2EN4A

Solution structure of the c2h2 type zinc finger (region 284-316) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTKEKPYKCYECGKAFRTRSNLTTHQVIHTGEKRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 284-316) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en4A01
1AAYA 4R2SA 2EM2A 2EN6A 5KL4A 2YTIA 1WJPA 2R1FA 2EOSA 2EOZA 4X9JA 1A1FA 4GZNC 2EMXA 2YSOA 2WBSA 2YTNA 1BB8A 1ZU1A 2EOFA 2M9AA 2CSHA 2EMYA 2DGCA 2YTGA 2EQ3A 2EP3A 2DMIA 2EOXA 1X6FA 2EN3A 2EMHA 2WBTA 2EM6A 2EM8A 2EMWA 4R2QA 4FK5C 2MDGA 1A1JA 1A1HA 2RPCA 1X3CA 1JK2A 2MKNA 1BBOA 4WSGA 2EN8A 1UBDC 1Z1BA 4IS1C 1UN6B 2EOJA 1X5WA 2EPPA 2DRPA 1F2IG 2E72A 2YU8A 2J7JA 4R2RA 2EM0A 5KL7A 1TN9A 2VRDA 2D9HA 2ADRA 2EPAA 2EM5A 2JP9A 2EOQA 2EE8A 2PRTA 2JPAA 1B69A 1YUJA 1X6EA 2BB8A 3M99B 2A25A 2EPCA 2EPZA 4F6NA 2YTPA 2EN4A 2EL5A 4F6MA 1DGCA 1YUIA 2LT7A 2LCEA 4F2JC 2EQ1A 2EMZA 1LLMC 1NCSA 3VHTB 2WCC3 5KL5A 3UK3C 1A1GA 2EM4A 2MKDA 3EPKA 3EPLA 3EPJA 2EL6A 1A1LA 1KJKA 2LV2A 3MHSC 4M9VC 1A1KA 3EPHA 2EMGA 2YRMA 2EMLA 2I13A 2EM7A 1X6HA 2ENHA 5KL2A 1P47A 1G2DC 2EMBA 2CT1A 2LVHA 2YTDA 2EOMA 1A1IA 2EMCA 2EQ0A 1TF3A 4R2AA 1MEYC 2WBUA 2YTFA 2ENAA 2RSIA 3MHHC 2EMAA 2ELZA 1ZAAC 4R2DA 5KL3A 2EN1A 2EMIA 5KL6A 4R2PA 1JK1A 2CTDA 2YSPA 2EOIA 2EM9A 2EPUA 2ELYA 1TF6A 2EMKA 2EORA 2YTQA 2GLIA 2EOOA 4R2CA 2HGHA 2EM3A 2YTEA 2YTOA 2LO3A 2EPRA 2EOYA 2GHFA 2YU5A 2EN7A 2ENCA 1YSAC 2DLQA 4R2EA 2YRHA 2YRKA 2YTJA 2EJ4A 2EN2A 2EMFA 2EL4A 4IJDA 2EOHA 2NABA 1RMDA 2EOEA 2EPXA 1ZR9A 1G2FC 2DLKA
chains in the Genus database with same CATH superfamily
4LF9E 2EN6A 1HNZE 2EWLA 3HXLA 1WJPA 2H36X 2L2NA 4X62E 2R1FA 4X8WA 5A6BD 4X9JA 2WBSA 2I9IA 3HPSA 4WFTA 1ZU1A 2EOFA 1SFEA 2CSHA 1EH7A 2LUPB 1YYWA 2UXCE 2DMIA 2V83A 2EN3A 2EMHA 3C6MA 5ADZA 4JI7E 4DV6E 2B3TB 5LL6R 4R03A 3J81C 2YPNA 4M0VA 2EMWA 2L3JA 3MSWA 2L8TA 3BBGA 1X3CA 5A2QC 1JK2A 4TUGA 2EPKX 1UBDC 1Z1BA 1T38A 4DV2E 1L4SA 4F9BB 2EOJA 4RHBB 5LMUE 4N4RB 5AE3A 2IHR1 1YFHA 2E72A 4NXME 5BR8E 2YU8A 5KL7A 1PKPA 2ADRA 2JP9A 2JWOA 1X6EA 2KONA 1YZ9A 2DSYA 3EQ1A 2A25A 5A6JA 4L5NC 4JI1E 1YUIA 4L8NA 2LRSA 5CFFE 2R76A 2WCC3 1EKZA 1A1GA 1GQEA 3EPKA 2EL6A 1A1LA 4GEQB 1SR9A 3EPHA 2EMGA 4AQYE 1X6HA 2ENHA 2VQFE 4B3RE 3RMPA 2CT1A 2LVHA 2EOMA 2EQ0A 4KZSA 4R2AA 2WBUA 4M30A 2EMAA 3OTOE 4R2DA 4JI5E 3ADGA 2CTDA 5A6KA 2EPNA 1NEIA 2GPIA 2L3CA 4DV4E 2B7VA 2EOOA 2L6MA 2EOYA 2EN7A 2ODRC 2V88A 4LTYA 4KHPE 2K4VA 2EJ4A 2EN2A 2JY9A 1RMDA 4ZYHA 2EOEA 1IQOA 1G2FC 4P7DA 3F6HA 1AAYA 4R2SA 2EM2A 4JI2E 4LF6E 4O5GA 4DR7E 5TSEA 4ZYDA 2EOSA 2EOZA 4LF8E 4GZNC 2LBSB 2DGCA 2YTGA 3J80C 2EP3A 2M1SA 2CPNA 3JAMC 1ZBTA 2EM6A 2V86A 3THNA 5FLXC 4R2QA 5AE2A 1IBLE 4FK5C 3JTZA 1RQ0A 4OOGC 4M2ZA 1IBME 1A1HA 2M4IA 2RS6A 1BBOA 4WSGA 4LFAE 5A6BA 4J8ZA 3KZYA 1UN6B 4ZYEA 2L2MA 2B9DA 1YPNA 2EPPA 2UXDE 2V85A 4WX9A 1TN9A 4BMJA 1UILA 5DNYA 3J7Yp 4DV3E 2PRTA 1IMUA 4WXCA 4DUZE 1B69A 2BB8A 3M99B 5LLQA 2YTPA 2B7TA 2EL5A 2RS7A 4DR1E 4DR2E 2LCEA 5AASA 3C4BA 3VHTB 3HTXA 2BBGA 5KL5A 3EPLA 3EPJA 3C4TA 1DQ3A 2KOUA 2VE7C 1A1KA 2YRMA 5KL2A 3ADIA 2NUFA 4MLVA 1DI2A 1XNQE 2LMZA 3OMLA 1MEYC 2HHHE 1WHQA 2ENAA 2RSIA 3VYXA 3K6QA 2VQEE 2ELZA 1ZAAC 5KL3A 4JI4E 4R2PA 2EMIA 4BC9A 4X64E 1GTKA 2EM9A 2ELYA 2EMKA 2EORA 3HQ1A 2K7IA 4R2CA 2UUCE 2EM3A 2LO3A 1QNTA 2EPRA 2GHFA 2ENCA 4MLQA 4BHCA 2MC5A 1STUA 1HR0E 2YRKA 2DMYA 1O0WA 3FIGA 4Q35B 2G7HA 4JYAE 1IBKE 4HTGA 4LU9A 2DLKA 1KYQA 2VF1A 3C6KA 3THOB 4JI8E 3QG5C 2E5LE 4I8OA 2EMXA 2YSOA 4DV1E 4DR6E 2EMYA 4BHBA 1N36E 4DV0E 2EOXA 1X6FA 2WBTA 2EM8A 4BBYA 1T4NA 4DKKA 3AV0A 3ADLA 4F9CB 3L00A 2JR1A 2RSMA 1N34E 4X65E 2KHXA 3BF2A 2RTXA 3T1HE 5IV8B 4IS1C 4F9AB 2UUBE 2V8QB 2DB2A 3T1YE 4LFBE 3BGHA 4WYQB 5T6JA 4B3SE 4LF4E 4O24A 1MGTA 4YY3E 4R2RA 1X49A 4K0KE 2EM5A 2EE8A 2JPAA 5A69A 5AC5A 3DJWA 2NUEA 1RC7A 5IT9C 5LMNE 2EPZA 4F6NA 4Q28A 2LE2A 4DR4E 3LLHA 2MC6A 4F2JC 1T4OA 2EQ1A 4LF5E 2HC5A 1NCSA 3KZZA 5AC4A 2M7QA 3UK3C 2EM4A 3F6GA 1KJKA 2EZ6A 1BBGA 5IWAE 2LV2A 2YWQA 2EPOA 2L33A 2EMLA 2EM7A 2LTSA 1PJSA 2N3GA 2EMCA 1TF3A 2YTFA 3VK6A 3IWBA 1X48A 2ODRD 4DV7E 4DUYE 4F54A 5IXMB 4NZVA 2LJHA 1JK1A 1FJGE 2YSPA 2EPUA 1TF6A 1IQSA 2YTQA 2L2KB 2HGHA 2DIXA 2N8XA 2YTOA 3H09A 5F3WA 2LUQA 1I94E 2EPLX 2YU5A 1HNWE 4JI6E 4DR5E 2NA2A 1YSAC 4JI0E 4KWYA 3LMLA 1XNRE 4DMIA 4BS9A 2HJJA 2YTJA 3VYYA 2YT4A 1J26A 4NXNE 2MDRA 1X47A 1YYOA 4JV5E 1T4LB 5KL4A 2UUAE 4B3TE 2LTRA 2YTIA 3BIDA 1WHNA 4WXDA 2UXBE 1A1FA 1XMQE 4WPYA 2Q8UA 1BB8A 2YTNA 1J5EE 2M9AA 2L92A 3DF6A 2EQ3A 2N3HA 1WXRA 3KWRA 4LF7E 4OX9E 1PDAA 2MDGA 1A1JA 2RPCA 2MKNA 4NHRA 2EN8A 4R8OA 3ADJA 1N33E 1X5WA 1ZBQA 4DR3E 2DRPA 1F2IG 2WZOA 2YZTA 2F4VE 4GKJE 4TUIA 1PJQA 3P1XA 1N3GA 2J7JA 2EM0A 2VRDA 2D9HA 2EPAA 2EOQA 2JXPA 3AUZA 2LJUA 1YUJA 1FKAE 2EPCA 4DV5E 2EN4A 5A6AA 4F6MA 1DGCA 2LT7A 3HPZA 1WRJA 2EMZA 1LLMC 4GKKE 1YYKA 2V89A 2FV4B 1PJTA 3TQMA 1AH5A 2MKDA 2UU9E 1GZ6A 1HNXE 3IWCA 3MHSC 4B3ME 4M9VC 2RQLA 1T39A 2I13A 1G2DC 4RH8A 1P47A 4LFCE 3IWDA 2EMBA 4O43A 2YTDA 1A1IA 4ZYGA 5AE1A 2F8BA 1EH8A 3MHHC 1EH6A 2FGGA 2EN1A 2JVAA 5KL6A 2EOIA 2JOXA 1N32E 2GLIA 2FTXB 4P78A 4BC7A 2YTEA 3ECRA 3ZOQB 2JOBA 3JU0A 4X66E 4WSPA 2DLQA 4R2EA 2YRHA 2V87A 2ZM6E 2E1MA 2NUGA 2EPMX 4YHHE 1QU6A 2EMFA 2EL4A 4IJDA 2EOHA 2NABA 1UHZA 1XMOE 4O4KA 2JYAA 3J7AG 2EPXA 4HEIA 1ZR9A 4BCAA 4JI3E
chains in the Genus database with same CATH topology
1AAYA 4R2SA 2EM2A 2EN6A 5KL4A 2YTIA 1WJPA 2R1FA 2EOSA 2EOZA 4X9JA 1A1FA 4GZNC 2EMXA 2YSOA 2WBSA 2YTNA 1BB8A 1ZU1A 2EOFA 2M9AA 2CSHA 2EMYA 2DGCA 2YTGA 2EQ3A 2EP3A 2DMIA 2EOXA 1X6FA 2EN3A 2EMHA 2WBTA 2EM6A 2EM8A 2EMWA 4R2QA 4FK5C 2MDGA 1A1JA 1A1HA 2RPCA 1X3CA 1JK2A 2MKNA 1BBOA 4WSGA 2EN8A 1UBDC 1Z1BA 4IS1C 1UN6B 2EOJA 1X5WA 2EPPA 2DRPA 1F2IG 2E72A 2YU8A 2J7JA 4R2RA 2EM0A 5KL7A 1TN9A 2VRDA 2D9HA 2ADRA 2EPAA 2EM5A 2JP9A 2EOQA 2EE8A 2PRTA 2JPAA 1B69A 1YUJA 1X6EA 2BB8A 3M99B 2A25A 2EPCA 2EPZA 4F6NA 2YTPA 2EN4A 2EL5A 4F6MA 1DGCA 1YUIA 2LT7A 2LCEA 4F2JC 2EQ1A 2EMZA 1LLMC 1NCSA 3VHTB 2WCC3 5KL5A 3UK3C 1A1GA 2EM4A 2MKDA 3EPKA 3EPLA 3EPJA 2EL6A 1A1LA 1KJKA 2LV2A 3MHSC 4M9VC 1A1KA 3EPHA 2EMGA 2YRMA 2EMLA 2I13A 2EM7A 1X6HA 2ENHA 5KL2A 1P47A 1G2DC 2EMBA 2CT1A 2LVHA 2YTDA 2EOMA 1A1IA 2EMCA 2EQ0A 1TF3A 4R2AA 1MEYC 2WBUA 2YTFA 2ENAA 2RSIA 3MHHC 2EMAA 2ELZA 1ZAAC 4R2DA 5KL3A 2EN1A 2EMIA 5KL6A 4R2PA 1JK1A 2CTDA 2YSPA 2EOIA 2EM9A 2EPUA 2ELYA 1TF6A 2EMKA 2EORA 2YTQA 2GLIA 2EOOA 4R2CA 2HGHA 2EM3A 2YTEA 2YTOA 2LO3A 2EPRA 2EOYA 2GHFA 2YU5A 2EN7A 2ENCA 1YSAC 2DLQA 4R2EA 2YRHA 2YRKA 2YTJA 2EJ4A 2EN2A 2EMFA 2EL4A 4IJDA 2EOHA 2NABA 1RMDA 2EOEA 2EPXA 1ZR9A 1G2FC 2DLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAY A;  4R2S A;  2EM2 A;  2EN6 A;  5KL4 A;  2YTI A;  1WJP A;  2R1F A;  2EOS A;  2EOZ A;  4X9J A;  1A1F A;  4GZN C;  2EMX A;  2YSO A;  2WBS A;  2YTN A;  1BB8 A;  1ZU1 A;  2EOF A;  2M9A A;  2CSH A;  2EMY A;  2DGC A;  2YTG A;  2EQ3 A;  2EP3 A;  2DMI A;  2EOX A;  1X6F A;  2EN3 A;  2EMH A;  2WBT A;  2EM6 A;  2EM8 A;  2EMW A;  4R2Q A;  4FK5 C;  2MDG A;  1A1J A;  1A1H A;  2RPC A;  1X3C A;  1JK2 A;  2MKN A;  1BBO A;  4WSG A;  2EN8 A;  1UBD C;  1Z1B A;  4IS1 C;  1UN6 B;  2EOJ A;  1X5W A;  2EPP A;  2DRP A;  1F2I G;  2E72 A;  2YU8 A;  2J7J A;  4R2R A;  2EM0 A;  5KL7 A;  1TN9 A;  2VRD A;  2D9H A;  2ADR A;  2EPA A;  2EM5 A;  2JP9 A;  2EOQ A;  2EE8 A;  2PRT A;  2JPA A;  1B69 A;  1YUJ A;  1X6E A;  2BB8 A;  3M99 B;  2A25 A;  2EPC A;  2EPZ A;  4F6N A;  2YTP A;  2EN4 A;  2EL5 A;  4F6M A;  1DGC A;  1YUI A;  2LT7 A;  2LCE A;  4F2J C;  2EQ1 A;  2EMZ A;  1LLM C;  1NCS A;  3VHT B;  2WCC 3;  5KL5 A;  3UK3 C;  1A1G A;  2EM4 A;  2MKD A;  3EPK A;  3EPL A;  3EPJ A;  2EL6 A;  1A1L A;  1KJK A;  2LV2 A;  3MHS C;  4M9V C;  1A1K A;  3EPH A;  2EMG A;  2YRM A;  2EML A;  2I13 A;  2EM7 A;  1X6H A;  2ENH A;  5KL2 A;  1P47 A;  1G2D C;  2EMB A;  2CT1 A;  2LVH A;  2YTD A;  2EOM A;  1A1I A;  2EMC A;  2EQ0 A;  1TF3 A;  4R2A A;  1MEY C;  2WBU A;  2YTF A;  2ENA A;  2RSI A;  3MHH C;  2EMA A;  2ELZ A;  1ZAA C;  4R2D A;  5KL3 A;  2EN1 A;  2EMI A;  5KL6 A;  4R2P A;  1JK1 A;  2CTD A;  2YSP A;  2EOI A;  2EM9 A;  2EPU A;  2ELY A;  1TF6 A;  2EMK A;  2EOR A;  2YTQ A;  2GLI A;  2EOO A;  4R2C A;  2HGH A;  2EM3 A;  2YTE A;  2YTO A;  2LO3 A;  2EPR A;  2EOY A;  2GHF A;  2YU5 A;  2EN7 A;  2ENC A;  1YSA C;  2DLQ A;  4R2E A;  2YRH A;  2YRK A;  2YTJ A;  2EJ4 A;  2EN2 A;  2EMF A;  2EL4 A;  4IJD A;  2EOH A;  2NAB A;  1RMD A;  2EOE A;  2EPX A;  1ZR9 A;  1G2F C;  2DLK A; 
#chains in the Genus database with same CATH topology
 4LF9 E;  2EN6 A;  1HNZ E;  2EWL A;  3HXL A;  1WJP A;  2H36 X;  2L2N A;  4X62 E;  2R1F A;  4X8W A;  5A6B D;  4X9J A;  2WBS A;  2I9I A;  3HPS A;  4WFT A;  1ZU1 A;  2EOF A;  1SFE A;  2CSH A;  1EH7 A;  2LUP B;  1YYW A;  2UXC E;  2DMI A;  2V83 A;  2EN3 A;  2EMH A;  3C6M A;  5ADZ A;  4JI7 E;  4DV6 E;  2B3T B;  5LL6 R;  4R03 A;  3J81 C;  2YPN A;  4M0V A;  2EMW A;  2L3J A;  3MSW A;  2L8T A;  3BBG A;  1X3C A;  5A2Q C;  1JK2 A;  4TUG A;  2EPK X;  1UBD C;  1Z1B A;  1T38 A;  4DV2 E;  1L4S A;  4F9B B;  2EOJ A;  4RHB B;  5LMU E;  4N4R B;  5AE3 A;  2IHR 1;  1YFH A;  2E72 A;  4NXM E;  5BR8 E;  2YU8 A;  5KL7 A;  1PKP A;  2ADR A;  2JP9 A;  2JWO A;  1X6E A;  2KON A;  1YZ9 A;  2DSY A;  3EQ1 A;  2A25 A;  5A6J A;  4L5N C;  4JI1 E;  1YUI A;  4L8N A;  2LRS A;  5CFF E;  2R76 A;  2WCC 3;  1EKZ A;  1A1G A;  1GQE A;  3EPK A;  2EL6 A;  1A1L A;  4GEQ B;  1SR9 A;  3EPH A;  2EMG A;  4AQY E;  1X6H A;  2ENH A;  2VQF E;  4B3R E;  3RMP A;  2CT1 A;  2LVH A;  2EOM A;  2EQ0 A;  4KZS A;  4R2A A;  2WBU A;  4M30 A;  2EMA A;  3OTO E;  4R2D A;  4JI5 E;  3ADG A;  2CTD A;  5A6K A;  2EPN A;  1NEI A;  2GPI A;  2L3C A;  4DV4 E;  2B7V A;  2EOO A;  2L6M A;  2EOY A;  2EN7 A;  2ODR C;  2V88 A;  4LTY A;  4KHP E;  2K4V A;  2EJ4 A;  2EN2 A;  2JY9 A;  1RMD A;  4ZYH A;  2EOE A;  1IQO A;  1G2F C;  4P7D A;  3F6H A;  1AAY A;  4R2S A;  2EM2 A;  4JI2 E;  4LF6 E;  4O5G A;  4DR7 E;  5TSE A;  4ZYD A;  2EOS A;  2EOZ A;  4LF8 E;  4GZN C;  2LBS B;  2DGC A;  2YTG A;  3J80 C;  2EP3 A;  2M1S A;  2CPN A;  3JAM C;  1ZBT A;  2EM6 A;  2V86 A;  3THN A;  5FLX C;  4R2Q A;  5AE2 A;  1IBL E;  4FK5 C;  3JTZ A;  1RQ0 A;  4OOG C;  4M2Z A;  1IBM E;  1A1H A;  2M4I A;  2RS6 A;  1BBO A;  4WSG A;  4LFA E;  5A6B A;  4J8Z A;  3KZY A;  1UN6 B;  4ZYE A;  2L2M A;  2B9D A;  1YPN A;  2EPP A;  2UXD E;  2V85 A;  4WX9 A;  1TN9 A;  4BMJ A;  1UIL A;  5DNY A;  3J7Y p;  4DV3 E;  2PRT A;  1IMU A;  4WXC A;  4DUZ E;  1B69 A;  2BB8 A;  3M99 B;  5LLQ A;  2YTP A;  2B7T A;  2EL5 A;  2RS7 A;  4DR1 E;  4DR2 E;  2LCE A;  5AAS A;  3C4B A;  3VHT B;  3HTX A;  2BBG A;  5KL5 A;  3EPL A;  3EPJ A;  3C4T A;  1DQ3 A;  2KOU A;  2VE7 C;  1A1K A;  2YRM A;  5KL2 A;  3ADI A;  2NUF A;  4MLV A;  1DI2 A;  1XNQ E;  2LMZ A;  3OML A;  1MEY C;  2HHH E;  1WHQ A;  2ENA A;  2RSI A;  3VYX A;  3K6Q A;  2VQE E;  2ELZ A;  1ZAA C;  5KL3 A;  4JI4 E;  4R2P A;  2EMI A;  4BC9 A;  4X64 E;  1GTK A;  2EM9 A;  2ELY A;  2EMK A;  2EOR A;  3HQ1 A;  2K7I A;  4R2C A;  2UUC E;  2EM3 A;  2LO3 A;  1QNT A;  2EPR A;  2GHF A;  2ENC A;  4MLQ A;  4BHC A;  2MC5 A;  1STU A;  1HR0 E;  2YRK A;  2DMY A;  1O0W A;  3FIG A;  4Q35 B;  2G7H A;  4JYA E;  1IBK E;  4HTG A;  4LU9 A;  2DLK A;  1KYQ A;  2VF1 A;  3C6K A;  3THO B;  4JI8 E;  3QG5 C;  2E5L E;  4I8O A;  2EMX A;  2YSO A;  4DV1 E;  4DR6 E;  2EMY A;  4BHB A;  1N36 E;  4DV0 E;  2EOX A;  1X6F A;  2WBT A;  2EM8 A;  4BBY A;  1T4N A;  4DKK A;  3AV0 A;  3ADL A;  4F9C B;  3L00 A;  2JR1 A;  2RSM A;  1N34 E;  4X65 E;  2KHX A;  3BF2 A;  2RTX A;  3T1H E;  5IV8 B;  4IS1 C;  4F9A B;  2UUB E;  2V8Q B;  2DB2 A;  3T1Y E;  4LFB E;  3BGH A;  4WYQ B;  5T6J A;  4B3S E;  4LF4 E;  4O24 A;  1MGT A;  4YY3 E;  4R2R A;  1X49 A;  4K0K E;  2EM5 A;  2EE8 A;  2JPA A;  5A69 A;  5AC5 A;  3DJW A;  2NUE A;  1RC7 A;  5IT9 C;  5LMN E;  2EPZ A;  4F6N A;  4Q28 A;  2LE2 A;  4DR4 E;  3LLH A;  2MC6 A;  4F2J C;  1T4O A;  2EQ1 A;  4LF5 E;  2HC5 A;  1NCS A;  3KZZ A;  5AC4 A;  2M7Q A;  3UK3 C;  2EM4 A;  3F6G A;  1KJK A;  2EZ6 A;  1BBG A;  5IWA E;  2LV2 A;  2YWQ A;  2EPO A;  2L33 A;  2EML A;  2EM7 A;  2LTS A;  1PJS A;  2N3G A;  2EMC A;  1TF3 A;  2YTF A;  3VK6 A;  3IWB A;  1X48 A;  2ODR D;  4DV7 E;  4DUY E;  4F54 A;  5IXM B;  4NZV A;  2LJH A;  1JK1 A;  1FJG E;  2YSP A;  2EPU A;  1TF6 A;  1IQS A;  2YTQ A;  2L2K B;  2HGH A;  2DIX A;  2N8X A;  2YTO A;  3H09 A;  5F3W A;  2LUQ A;  1I94 E;  2EPL X;  2YU5 A;  1HNW E;  4JI6 E;  4DR5 E;  2NA2 A;  1YSA C;  4JI0 E;  4KWY A;  3LML A;  1XNR E;  4DMI A;  4BS9 A;  2HJJ A;  2YTJ A;  3VYY A;  2YT4 A;  1J26 A;  4NXN E;  2MDR A;  1X47 A;  1YYO A;  4JV5 E;  1T4L B;  5KL4 A;  2UUA E;  4B3T E;  2LTR A;  2YTI A;  3BID A;  1WHN A;  4WXD A;  2UXB E;  1A1F A;  1XMQ E;  4WPY A;  2Q8U A;  1BB8 A;  2YTN A;  1J5E E;  2M9A A;  2L92 A;  3DF6 A;  2EQ3 A;  2N3H A;  1WXR A;  3KWR A;  4LF7 E;  4OX9 E;  1PDA A;  2MDG A;  1A1J A;  2RPC A;  2MKN A;  4NHR A;  2EN8 A;  4R8O A;  3ADJ A;  1N33 E;  1X5W A;  1ZBQ A;  4DR3 E;  2DRP A;  1F2I G;  2WZO A;  2YZT A;  2F4V E;  4GKJ E;  4TUI A;  1PJQ A;  3P1X A;  1N3G A;  2J7J A;  2EM0 A;  2VRD A;  2D9H A;  2EPA A;  2EOQ A;  2JXP A;  3AUZ A;  2LJU A;  1YUJ A;  1FKA E;  2EPC A;  4DV5 E;  2EN4 A;  5A6A A;  4F6M A;  1DGC A;  2LT7 A;  3HPZ A;  1WRJ A;  2EMZ A;  1LLM C;  4GKK E;  1YYK A;  2V89 A;  2FV4 B;  1PJT A;  3TQM A;  1AH5 A;  2MKD A;  2UU9 E;  1GZ6 A;  1HNX E;  3IWC A;  3MHS C;  4B3M E;  4M9V C;  2RQL A;  1T39 A;  2I13 A;  1G2D C;  4RH8 A;  1P47 A;  4LFC E;  3IWD A;  2EMB A;  4O43 A;  2YTD A;  1A1I A;  4ZYG A;  5AE1 A;  2F8B A;  1EH8 A;  3MHH C;  1EH6 A;  2FGG A;  2EN1 A;  2JVA A;  5KL6 A;  2EOI A;  2JOX A;  1N32 E;  2GLI A;  2FTX B;  4P78 A;  4BC7 A;  2YTE A;  3ECR A;  3ZOQ B;  2JOB A;  3JU0 A;  4X66 E;  4WSP A;  2DLQ A;  4R2E A;  2YRH A;  2V87 A;  2ZM6 E;  2E1M A;  2NUG A;  2EPM X;  4YHH E;  1QU6 A;  2EMF A;  2EL4 A;  4IJD A;  2EOH A;  2NAB A;  1UHZ A;  1XMO E;  4O4K A;  2JYA A;  3J7A G;  2EPX A;  4HEI A;  1ZR9 A;  4BCA A;  4JI3 E; 
#chains in the Genus database with same CATH homology
 1AAY A;  4R2S A;  2EM2 A;  2EN6 A;  5KL4 A;  2YTI A;  1WJP A;  2R1F A;  2EOS A;  2EOZ A;  4X9J A;  1A1F A;  4GZN C;  2EMX A;  2YSO A;  2WBS A;  2YTN A;  1BB8 A;  1ZU1 A;  2EOF A;  2M9A A;  2CSH A;  2EMY A;  2DGC A;  2YTG A;  2EQ3 A;  2EP3 A;  2DMI A;  2EOX A;  1X6F A;  2EN3 A;  2EMH A;  2WBT A;  2EM6 A;  2EM8 A;  2EMW A;  4R2Q A;  4FK5 C;  2MDG A;  1A1J A;  1A1H A;  2RPC A;  1X3C A;  1JK2 A;  2MKN A;  1BBO A;  4WSG A;  2EN8 A;  1UBD C;  1Z1B A;  4IS1 C;  1UN6 B;  2EOJ A;  1X5W A;  2EPP A;  2DRP A;  1F2I G;  2E72 A;  2YU8 A;  2J7J A;  4R2R A;  2EM0 A;  5KL7 A;  1TN9 A;  2VRD A;  2D9H A;  2ADR A;  2EPA A;  2EM5 A;  2JP9 A;  2EOQ A;  2EE8 A;  2PRT A;  2JPA A;  1B69 A;  1YUJ A;  1X6E A;  2BB8 A;  3M99 B;  2A25 A;  2EPC A;  2EPZ A;  4F6N A;  2YTP A;  2EN4 A;  2EL5 A;  4F6M A;  1DGC A;  1YUI A;  2LT7 A;  2LCE A;  4F2J C;  2EQ1 A;  2EMZ A;  1LLM C;  1NCS A;  3VHT B;  2WCC 3;  5KL5 A;  3UK3 C;  1A1G A;  2EM4 A;  2MKD A;  3EPK A;  3EPL A;  3EPJ A;  2EL6 A;  1A1L A;  1KJK A;  2LV2 A;  3MHS C;  4M9V C;  1A1K A;  3EPH A;  2EMG A;  2YRM A;  2EML A;  2I13 A;  2EM7 A;  1X6H A;  2ENH A;  5KL2 A;  1P47 A;  1G2D C;  2EMB A;  2CT1 A;  2LVH A;  2YTD A;  2EOM A;  1A1I A;  2EMC A;  2EQ0 A;  1TF3 A;  4R2A A;  1MEY C;  2WBU A;  2YTF A;  2ENA A;  2RSI A;  3MHH C;  2EMA A;  2ELZ A;  1ZAA C;  4R2D A;  5KL3 A;  2EN1 A;  2EMI A;  5KL6 A;  4R2P A;  1JK1 A;  2CTD A;  2YSP A;  2EOI A;  2EM9 A;  2EPU A;  2ELY A;  1TF6 A;  2EMK A;  2EOR A;  2YTQ A;  2GLI A;  2EOO A;  4R2C A;  2HGH A;  2EM3 A;  2YTE A;  2YTO A;  2LO3 A;  2EPR A;  2EOY A;  2GHF A;  2YU5 A;  2EN7 A;  2ENC A;  1YSA C;  2DLQ A;  4R2E A;  2YRH A;  2YRK A;  2YTJ A;  2EJ4 A;  2EN2 A;  2EMF A;  2EL4 A;  4IJD A;  2EOH A;  2NAB A;  1RMD A;  2EOE A;  2EPX A;  1ZR9 A;  1G2F C;  2DLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...