2EN4A

Solution structure of the c2h2 type zinc finger (region 284-316) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTKEKPYKCYECGKAFRTRSNLTTHQVIHTGEKRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 284-316) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en4A01
2EMIA 1UN6B 2DLQA 2JP9A 1TF6A 2EN1A 2ELZA 2EMYA 1YUJA 2LCEA 2EPXA 2WBSA 2EL4A 2RSIA 1P47A 5KL5A 2EOXA 3M99B 1Z1BA 4WSGA 1RMDA 1X3CA 2YTGA 1A1KA 2YTDA 2I13A 2EMXA 2EORA 4F6MA 2YTQA 2YTEA 2EOMA 2EMCA 2GHFA 1KJKA 2A25A 1F2IG 2YTOA 2MKNA 1X6HA 2EP3A 2YSPA 2EN2A 2EPPA 2EOJA 2EN4A 1BB8A 2E72A 4FK5C 1A1HA 2LV2A 2WCC3 2M9AA 2EM9A 4R2PA 1X6EA 2YTNA 4GZNC 2EMHA 2DLKA 2EPZA 2D9HA 2R1FA 2CSHA 2YSOA 1JK2A 1A1GA 5KL6A 2YTPA 4M9VC 2ENAA 4R2AA 2EM8A 2YTFA 4F6NA 2EM5A 4F2JC 3MHHC 2EQ3A 2GLIA 1TN9A 3EPLA 2MDGA 1G2FC 2EM7A 5KL4A 1TF3A 1ZR9A 2EOSA 2EOFA 2YRMA 4IJDA 5KL7A 4R2DA 2EN6A 2EQ1A 2DRPA 1MEYC 2EM4A 2EOIA 2EN7A 2RPCA 4R2RA 4R2QA 1DGCA 2WBTA 2ELYA 2YU5A 2PRTA 1WJPA 4IS1C 2YU8A 2JPAA 2DMIA 2MKDA 5KL3A 2WBUA 2LVHA 1X5WA 1G2DC 2EMGA 1X6FA 5KL2A 2J7JA 2EMBA 2EM6A 1NCSA 1A1JA 2EOQA 1YUIA 2CT1A 2EM3A 2CTDA 2EMKA 3MHSC 2EPRA 2ENCA 2EPAA 2YTIA 2EN8A 2EQ0A 1A1LA 1A1FA 2YTJA 3EPKA 2EOEA 1LLMC 2EOYA 2NABA 2DGCA 1ZU1A 2HGHA 1JK1A 2EMAA 1BBOA 4R2EA 3VHTB 2EPCA 2EOHA 2EL6A 2ADRA 3EPJA 2EL5A 2EPUA 1A1IA 3EPHA 1ZAAC 2EOZA 2YRHA 2EM2A 2EM0A 2EMLA 1UBDC 2YRKA 1YSAC 2LT7A 2ENHA 2VRDA 2BB8A 1B69A 2EMZA 4X9JA 2EE8A 2EN3A 1AAYA 4R2CA 2EJ4A 2EMFA 4R2SA 2EMWA 2EOOA 3UK3C 2LO3A
chains in the Genus database with same CATH superfamily
2K7IA 2EMIA 2DLQA 4X8WA 5LMNE 4DR1E 2JVAA 2EN1A 4KHPE 4RH8A 4N4RB 5LLQA 2EMYA 1YUJA 2LCEA 5A6AA 2RSIA 1P47A 2E1MA 3C6KA 4F54A 4BMJA 2EOXA 4LF7E 4WSGA 2KOUA 4LTYA 1WRJA 5ADZA 5BR8E 2JXPA 1T38A 1A1KA 2EMXA 2L3CA 2L2MA 2MC6A 1KJKA 2EPLX 4DV1E 4DV7E 4M30A 1F2IG 2MKNA 4R03A 4WX9A 2EPPA 2EN4A 2LV2A 2UXDE 2EZ6A 3F6HA 2RSMA 2B7VA 2YTNA 4GZNC 2EPZA 2ODRD 4J8ZA 4B3SE 2R1FA 3OTOE 3TQMA 1JK2A 2YSOA 2K4VA 5CFFE 4R2AA 4GEQB 1YYWA 2V83A 3RMPA 5IT9C 2EQ3A 2GLIA 4P78A 2V88A 1EH8A 4HEIA 4OOGC 2EN6A 2BBGA 1PJSA 1X47A 2EOIA 2EN7A 2RPCA 4R2QA 2PRTA 5KL3A 4HTGA 1X6FA 4WPYA 1BBGA 2HJJA 1NCSA 2M7QA 4NZVA 2V85A 2EPRA 4DR4E 1IBKE 2N3HA 2EQ0A 4DMIA 4KZSA 1N3GA 2JR1A 2EOYA 1JK1A 2NUEA 2EMAA 4DR3E 1WHQA 3VHTB 4O24A 1RC7A 4O5GA 4JI3E 4JI7E 1IQSA 3VYYA 4X65E 4WYQB 4BBYA 3BIDA 3BBGA 4LFAE 3JAMC 3HQ1A 2ENHA 3JTZA 2V87A 3ZOQB 4X9JA 2EN3A 4JI2E 2LBSB 1ZBTA 1T4LB 2EMFA 3ADJA 5A6BA 4OX9E 2EMWA 1EH7A 1RQ0A 3ADGA 3ADIA 4DR5E 2JP9A 1SR9A 4JYAE 2LTRA 3FIGA 5A6BD 5AC5A 2EPXA 1YYKA 2ODRC 3AV0A 2MC5A 4Q35B 2F4VE 5KL5A 1L4SA 4ZYDA 4GKJE 1N32E 1YPNA 1X3CA 2EPNA 1EKZA 4P7DA 4DV0E 2UUAE 2JOXA 1DI2A 4DUZE 2EMCA 2GHFA 2V89A 1HNZE 2A25A 4DR6E 2YSPA 2EN2A 2EOJA 4LF9E 3DF6A 4FK5C 2L92A 1I94E 2M9AA 4I8OA 4R2PA 1X6EA 2MDRA 2Q8UA 4WFTA 2CSHA 2B3TB 3HXLA 4ZYEA 2YTPA 4M9VC 3J80C 1MGTA 4M2ZA 2YPNA 2YTFA 4F6NA 2UU9E 2EM5A 2YZTA 3MHHC 2NUGA 4L8NA 4F9AB 2L2NA 3T1HE 1G2FC 2EM7A 2R76A 4DKKA 1ZR9A 3LMLA 2EQ1A 2L8TA 2IHR1 1GQEA 4JI8E 5AE3A 2WBTA 2ELYA 2RTXA 2YU5A 1WJPA 2E5LE 2EPOA 1WXRA 4B3ME 2DMIA 4O4KA 2LUPB 1IBLE 2RS7A 2EMGA 5KL2A 2J7JA 4NXME 5A69A 2CTDA 5T6JA 2EMKA 1ZBQA 2EPAA 2EN8A 1UHZA 2YTJA 4DUYE 3EPKA 4ZYGA 4F9CB 1LLMC 4GKKE 1ZU1A 4R2EA 5FLXC 3J7AG 2EPCA 1QNTA 2ADRA 3EPJA 2LE2A 1FJGE 2LTSA 1ZAAC 2EOZA 2VQFE 3IWBA 1YSAC 2YRKA 4Q28A 2LT7A 2EMZA 5AC4A 4DR2E 2M1SA 2LJHA 2JOBA 3C4TA 3UK3C 4TUIA 4BC7A 2DSYA 2VQEE 1NEIA 1PKPA 1UN6B 2JWOA 4DV5E 1EH6A 1TF6A 2G7HA 3LLHA 1XNRE 4X64E 2L33A 2WBSA 2DMYA 2UXCE 2YT4A 3M99B 3HTXA 4B3TE 3QG5C 1RMDA 1SFEA 1J5EE 2DB2A 2I13A 2YTDA 4KWYA 4F6MA 2YTQA 1WHNA 5A6JA 2YTOA 4MLQA 4DV3E 3H09A 1BB8A 2E72A 1O0WA 1IMUA 1T4OA 2EM9A 2RS6A 1UILA 4BHBA 4R8OA 2V86A 2NA2A 3JU0A 3KZYA 2DIXA 1FKAE 3MSWA 3KZZA 4K0KE 4B3RE 4L5NC 1YZ9A 4AQYE 1TN9A 4WSPA 3EPLA 3HPSA 4WXCA 5KL4A 1TF3A 2EOFA 4DV2E 5AE1A 2F8BA 3HPZA 5KL7A 2DRPA 1XMQE 4R2RA 2KONA 1DGCA 2UUBE 3IWDA 4TUGA 1KYQA 2JPAA 1XMOE 3ADLA 1STUA 2MKDA 2LVHA 3F6GA 2GPIA 1PDAA 4BC9A 1YFHA 1A1JA 2ZM6E 1YUIA 2CT1A 4LF6E 3MHSC 2ENCA 2FV4B 3VYXA 3EQ1A 3OMLA 4JI4E 2LRSA 4O43A 4JI6E 2DGCA 5LMUE 2HGHA 3VK6A 5AE2A 1HNXE 4WXDA 2JY9A 5AASA 2EL6A 4BCAA 3EPHA 2L3JA 2YRHA 2EMLA 1UBDC 2VRDA 2BB8A 1B69A 4R2CA 4MLVA 4RHBB 2EJ4A 2V8QB 3C4BA 5A2QC 2EWLA 4JV5E 4F9BB 4YY3E 3THNA 2ELZA 2EL4A 2EPKX 1T4NA 2WZOA 2LMZA 1IQOA 1Z1BA 1N36E 2KHXA 1N34E 2YTGA 4YHHE 2UXBE 2EORA 5TSEA 2YTEA 2EOMA 2B9DA 3C6MA 3AUZA 1X6HA 2EP3A 5F3WA 3DJWA 5DNYA 4NXNE 1A1HA 2WCC3 1YYOA 4LFCE 4DR7E 2FGGA 2CPNA 2EMHA 4JI0E 2DLKA 1N33E 2D9HA 3KWRA 3L00A 1A1GA 3J81C 1GZ6A 1PJTA 5IV8B 5KL6A 4JI1E 1IBME 2ENAA 2JYAA 5LL6R 2EPMX 4LU9A 1AH5A 2EM8A 4LF5E 4F2JC 1T39A 1PJQA 3BF2A 2MDGA 2I9IA 2RQLA 2EOSA 2H36X 2YRMA 4DV4E 4IJDA 4R2DA 1MEYC 2EM4A 4IS1C 2YU8A 2YWQA 1QU6A 1XNQE 1X48A 4NHRA 4X66E 2WBUA 2HHHE 2UUCE 1J26A 1X5WA 1HR0E 1GTKA 2VF1A 1G2DC 4JI5E 2L6MA 2EMBA 2EM6A 4BS9A 2EOQA 3K6QA 2EM3A 3THOB 3IWCA 2YTIA 3ECRA 1A1LA 1A1FA 2HC5A 5IXMB 2B7TA 2EOEA 1HNWE 2NABA 5IWAE 1BBOA 4LF4E 4BHCA 1DQ3A 1X49A 2EOHA 4LF8E 4M0VA 5A6KA 2EL5A 2EPUA 1A1IA 3BGHA 2LJUA 2N8XA 2EM2A 2EM0A 2FTXB 2LUQA 4ZYHA 4DV6E 3T1YE 3J7Yp 4X62E 4LFBE 2EE8A 3P1XA 2VE7C 1AAYA 2M4IA 2NUFA 4R2SA 2N3GA 2EOOA 2LO3A 2L2KB
chains in the Genus database with same CATH topology
2EMIA 1UN6B 2DLQA 2JP9A 1TF6A 2EN1A 2ELZA 2EMYA 1YUJA 2LCEA 2EPXA 2WBSA 2EL4A 2RSIA 1P47A 5KL5A 2EOXA 3M99B 1Z1BA 4WSGA 1RMDA 1X3CA 2YTGA 1A1KA 2YTDA 2I13A 2EMXA 2EORA 4F6MA 2YTQA 2YTEA 2EOMA 2EMCA 2GHFA 1KJKA 2A25A 1F2IG 2YTOA 2MKNA 1X6HA 2EP3A 2YSPA 2EN2A 2EPPA 2EOJA 2EN4A 1BB8A 2E72A 4FK5C 1A1HA 2LV2A 2WCC3 2M9AA 2EM9A 4R2PA 1X6EA 2YTNA 4GZNC 2EMHA 2DLKA 2EPZA 2D9HA 2R1FA 2CSHA 2YSOA 1JK2A 1A1GA 5KL6A 2YTPA 4M9VC 2ENAA 4R2AA 2EM8A 2YTFA 4F6NA 2EM5A 4F2JC 3MHHC 2EQ3A 2GLIA 1TN9A 3EPLA 2MDGA 1G2FC 2EM7A 5KL4A 1TF3A 1ZR9A 2EOSA 2EOFA 2YRMA 4IJDA 5KL7A 4R2DA 2EN6A 2EQ1A 2DRPA 1MEYC 2EM4A 2EOIA 2EN7A 2RPCA 4R2RA 4R2QA 1DGCA 2WBTA 2ELYA 2YU5A 2PRTA 1WJPA 4IS1C 2YU8A 2JPAA 2DMIA 2MKDA 5KL3A 2WBUA 2LVHA 1X5WA 1G2DC 2EMGA 1X6FA 5KL2A 2J7JA 2EMBA 2EM6A 1NCSA 1A1JA 2EOQA 1YUIA 2CT1A 2EM3A 2CTDA 2EMKA 3MHSC 2EPRA 2ENCA 2EPAA 2YTIA 2EN8A 2EQ0A 1A1LA 1A1FA 2YTJA 3EPKA 2EOEA 1LLMC 2EOYA 2NABA 2DGCA 1ZU1A 2HGHA 1JK1A 2EMAA 1BBOA 4R2EA 3VHTB 2EPCA 2EOHA 2EL6A 2ADRA 3EPJA 2EL5A 2EPUA 1A1IA 3EPHA 1ZAAC 2EOZA 2YRHA 2EM2A 2EM0A 2EMLA 1UBDC 2YRKA 1YSAC 2LT7A 2ENHA 2VRDA 2BB8A 1B69A 2EMZA 4X9JA 2EE8A 2EN3A 1AAYA 4R2CA 2EJ4A 2EMFA 4R2SA 2EMWA 2EOOA 3UK3C 2LO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMI A;  1UN6 B;  2DLQ A;  2JP9 A;  1TF6 A;  2EN1 A;  2ELZ A;  2EMY A;  1YUJ A;  2LCE A;  2EPX A;  2WBS A;  2EL4 A;  2RSI A;  1P47 A;  5KL5 A;  2EOX A;  3M99 B;  1Z1B A;  4WSG A;  1RMD A;  1X3C A;  2YTG A;  1A1K A;  2YTD A;  2I13 A;  2EMX A;  2EOR A;  4F6M A;  2YTQ A;  2YTE A;  2EOM A;  2EMC A;  2GHF A;  1KJK A;  2A25 A;  1F2I G;  2YTO A;  2MKN A;  1X6H A;  2EP3 A;  2YSP A;  2EN2 A;  2EPP A;  2EOJ A;  2EN4 A;  1BB8 A;  2E72 A;  4FK5 C;  1A1H A;  2LV2 A;  2WCC 3;  2M9A A;  2EM9 A;  4R2P A;  1X6E A;  2YTN A;  4GZN C;  2EMH A;  2DLK A;  2EPZ A;  2D9H A;  2R1F A;  2CSH A;  2YSO A;  1JK2 A;  1A1G A;  5KL6 A;  2YTP A;  4M9V C;  2ENA A;  4R2A A;  2EM8 A;  2YTF A;  4F6N A;  2EM5 A;  4F2J C;  3MHH C;  2EQ3 A;  2GLI A;  1TN9 A;  3EPL A;  2MDG A;  1G2F C;  2EM7 A;  5KL4 A;  1TF3 A;  1ZR9 A;  2EOS A;  2EOF A;  2YRM A;  4IJD A;  5KL7 A;  4R2D A;  2EN6 A;  2EQ1 A;  2DRP A;  1MEY C;  2EM4 A;  2EOI A;  2EN7 A;  2RPC A;  4R2R A;  4R2Q A;  1DGC A;  2WBT A;  2ELY A;  2YU5 A;  2PRT A;  1WJP A;  4IS1 C;  2YU8 A;  2JPA A;  2DMI A;  2MKD A;  5KL3 A;  2WBU A;  2LVH A;  1X5W A;  1G2D C;  2EMG A;  1X6F A;  5KL2 A;  2J7J A;  2EMB A;  2EM6 A;  1NCS A;  1A1J A;  2EOQ A;  1YUI A;  2CT1 A;  2EM3 A;  2CTD A;  2EMK A;  3MHS C;  2EPR A;  2ENC A;  2EPA A;  2YTI A;  2EN8 A;  2EQ0 A;  1A1L A;  1A1F A;  2YTJ A;  3EPK A;  2EOE A;  1LLM C;  2EOY A;  2NAB A;  2DGC A;  1ZU1 A;  2HGH A;  1JK1 A;  2EMA A;  1BBO A;  4R2E A;  3VHT B;  2EPC A;  2EOH A;  2EL6 A;  2ADR A;  3EPJ A;  2EL5 A;  2EPU A;  1A1I A;  3EPH A;  1ZAA C;  2EOZ A;  2YRH A;  2EM2 A;  2EM0 A;  2EML A;  1UBD C;  2YRK A;  1YSA C;  2LT7 A;  2ENH A;  2VRD A;  2BB8 A;  1B69 A;  2EMZ A;  4X9J A;  2EE8 A;  2EN3 A;  1AAY A;  4R2C A;  2EJ4 A;  2EMF A;  4R2S A;  2EMW A;  2EOO A;  3UK3 C;  2LO3 A; 
#chains in the Genus database with same CATH topology
 2K7I A;  2EMI A;  2DLQ A;  4X8W A;  5LMN E;  4DR1 E;  2JVA A;  2EN1 A;  4KHP E;  4RH8 A;  4N4R B;  5LLQ A;  2EMY A;  1YUJ A;  2LCE A;  5A6A A;  2RSI A;  1P47 A;  2E1M A;  3C6K A;  4F54 A;  4BMJ A;  2EOX A;  4LF7 E;  4WSG A;  2KOU A;  4LTY A;  1WRJ A;  5ADZ A;  5BR8 E;  2JXP A;  1T38 A;  1A1K A;  2EMX A;  2L3C A;  2L2M A;  2MC6 A;  1KJK A;  2EPL X;  4DV1 E;  4DV7 E;  4M30 A;  1F2I G;  2MKN A;  4R03 A;  4WX9 A;  2EPP A;  2EN4 A;  2LV2 A;  2UXD E;  2EZ6 A;  3F6H A;  2RSM A;  2B7V A;  2YTN A;  4GZN C;  2EPZ A;  2ODR D;  4J8Z A;  4B3S E;  2R1F A;  3OTO E;  3TQM A;  1JK2 A;  2YSO A;  2K4V A;  5CFF E;  4R2A A;  4GEQ B;  1YYW A;  2V83 A;  3RMP A;  5IT9 C;  2EQ3 A;  2GLI A;  4P78 A;  2V88 A;  1EH8 A;  4HEI A;  4OOG C;  2EN6 A;  2BBG A;  1PJS A;  1X47 A;  2EOI A;  2EN7 A;  2RPC A;  4R2Q A;  2PRT A;  5KL3 A;  4HTG A;  1X6F A;  4WPY A;  1BBG A;  2HJJ A;  1NCS A;  2M7Q A;  4NZV A;  2V85 A;  2EPR A;  4DR4 E;  1IBK E;  2N3H A;  2EQ0 A;  4DMI A;  4KZS A;  1N3G A;  2JR1 A;  2EOY A;  1JK1 A;  2NUE A;  2EMA A;  4DR3 E;  1WHQ A;  3VHT B;  4O24 A;  1RC7 A;  4O5G A;  4JI3 E;  4JI7 E;  1IQS A;  3VYY A;  4X65 E;  4WYQ B;  4BBY A;  3BID A;  3BBG A;  4LFA E;  3JAM C;  3HQ1 A;  2ENH A;  3JTZ A;  2V87 A;  3ZOQ B;  4X9J A;  2EN3 A;  4JI2 E;  2LBS B;  1ZBT A;  1T4L B;  2EMF A;  3ADJ A;  5A6B A;  4OX9 E;  2EMW A;  1EH7 A;  1RQ0 A;  3ADG A;  3ADI A;  4DR5 E;  2JP9 A;  1SR9 A;  4JYA E;  2LTR A;  3FIG A;  5A6B D;  5AC5 A;  2EPX A;  1YYK A;  2ODR C;  3AV0 A;  2MC5 A;  4Q35 B;  2F4V E;  5KL5 A;  1L4S A;  4ZYD A;  4GKJ E;  1N32 E;  1YPN A;  1X3C A;  2EPN A;  1EKZ A;  4P7D A;  4DV0 E;  2UUA E;  2JOX A;  1DI2 A;  4DUZ E;  2EMC A;  2GHF A;  2V89 A;  1HNZ E;  2A25 A;  4DR6 E;  2YSP A;  2EN2 A;  2EOJ A;  4LF9 E;  3DF6 A;  4FK5 C;  2L92 A;  1I94 E;  2M9A A;  4I8O A;  4R2P A;  1X6E A;  2MDR A;  2Q8U A;  4WFT A;  2CSH A;  2B3T B;  3HXL A;  4ZYE A;  2YTP A;  4M9V C;  3J80 C;  1MGT A;  4M2Z A;  2YPN A;  2YTF A;  4F6N A;  2UU9 E;  2EM5 A;  2YZT A;  3MHH C;  2NUG A;  4L8N A;  4F9A B;  2L2N A;  3T1H E;  1G2F C;  2EM7 A;  2R76 A;  4DKK A;  1ZR9 A;  3LML A;  2EQ1 A;  2L8T A;  2IHR 1;  1GQE A;  4JI8 E;  5AE3 A;  2WBT A;  2ELY A;  2RTX A;  2YU5 A;  1WJP A;  2E5L E;  2EPO A;  1WXR A;  4B3M E;  2DMI A;  4O4K A;  2LUP B;  1IBL E;  2RS7 A;  2EMG A;  5KL2 A;  2J7J A;  4NXM E;  5A69 A;  2CTD A;  5T6J A;  2EMK A;  1ZBQ A;  2EPA A;  2EN8 A;  1UHZ A;  2YTJ A;  4DUY E;  3EPK A;  4ZYG A;  4F9C B;  1LLM C;  4GKK E;  1ZU1 A;  4R2E A;  5FLX C;  3J7A G;  2EPC A;  1QNT A;  2ADR A;  3EPJ A;  2LE2 A;  1FJG E;  2LTS A;  1ZAA C;  2EOZ A;  2VQF E;  3IWB A;  1YSA C;  2YRK A;  4Q28 A;  2LT7 A;  2EMZ A;  5AC4 A;  4DR2 E;  2M1S A;  2LJH A;  2JOB A;  3C4T A;  3UK3 C;  4TUI A;  4BC7 A;  2DSY A;  2VQE E;  1NEI A;  1PKP A;  1UN6 B;  2JWO A;  4DV5 E;  1EH6 A;  1TF6 A;  2G7H A;  3LLH A;  1XNR E;  4X64 E;  2L33 A;  2WBS A;  2DMY A;  2UXC E;  2YT4 A;  3M99 B;  3HTX A;  4B3T E;  3QG5 C;  1RMD A;  1SFE A;  1J5E E;  2DB2 A;  2I13 A;  2YTD A;  4KWY A;  4F6M A;  2YTQ A;  1WHN A;  5A6J A;  2YTO A;  4MLQ A;  4DV3 E;  3H09 A;  1BB8 A;  2E72 A;  1O0W A;  1IMU A;  1T4O A;  2EM9 A;  2RS6 A;  1UIL A;  4BHB A;  4R8O A;  2V86 A;  2NA2 A;  3JU0 A;  3KZY A;  2DIX A;  1FKA E;  3MSW A;  3KZZ A;  4K0K E;  4B3R E;  4L5N C;  1YZ9 A;  4AQY E;  1TN9 A;  4WSP A;  3EPL A;  3HPS A;  4WXC A;  5KL4 A;  1TF3 A;  2EOF A;  4DV2 E;  5AE1 A;  2F8B A;  3HPZ A;  5KL7 A;  2DRP A;  1XMQ E;  4R2R A;  2KON A;  1DGC A;  2UUB E;  3IWD A;  4TUG A;  1KYQ A;  2JPA A;  1XMO E;  3ADL A;  1STU A;  2MKD A;  2LVH A;  3F6G A;  2GPI A;  1PDA A;  4BC9 A;  1YFH A;  1A1J A;  2ZM6 E;  1YUI A;  2CT1 A;  4LF6 E;  3MHS C;  2ENC A;  2FV4 B;  3VYX A;  3EQ1 A;  3OML A;  4JI4 E;  2LRS A;  4O43 A;  4JI6 E;  2DGC A;  5LMU E;  2HGH A;  3VK6 A;  5AE2 A;  1HNX E;  4WXD A;  2JY9 A;  5AAS A;  2EL6 A;  4BCA A;  3EPH A;  2L3J A;  2YRH A;  2EML A;  1UBD C;  2VRD A;  2BB8 A;  1B69 A;  4R2C A;  4MLV A;  4RHB B;  2EJ4 A;  2V8Q B;  3C4B A;  5A2Q C;  2EWL A;  4JV5 E;  4F9B B;  4YY3 E;  3THN A;  2ELZ A;  2EL4 A;  2EPK X;  1T4N A;  2WZO A;  2LMZ A;  1IQO A;  1Z1B A;  1N36 E;  2KHX A;  1N34 E;  2YTG A;  4YHH E;  2UXB E;  2EOR A;  5TSE A;  2YTE A;  2EOM A;  2B9D A;  3C6M A;  3AUZ A;  1X6H A;  2EP3 A;  5F3W A;  3DJW A;  5DNY A;  4NXN E;  1A1H A;  2WCC 3;  1YYO A;  4LFC E;  4DR7 E;  2FGG A;  2CPN A;  2EMH A;  4JI0 E;  2DLK A;  1N33 E;  2D9H A;  3KWR A;  3L00 A;  1A1G A;  3J81 C;  1GZ6 A;  1PJT A;  5IV8 B;  5KL6 A;  4JI1 E;  1IBM E;  2ENA A;  2JYA A;  5LL6 R;  2EPM X;  4LU9 A;  1AH5 A;  2EM8 A;  4LF5 E;  4F2J C;  1T39 A;  1PJQ A;  3BF2 A;  2MDG A;  2I9I A;  2RQL A;  2EOS A;  2H36 X;  2YRM A;  4DV4 E;  4IJD A;  4R2D A;  1MEY C;  2EM4 A;  4IS1 C;  2YU8 A;  2YWQ A;  1QU6 A;  1XNQ E;  1X48 A;  4NHR A;  4X66 E;  2WBU A;  2HHH E;  2UUC E;  1J26 A;  1X5W A;  1HR0 E;  1GTK A;  2VF1 A;  1G2D C;  4JI5 E;  2L6M A;  2EMB A;  2EM6 A;  4BS9 A;  2EOQ A;  3K6Q A;  2EM3 A;  3THO B;  3IWC A;  2YTI A;  3ECR A;  1A1L A;  1A1F A;  2HC5 A;  5IXM B;  2B7T A;  2EOE A;  1HNW E;  2NAB A;  5IWA E;  1BBO A;  4LF4 E;  4BHC A;  1DQ3 A;  1X49 A;  2EOH A;  4LF8 E;  4M0V A;  5A6K A;  2EL5 A;  2EPU A;  1A1I A;  3BGH A;  2LJU A;  2N8X A;  2EM2 A;  2EM0 A;  2FTX B;  2LUQ A;  4ZYH A;  4DV6 E;  3T1Y E;  3J7Y p;  4X62 E;  4LFB E;  2EE8 A;  3P1X A;  2VE7 C;  1AAY A;  2M4I A;  2NUF A;  4R2S A;  2N3G A;  2EOO A;  2LO3 A;  2L2K B; 
#chains in the Genus database with same CATH homology
 2EMI A;  1UN6 B;  2DLQ A;  2JP9 A;  1TF6 A;  2EN1 A;  2ELZ A;  2EMY A;  1YUJ A;  2LCE A;  2EPX A;  2WBS A;  2EL4 A;  2RSI A;  1P47 A;  5KL5 A;  2EOX A;  3M99 B;  1Z1B A;  4WSG A;  1RMD A;  1X3C A;  2YTG A;  1A1K A;  2YTD A;  2I13 A;  2EMX A;  2EOR A;  4F6M A;  2YTQ A;  2YTE A;  2EOM A;  2EMC A;  2GHF A;  1KJK A;  2A25 A;  1F2I G;  2YTO A;  2MKN A;  1X6H A;  2EP3 A;  2YSP A;  2EN2 A;  2EPP A;  2EOJ A;  2EN4 A;  1BB8 A;  2E72 A;  4FK5 C;  1A1H A;  2LV2 A;  2WCC 3;  2M9A A;  2EM9 A;  4R2P A;  1X6E A;  2YTN A;  4GZN C;  2EMH A;  2DLK A;  2EPZ A;  2D9H A;  2R1F A;  2CSH A;  2YSO A;  1JK2 A;  1A1G A;  5KL6 A;  2YTP A;  4M9V C;  2ENA A;  4R2A A;  2EM8 A;  2YTF A;  4F6N A;  2EM5 A;  4F2J C;  3MHH C;  2EQ3 A;  2GLI A;  1TN9 A;  3EPL A;  2MDG A;  1G2F C;  2EM7 A;  5KL4 A;  1TF3 A;  1ZR9 A;  2EOS A;  2EOF A;  2YRM A;  4IJD A;  5KL7 A;  4R2D A;  2EN6 A;  2EQ1 A;  2DRP A;  1MEY C;  2EM4 A;  2EOI A;  2EN7 A;  2RPC A;  4R2R A;  4R2Q A;  1DGC A;  2WBT A;  2ELY A;  2YU5 A;  2PRT A;  1WJP A;  4IS1 C;  2YU8 A;  2JPA A;  2DMI A;  2MKD A;  5KL3 A;  2WBU A;  2LVH A;  1X5W A;  1G2D C;  2EMG A;  1X6F A;  5KL2 A;  2J7J A;  2EMB A;  2EM6 A;  1NCS A;  1A1J A;  2EOQ A;  1YUI A;  2CT1 A;  2EM3 A;  2CTD A;  2EMK A;  3MHS C;  2EPR A;  2ENC A;  2EPA A;  2YTI A;  2EN8 A;  2EQ0 A;  1A1L A;  1A1F A;  2YTJ A;  3EPK A;  2EOE A;  1LLM C;  2EOY A;  2NAB A;  2DGC A;  1ZU1 A;  2HGH A;  1JK1 A;  2EMA A;  1BBO A;  4R2E A;  3VHT B;  2EPC A;  2EOH A;  2EL6 A;  2ADR A;  3EPJ A;  2EL5 A;  2EPU A;  1A1I A;  3EPH A;  1ZAA C;  2EOZ A;  2YRH A;  2EM2 A;  2EM0 A;  2EML A;  1UBD C;  2YRK A;  1YSA C;  2LT7 A;  2ENH A;  2VRD A;  2BB8 A;  1B69 A;  2EMZ A;  4X9J A;  2EE8 A;  2EN3 A;  1AAY A;  4R2C A;  2EJ4 A;  2EMF A;  4R2S A;  2EMW A;  2EOO A;  3UK3 C;  2LO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...