A;  2EPU A;  2YTI A;  1A1L A;  2EL6 A;  4R2D A;  1G2F C;  2GLI A;  2EMG A;  2EMX A;  2WBT A;  3EPL A;  2EMZ A;  2HGH A;  2EE8 A;  2D9H A;  3MHH C;  2EOE A;  2JP9 A;  2LV2 A;  1F2I G;  1A1J A;  2YRH A;  2EMW A;  2LO3 A;  2EOH A;  2YU8 A;  1JK2 A;  1BBO A;  2YRM A;  1G2D C;  2EN3 A;  1X6F A;  1A1G A;  2EOO A;  2DMI A;  4IS1 C;  2YU5 A;  2YRK A;  2LVH A;  1UBD C;  2EMI A;  2EPC A;  1X3C A;  2CT1 A;  4R2P A;  2EM3 A;  2JPA A;  2EQ1 A;  5KL6 A;  2ENA A;  2EPP A;  4R2A A;  2EPR A;  2YTF A;  2R1F A;  2EOQ A;  1B69 A;  2EN1 A;  2LT7 A;  1Z1B A;  2EOF A;  2DGC A;  3EPK A;  2ADR A;  2EP3 A;  4R2E A;  3EPH A;  2EOJ A;  2YTO A;  2EM0 A;  4R2R A;  1ZR9 A;  1YUI A;  1ZAA C;  2EMB A;  2RSI A;  2GHF A;  5KL7 A; 
#chains in the Genus database with same CATH topology
 2WBU A;  4HTG A;  3J7Y p;  2JYA A;  4Q28 A;  2YPN A;  2EM6 A;  4X66 E;  2EQ0 A;  2EN4 A;  2LCE A;  1A1K A;  4J8Z A;  1YPN A;  3IWC A;  4R2C A;  4OX9 E;  2EOM A;  4F9B B;  2EM4 A;  2CTD A;  2M4I A;  4GEQ B;  1T4N A;  4LF7 E;  2A25 A;  5KL3 A;  1ZBT A;  2EPK X;  2KON A;  1BB8 A;  2HJJ A;  2YSP A;  1LLM C;  1A1H A;  4LFC E;  4DR4 E;  1PKP A;  2ODR D;  1XMQ E;  3JAM C;  1T39 A;  5LL6 R;  1X5W A;  2WCC 3;  2CPN A;  1STU A;  2L6M A;  2LUP B;  4R03 A;  3BBG A;  5AE3 A;  3J81 C;  4RHB B;  3HQ1 A;  4DV6 E;  4F6M A;  2YTJ A;  2RPC A;  4LTY A;  1X48 A;  4WX9 A;  4DUY E;  5KL2 A;  2K7I A;  2MC5 A;  1J26 A;  5BR8 E;  4NZV A;  3KZY A;  2E1M A;  2EM7 A;  5AE2 A;  1YSA C;  4BBY A;  4TUI A;  4JI5 E;  4F2J C;  2EN2 A;  2K4V A;  3KZZ A;  3LML A;  4M0V A;  2ENC A;  1PJT A;  2ELZ A;  2V87 A;  1AAY A;  2EMY A;  1IBL E;  2EM9 A;  2EWL A;  2UU9 E;  4LFB E;  1MEY C;  3TQM A;  2EMH A;  2EPU A;  3DJW A;  2EMZ A;  2JVA A;  4JI3 E;  3MHH C;  5ADZ A;  4GKK E;  2JP9 A;  2UUC E;  1DI2 A;  1HR0 E;  2L8T A;  3BGH A;  1F2I G;  4KHP E;  4O24 A;  5AC5 A;  2YU8 A;  1G2D C;  4M2Z A;  4IS1 C;  2YU5 A;  2LVH A;  3BF2 A;  1IQS A;  4M30 A;  2EPC A;  2I9I A;  1WXR A;  1IQO A;  4R2P A;  4DV3 E;  2JPA A;  2LRS A;  3OTO E;  3HPS A;  2VE7 C;  4R2A A;  3HPZ A;  3H09 A;  2LTS A;  1T4L B;  2LT7 A;  2EOF A;  1KYQ A;  2VQF E;  1BBG A;  1YUI A;  2V85 A;  1X49 A;  2L2M A;  2DLQ A;  5IWA E;  4BCA A;  4KZS A;  4LFA E;  1N33 E;  1TF6 A;  3J7A G;  4JI2 E;  2UXD E;  2DMY A;  2EN6 A;  1IBM E;  1A1F A;  2EOY A;  3T1H E;  1I94 E;  2DIX A;  4B3T E;  2YTD A;  2EQ3 A;  2L2K B;  2EN8 A;  4JV5 E;  1UIL A;  5LMU E;  2EL5 A;  4TUG A;  2MDG A;  2N8X A;  2EZ6 A;  4IJD A;  4K0K E;  2G7H A;  3JU0 A;  1EH6 A;  2FV4 B;  1UN6 B;  4R2S A;  2NA2 A;  3BID A;  2B3T B;  1WHN A;  2MDR A;  3C6M A;  3DF6 A;  1KJK A;  4BHC A;  4X9J A;  1SR9 A;  3M99 B;  4O4K A;  2LUQ A;  5AE1 A;  4L5N C;  2EPL X;  2YWQ A;  1NCS A;  1WHQ A;  5T6J A;  2YTP A;  2RTX A;  2EOS A;  2NUF A;  2EM5 A;  2EOZ A;  2LTR A;  4ZYE A;  2B7T A;  1FKA E;  3HTX A;  2YTG A;  4WFT A;  4B3S E;  1PDA A;  1EH7 A;  3MHS C;  1YZ9 A;  4JYA E;  2M9A A;  3C6K A;  2N3G A;  2EOX A;  1P47 A;  2EPZ A;  4GZN C;  3ADG A;  5KL5 A;  1YYO A;  2JR1 A;  2EL6 A;  2IHR 1;  2ODR C;  3ADL A;  2GLI A;  3IWB A;  2EMG A;  2EMX A;  2WBT A;  4BC9 A;  1NEI A;  4WXC A;  2UUB E;  2D9H A;  2EOE A;  2JOX A;  5F3W A;  3IWD A;  3F6H A;  4WSP A;  4F9A B;  2L3J A;  1A1J A;  2KOU A;  3ADJ A;  2JWO A;  3P1X A;  2EMW A;  2EOH A;  1BBO A;  4NXM E;  1XNQ E;  2YRM A;  4GKJ E;  2EN3 A;  3C4T A;  3ADI A;  3F6G A;  4F9C B;  2YRK A;  4X62 E;  1UBD C;  4HEI A;  4JI4 E;  2LE2 A;  2UUA E;  1WRJ A;  2EQ1 A;  4LU9 A;  2DB2 A;  2ENA A;  5A6B D;  3FIG A;  5AAS A;  2L33 A;  1B69 A;  4DR2 E;  4X65 E;  1IBK E;  3EPK A;  2DSY A;  4YY3 E;  2EP3 A;  4R2E A;  2RQL A;  2YTO A;  4P78 A;  4R2R A;  2UXC E;  1ZR9 A;  5A6A A;  1ZAA C;  4X8W A;  2RSI A;  4DUZ E;  2GHF A;  4R8O A;  2EOR A;  4F54 A;  3KWR A;  1YYK A;  1DGC A;  3AV0 A;  4ZYH A;  2R76 A;  2NAB A;  2ELY A;  4WSG A;  1X6H A;  3LLH A;  2MKD A;  1HNX E;  4AQY E;  2BB8 A;  2PRT A;  2EN7 A;  3C4B A;  2EPM X;  2J7J A;  2MC6 A;  4KWY A;  4BS9 A;  4FK5 C;  5A6J A;  2LBS B;  2FGG A;  3K6Q A;  4F6N A;  2VRD A;  1A1I A;  1TN9 A;  2EPO A;  1T4O A;  4O43 A;  4LF9 E;  2YTQ A;  1RMD A;  2Q8U A;  1EKZ A;  1WJP A;  1X6E A;  2B9D A;  1YUJ A;  2YTN A;  3AUZ A;  5IXM B;  4DV4 E;  3EPJ A;  5A6B A;  5A2Q C;  2EOI A;  5FLX C;  2FTX B;  1ZU1 A;  5CFF E;  3EQ1 A;  2V88 A;  2EM2 A;  5IV8 B;  2WBS A;  2LJU A;  1AH5 A;  2KHX A;  2EPA A;  2L92 A;  1EH8 A;  3THO B;  4WXD A;  4B3M E;  1YYW A;  2V8Q B;  2YTE A;  1A1L A;  4NXN E;  2EPN A;  4DR5 E;  4NHR A;  1L4S A;  1FJG E;  4DMI A;  4R2D A;  3EPL A;  4MLQ A;  2EE8 A;  2ZM6 E;  4JI0 E;  5DNY A;  2YRH A;  1JK2 A;  4JI1 E;  4OOG C;  2JOB A;  1X6F A;  1A1G A;  2DMI A;  3MSW A;  1PJS A;  4L8N A;  2NUE A;  2UXB E;  2RS6 A;  1N36 E;  3QG5 C;  3OML A;  4LF4 E;  2EM3 A;  5KL6 A;  2HHH E;  2EPP A;  2EPR A;  5LMN E;  4ZYD A;  2EOQ A;  3RMP A;  2ADR A;  2YT4 A;  4O5G A;  4BC7 A;  3EPH A;  2EOJ A;  2EM0 A;  4ZYG A;  2M1S A;  4RH8 A;  2EMB A;  4BMJ A;  2B7V A;  5KL7 A;  2V89 A;  1N3G A;  1ZBQ A;  2EPX A;  4Q35 B;  2E5L E;  4DV0 E;  1QU6 A;  2EMA A;  2V83 A;  2V86 A;  4DKK A;  2VQE E;  5A69 A;  2YSO A;  4YHH E;  1RC7 A;  1RQ0 A;  4DV5 E;  2RS7 A;  2L2N A;  5IT9 C;  1O0W A;  2CSH A;  2BBG A;  2H36 X;  2M7Q A;  2N3H A;  2EL4 A;  2F4V E;  1T38 A;  3UK3 C;  3J80 C;  1DQ3 A;  2L3C A;  2EMK A;  4DR6 E;  3VK6 A;  4P7D A;  2F8B A;  2DLK A;  2EMF A;  2MKN A;  2E72 A;  2EMC A;  1TF3 A;  4JI7 E;  2WZO A;  4LF6 E;  2I13 A;  1N34 E;  5KL4 A;  4DR3 E;  2ENH A;  3VHT B;  5A6K A;  2RSM A;  2GPI A;  4M9V C;  1MGT A;  1X47 A;  1IMU A;  1HNZ E;  2EML A;  1JK1 A;  3JTZ A;  2DRP A;  2EJ4 A;  2EM8 A;  1QNT A;  4R2Q A;  2YTI A;  2NUG A;  4DV1 E;  1SFE A;  5TSE A;  1G2F C;  4LF8 E;  1YFH A;  2YZT A;  1GZ6 A;  2HGH A;  2LJH A;  2JXP A;  4B3R E;  2LV2 A;  5LLQ A;  1N32 E;  4BHB A;  3HXL A;  4WYQ B;  2HC5 A;  2LO3 A;  3ZOQ B;  3ECR A;  2EOO A;  1XNR E;  4X64 E;  1J5E E;  4DR7 E;  2VF1 A;  5AC4 A;  4WPY A;  2EMI A;  1UHZ A;  1X3C A;  2CT1 A;  3THN A;  3VYX A;  4N4R B;  1XMO E;  1GQE A;  3T1Y E;  4I8O A;  2YTF A;  2R1F A;  2LMZ A;  4DV2 E;  4MLV A;  2EN1 A;  3VYY A;  1Z1B A;  2DGC A;  4JI8 E;  1PJQ A;  4JI6 E;  2JY9 A;  3L00 A;  4LF5 E;  4DV7 E;  4DR1 E;  1GTK A;  1HNW E; 
#chains in the Genus database with same CATH homology
 2EOR A;  2WBU A;  2DLQ A;  2EPX A;  1DGC A;  2EM6 A;  2EQ0 A;  2NAB A;  2ELY A;  2EMA A;  2EN4 A;  2LCE A;  4WSG A;  1TF6 A;  1A1K A;  1X6H A;  2EN6 A;  2YSO A;  4R2C A;  1A1F A;  2EOY A;  2MKD A;  2EOM A;  2BB8 A;  2CSH A;  2EM4 A;  2YTD A;  2CTD A;  2PRT A;  2EN7 A;  2EQ3 A;  2J7J A;  2EN8 A;  2A25 A;  5KL3 A;  4FK5 C;  2EL5 A;  2EL4 A;  1BB8 A;  2YSP A;  1LLM C;  3UK3 C;  1A1H A;  4F6N A;  2VRD A;  2MDG A;  1A1I A;  1TN9 A;  4IJD A;  2YTQ A;  1X5W A;  1RMD A;  2WCC 3;  1UN6 B;  2EMK A;  4R2S A;  2DLK A;  2EMF A;  2MKN A;  1KJK A;  2E72 A;  4X9J A;  4F6M A;  3M99 B;  1WJP A;  2YTJ A;  2EMC A;  1X6E A;  2RPC A;  1YUJ A;  2YTN A;  1TF3 A;  5KL2 A;  3EPJ A;  1NCS A;  2I13 A;  2EOI A;  2YTP A;  1ZU1 A;  5KL4 A;  2EM7 A;  2EOS A;  1YSA C;  2ENH A;  4F2J C;  3VHT B;  2EM5 A;  2EN2 A;  2EM2 A;  2WBS A;  2EOZ A;  4M9V C;  2ENC A;  2YTG A;  2ELZ A;  1AAY A;  2EPA A;  2EML A;  2EMY A;  1JK1 A;  2DRP A;  3MHS C;  2EJ4 A;  2M9A A;  2EM8 A;  2EM9 A;  1MEY C;  2EOX A;  4R2Q A;  2EPZ A;  1P47 A;  4GZN C;  5KL5 A;  2EMH A;  2YTE A;  2EPU A;  2YTI A;  1A1L A;  2EL6 A;  4R2D A;  1G2F C;  2GLI A;  2EMG A;  2EMX A;  2WBT A;  3EPL A;  2EMZ A;  2HGH A;  2EE8 A;  2D9H A;  3MHH C;  2EOE A;  2JP9 A;  2LV2 A;  1F2I G;  1A1J A;  2YRH A;  2EMW A;  2LO3 A;  2EOH A;  2YU8 A;  1JK2 A;  1BBO A;  2YRM A;  1G2D C;  2EN3 A;  1X6F A;  1A1G A;  2EOO A;  2DMI A;  4IS1 C;  2YU5 A;  2YRK A;  2LVH A;  1UBD C;  2EMI A;  2EPC A;  1X3C A;  2CT1 A;  4R2P A;  2EM3 A;  2JPA A;  2EQ1 A;  5KL6 A;  2ENA A;  2EPP A;  4R2A A;  2EPR A;  2YTF A;  2R1F A;  2EOQ A;  1B69 A;  2EN1 A;  2LT7 A;  1Z1B A;  2EOF A;  2DGC A;  3EPK A;  2ADR A;  2EP3 A;  4R2E A;  3EPH A;  2EOJ A;  2YTO A;  2EM0 A;  4R2R A;  1ZR9 A;  1YUI A;  1ZAA C;  2EMB A;  2RSI A;  2GHF A;  5KL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...