3BGHA

Crystal structure of putative neuraminyllactose-binding hemagglutinin homolog from helicobacter pylori
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
187
Chain Sequence
VELHFHYPIKGKQEPKNSHLVVLIEPKIEINKVIPESYQKEFEKSLFLQLSSFLERKGYSVSQFKDASEIPQDIKEKALLVLRMDGNVAILEDIVEESDALSEEKVIDMSSGYLNLNFVEPKSEDIIHSFGIDVSKIKAVIERVKETDHDQAIRKIMNQAYHKVMVHITKELSKKHMEHYEKVSSEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative neuraminyllactose-binding hemagglutinin homolog
publication title Crystal structure of putative neuraminyllactose-binding hemagglutinin homolog from Helicobacter pylori.
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
total genus 57
structure length 187
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.180 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Putative neuraminyllactose-binding hemagglutinin homolog like domain 3bghA01
3BGHA 2I9IA
chains in the Genus database with same CATH superfamily
2EL6A 5ADZA 3HQ1A 1RC7A 2ODRC 3BBGA 5KL4A 3MHSC 2EPPA 2YTNA 2LO3A 4M9VC 4RH8A 4N4RB 2UU9E 4JV5E 4DKKA 2DLQA 2RPCA 3J80C 2YRKA 5IT9C 4LFAE 1BBOA 5KL5A 3MSWA 4NZVA 2JP9A 4JI4E 2EN6A 3JAMC 1A1FA 1T4OA 4LFCE 5IXMB 1IMUA 2UUAE 1GQEA 4J8ZA 2LT7A 1IBKE 4F2JC 1YSAC 2N3HA 2DB2A 4DUZE 1Z1BA 2EOOA 1PJTA 4OOGC 2B3TB 3HXLA 4NXNE 2KONA 4DR6E 2EM9A 5KL2A 1YYKA 1EH7A 2EOZA 4WSPA 5A2QC 2YTDA 2YWQA 2HGHA 2EPKX 4F9BB 4L5NC 2EN4A 2YSOA 2K4VA 4R2RA 2KHXA 3AUZA 2MDRA 2RS6A 2YRHA 2YZTA 4X64E 3VYXA 2EMIA 4K0KE 4DV0E 2DIXA 1G2DC 2MKNA 3F6HA 2WBUA 1L4SA 1AAYA 2EMLA 1I94E 2LJHA 2DLKA 2R76A 2WZOA 4DR7E 2E5LE 3BIDA 2EOYA 2HC5A 4JI0E 4BS9A 5A6KA 2LMZA 4NXME 4O43A 4JI8E 3ZOQB 5A6BA 2YTPA 5A6AA 2EQ0A 2N8XA 1N3GA 2EMCA 2EM5A 2BB8A 2B9DA 2JOXA 2EL5A 1F2IG 1O0WA 2PRTA 1A1LA 2N3GA 1A1IA 2EOJA 2EPXA 4L8NA 5DNYA 2UUBE 2FTXB 4HTGA 2JY9A 1XMQE 1YUIA 4F9AB 2EM4A 1T4LB 2LUPB 2E72A 1ZBQA 2V83A 5KL7A 3EPKA 1N32E 2EMZA 3KWRA 4I8OA 4B3TE 2YTGA 3DF6A 2YTIA 2MC5A 2HHHE 2EPNA 3JTZA 1WHNA 3ADJA 1PDAA 1PJQA 4JI2E 2D9HA 2JYAA 2L2KB 2F4VE 3RMPA 1ZU1A 4BCAA 1WHQA 4DV2E 2R1FA 2NUEA 2FGGA 2EE8A 4FK5C 1X48A 4B3ME 2WBSA 4M0VA 2NA2A 2NABA 4LTYA 1TN9A 2EMYA 2E1MA 2F8BA 2EMBA 3C6KA 1EKZA 1QU6A 1BBGA 2EOMA 1T4NA 3C4BA 1ZAAC 4JYAE 1UHZA 2LV2A 2KOUA 2CTDA 4WXCA 2EJ4A 2ENCA 2EOSA 4WYQB 1N34E 1HR0E 1IQSA 2LUQA 2JR1A 2GLIA 1TF3A 2K7IA 4KZSA 2EMAA 2WCC3 1QNTA 3J7Yp 2MKDA 4F6MA 2V88A 2H36X 4R03A 2EPMX 3IWDA 4WSGA 1T38A 5A6JA 1YYWA 1A1HA 1T39A 4DV3E 2J7JA 5KL6A 4X66E 2DMYA 4GEQB 1X5WA 2UXCE 1X6HA 2EMHA 1YZ9A 2EM0A 1A1GA 1DI2A 2B7TA 2MC6A 5AE2A 1NCSA 3ADLA 2GHFA 2GPIA 4LF9E 1GTKA 2EL4A 2YTFA 4BMJA 1N36E 4B3RE 3HPZA 4M2ZA 2DRPA 5AC4A 2LCEA 4LF5E 2Q8UA 2EM2A 4LF4E 1AH5A 1IQOA 3KZZA 1X6FA 2EMXA 4JI5E 4DMIA 2YT4A 3J7AG 2LJUA 5FLXC 4KHPE 1WRJA 4BHCA 5LLQA 2CSHA 4NHRA 4Q28A 1X6EA 2JPAA 4B3SE 4O5GA 3OTOE 4DV1E 3TQMA 2EPOA 1XMOE 1J26A 2EOFA 4WPYA 1YYOA 2ODRD 3K6QA 2VRDA 2EM7A 2I13A 1RMDA 3HTXA 2M4IA 2MDGA 3UK3C 2EPUA 3J81C 2V86A 4DV7E 4BBYA 1HNZE 5AASA 4ZYHA 4DR1E 3MHHC 2V87A 1X47A 2EWLA 4DR3E 2EMFA 4DV6E 2JVAA 4R2CA 1JK1A 1SFEA 5BR8E 1FJGE 4X8WA 2IHR1 4BC9A 3AV0A 4R2EA 4GZNC 1X3CA 4ZYEA 2EN7A 2EORA 2EN8A 4F9CB 3P1XA 1EH8A 5CFFE 1SR9A 5IV8B 4LF8E 2ENAA 4F6NA 1HNXE 2RS7A 4TUGA 3EPLA 1J5EE 2EM3A 3ADGA 2WBTA 2YPNA 1YFHA 1HNWE 2RSIA 2EMWA 1ZBTA 4DR4E 2UXBE 3BF2A 3IWCA 2NUGA 1EH6A 5F3WA 5A69A 3JU0A 1A1KA 3LLHA 2B7VA 4O24A 2RQLA 2M7QA 5A6BD 4DV5E 1XNRE 2ZM6E 2YTOA 3KZYA 4R2QA 3VYYA 3BGHA 2L2NA 4OX9E 1PKPA 3HPSA 3LMLA 2EN3A 2NUFA 2L8TA 2EQ3A 2LRSA 2L3CA 1STUA 2EMGA 4R2PA 5AE1A 2V8QB 3EPJA 2EQ1A 1A1JA 2YU5A 3L00A 4HEIA 4MLVA 2L92A 3M99B 2UUCE 4WXDA 2L33A 5LMUE 2RTXA 1MEYC 3VK6A 4BHBA 1GZ6A 1B69A 3IWBA 2YSPA 2JWOA 3EPHA 2RSMA 4LFBE 2L3JA 1NEIA 2EOHA 1DGCA 2EOXA 2LE2A 2VF1A 4X65E 4IJDA 2ENHA 2VQEE 3OMLA 2VE7C 2LTSA 1YPNA 2EM8A 4LU9A 5IWAE 3QG5C 5T6JA 1IBLE 2DMIA 2HJJA 3T1YE 2FV4B 1BB8A 1MGTA 2EOEA 4GKKE 2EPCA 2G7HA 4GKJE 4JI3E 1LLMC 2EMKA 3EQ1A 2EPZA 1TF6A 3H09A 2CPNA 4TUIA 5TSEA 4ZYDA 2L6MA 1WJPA 4WX9A 2EOIA 5AC5A 2A25A 2YRMA 4IS1C 1KJKA 4KWYA 2YTQA 2ADRA 1IBME 4AQYE 3FIGA 1FKAE 2LTRA 3ADIA 1P47A 4LF6E 1KYQA 2V85A 4R2SA 1DQ3A 4RHBB 4ZYGA 3T1HE 1XNQE 4P78A 4DV4E 1RQ0A 2ELYA 2EN1A 4DUYE 4F54A 2DSYA 5KL3A 3F6GA 4JI6E 4M30A 2M9AA 3THNA 4R2DA 4MLQA 1N33E 2EPLX 1JK2A 2EP3A 2M1SA 3THOB 4X62E 1UN6B 4Q35B 4YHHE 1PJSA 1ZR9A 2YTJA 2EN2A 4P7DA 2DGCA 4DR2E 3DJWA 1WXRA 1X49A 4WFTA 2CT1A 2JXPA 4DR5E 4X9JA 2BBGA 2EOQA 2EPRA 3C6MA 1UILA 4R2AA 2EPAA 3ECRA 2YU8A 3VHTB 2ELZA 5AE3A 1YUJA 4BC7A 2EZ6A 2LBSB 3C4TA 4JI1E 4O4KA 4JI7E 1G2FC 4R8OA 2UXDE 2LVHA 2L2MA 4YY3E 2EM6A 1UBDC 2I9IA 2V89A 2VQFE 2JOBA 5LMNE 2YTEA 4LF7E 5LL6R
chains in the Genus database with same CATH topology
3BGHA 2I9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BGH A;  2I9I A; 
#chains in the Genus database with same CATH topology
 2EL6 A;  5ADZ A;  3HQ1 A;  1RC7 A;  2ODR C;  3BBG A;  5KL4 A;  3MHS C;  2EPP A;  2YTN A;  2LO3 A;  4M9V C;  4RH8 A;  4N4R B;  2UU9 E;  4JV5 E;  4DKK A;  2DLQ A;  2RPC A;  3J80 C;  2YRK A;  5IT9 C;  4LFA E;  1BBO A;  5KL5 A;  3MSW A;  4NZV A;  2JP9 A;  4JI4 E;  2EN6 A;  3JAM C;  1A1F A;  1T4O A;  4LFC E;  5IXM B;  1IMU A;  2UUA E;  1GQE A;  4J8Z A;  2LT7 A;  1IBK E;  4F2J C;  1YSA C;  2N3H A;  2DB2 A;  4DUZ E;  1Z1B A;  2EOO A;  1PJT A;  4OOG C;  2B3T B;  3HXL A;  4NXN E;  2KON A;  4DR6 E;  2EM9 A;  5KL2 A;  1YYK A;  1EH7 A;  2EOZ A;  4WSP A;  5A2Q C;  2YTD A;  2YWQ A;  2HGH A;  2EPK X;  4F9B B;  4L5N C;  2EN4 A;  2YSO A;  2K4V A;  4R2R A;  2KHX A;  3AUZ A;  2MDR A;  2RS6 A;  2YRH A;  2YZT A;  4X64 E;  3VYX A;  2EMI A;  4K0K E;  4DV0 E;  2DIX A;  1G2D C;  2MKN A;  3F6H A;  2WBU A;  1L4S A;  1AAY A;  2EML A;  1I94 E;  2LJH A;  2DLK A;  2R76 A;  2WZO A;  4DR7 E;  2E5L E;  3BID A;  2EOY A;  2HC5 A;  4JI0 E;  4BS9 A;  5A6K A;  2LMZ A;  4NXM E;  4O43 A;  4JI8 E;  3ZOQ B;  5A6B A;  2YTP A;  5A6A A;  2EQ0 A;  2N8X A;  1N3G A;  2EMC A;  2EM5 A;  2BB8 A;  2B9D A;  2JOX A;  2EL5 A;  1F2I G;  1O0W A;  2PRT A;  1A1L A;  2N3G A;  1A1I A;  2EOJ A;  2EPX A;  4L8N A;  5DNY A;  2UUB E;  2FTX B;  4HTG A;  2JY9 A;  1XMQ E;  1YUI A;  4F9A B;  2EM4 A;  1T4L B;  2LUP B;  2E72 A;  1ZBQ A;  2V83 A;  5KL7 A;  3EPK A;  1N32 E;  2EMZ A;  3KWR A;  4I8O A;  4B3T E;  2YTG A;  3DF6 A;  2YTI A;  2MC5 A;  2HHH E;  2EPN A;  3JTZ A;  1WHN A;  3ADJ A;  1PDA A;  1PJQ A;  4JI2 E;  2D9H A;  2JYA A;  2L2K B;  2F4V E;  3RMP A;  1ZU1 A;  4BCA A;  1WHQ A;  4DV2 E;  2R1F A;  2NUE A;  2FGG A;  2EE8 A;  4FK5 C;  1X48 A;  4B3M E;  2WBS A;  4M0V A;  2NA2 A;  2NAB A;  4LTY A;  1TN9 A;  2EMY A;  2E1M A;  2F8B A;  2EMB A;  3C6K A;  1EKZ A;  1QU6 A;  1BBG A;  2EOM A;  1T4N A;  3C4B A;  1ZAA C;  4JYA E;  1UHZ A;  2LV2 A;  2KOU A;  2CTD A;  4WXC A;  2EJ4 A;  2ENC A;  2EOS A;  4WYQ B;  1N34 E;  1HR0 E;  1IQS A;  2LUQ A;  2JR1 A;  2GLI A;  1TF3 A;  2K7I A;  4KZS A;  2EMA A;  2WCC 3;  1QNT A;  3J7Y p;  2MKD A;  4F6M A;  2V88 A;  2H36 X;  4R03 A;  2EPM X;  3IWD A;  4WSG A;  1T38 A;  5A6J A;  1YYW A;  1A1H A;  1T39 A;  4DV3 E;  2J7J A;  5KL6 A;  4X66 E;  2DMY A;  4GEQ B;  1X5W A;  2UXC E;  1X6H A;  2EMH A;  1YZ9 A;  2EM0 A;  1A1G A;  1DI2 A;  2B7T A;  2MC6 A;  5AE2 A;  1NCS A;  3ADL A;  2GHF A;  2GPI A;  4LF9 E;  1GTK A;  2EL4 A;  2YTF A;  4BMJ A;  1N36 E;  4B3R E;  3HPZ A;  4M2Z A;  2DRP A;  5AC4 A;  2LCE A;  4LF5 E;  2Q8U A;  2EM2 A;  4LF4 E;  1AH5 A;  1IQO A;  3KZZ A;  1X6F A;  2EMX A;  4JI5 E;  4DMI A;  2YT4 A;  3J7A G;  2LJU A;  5FLX C;  4KHP E;  1WRJ A;  4BHC A;  5LLQ A;  2CSH A;  4NHR A;  4Q28 A;  1X6E A;  2JPA A;  4B3S E;  4O5G A;  3OTO E;  4DV1 E;  3TQM A;  2EPO A;  1XMO E;  1J26 A;  2EOF A;  4WPY A;  1YYO A;  2ODR D;  3K6Q A;  2VRD A;  2EM7 A;  2I13 A;  1RMD A;  3HTX A;  2M4I A;  2MDG A;  3UK3 C;  2EPU A;  3J81 C;  2V86 A;  4DV7 E;  4BBY A;  1HNZ E;  5AAS A;  4ZYH A;  4DR1 E;  3MHH C;  2V87 A;  1X47 A;  2EWL A;  4DR3 E;  2EMF A;  4DV6 E;  2JVA A;  4R2C A;  1JK1 A;  1SFE A;  5BR8 E;  1FJG E;  4X8W A;  2IHR 1;  4BC9 A;  3AV0 A;  4R2E A;  4GZN C;  1X3C A;  4ZYE A;  2EN7 A;  2EOR A;  2EN8 A;  4F9C B;  3P1X A;  1EH8 A;  5CFF E;  1SR9 A;  5IV8 B;  4LF8 E;  2ENA A;  4F6N A;  1HNX E;  2RS7 A;  4TUG A;  3EPL A;  1J5E E;  2EM3 A;  3ADG A;  2WBT A;  2YPN A;  1YFH A;  1HNW E;  2RSI A;  2EMW A;  1ZBT A;  4DR4 E;  2UXB E;  3BF2 A;  3IWC A;  2NUG A;  1EH6 A;  5F3W A;  5A69 A;  3JU0 A;  1A1K A;  3LLH A;  2B7V A;  4O24 A;  2RQL A;  2M7Q A;  5A6B D;  4DV5 E;  1XNR E;  2ZM6 E;  2YTO A;  3KZY A;  4R2Q A;  3VYY A;  3BGH A;  2L2N A;  4OX9 E;  1PKP A;  3HPS A;  3LML A;  2EN3 A;  2NUF A;  2L8T A;  2EQ3 A;  2LRS A;  2L3C A;  1STU A;  2EMG A;  4R2P A;  5AE1 A;  2V8Q B;  3EPJ A;  2EQ1 A;  1A1J A;  2YU5 A;  3L00 A;  4HEI A;  4MLV A;  2L92 A;  3M99 B;  2UUC E;  4WXD A;  2L33 A;  5LMU E;  2RTX A;  1MEY C;  3VK6 A;  4BHB A;  1GZ6 A;  1B69 A;  3IWB A;  2YSP A;  2JWO A;  3EPH A;  2RSM A;  4LFB E;  2L3J A;  1NEI A;  2EOH A;  1DGC A;  2EOX A;  2LE2 A;  2VF1 A;  4X65 E;  4IJD A;  2ENH A;  2VQE E;  3OML A;  2VE7 C;  2LTS A;  1YPN A;  2EM8 A;  4LU9 A;  5IWA E;  3QG5 C;  5T6J A;  1IBL E;  2DMI A;  2HJJ A;  3T1Y E;  2FV4 B;  1BB8 A;  1MGT A;  2EOE A;  4GKK E;  2EPC A;  2G7H A;  4GKJ E;  4JI3 E;  1LLM C;  2EMK A;  3EQ1 A;  2EPZ A;  1TF6 A;  3H09 A;  2CPN A;  4TUI A;  5TSE A;  4ZYD A;  2L6M A;  1WJP A;  4WX9 A;  2EOI A;  5AC5 A;  2A25 A;  2YRM A;  4IS1 C;  1KJK A;  4KWY A;  2YTQ A;  2ADR A;  1IBM E;  4AQY E;  3FIG A;  1FKA E;  2LTR A;  3ADI A;  1P47 A;  4LF6 E;  1KYQ A;  2V85 A;  4R2S A;  1DQ3 A;  4RHB B;  4ZYG A;  3T1H E;  1XNQ E;  4P78 A;  4DV4 E;  1RQ0 A;  2ELY A;  2EN1 A;  4DUY E;  4F54 A;  2DSY A;  5KL3 A;  3F6G A;  4JI6 E;  4M30 A;  2M9A A;  3THN A;  4R2D A;  4MLQ A;  1N33 E;  2EPL X;  1JK2 A;  2EP3 A;  2M1S A;  3THO B;  4X62 E;  1UN6 B;  4Q35 B;  4YHH E;  1PJS A;  1ZR9 A;  2YTJ A;  2EN2 A;  4P7D A;  2DGC A;  4DR2 E;  3DJW A;  1WXR A;  1X49 A;  4WFT A;  2CT1 A;  2JXP A;  4DR5 E;  4X9J A;  2BBG A;  2EOQ A;  2EPR A;  3C6M A;  1UIL A;  4R2A A;  2EPA A;  3ECR A;  2YU8 A;  3VHT B;  2ELZ A;  5AE3 A;  1YUJ A;  4BC7 A;  2EZ6 A;  2LBS B;  3C4T A;  4JI1 E;  4O4K A;  4JI7 E;  1G2F C;  4R8O A;  2UXD E;  2LVH A;  2L2M A;  4YY3 E;  2EM6 A;  1UBD C;  2I9I A;  2V89 A;  2VQF E;  2JOB A;  5LMN E;  2YTE A;  4LF7 E;  5LL6 R; 
#chains in the Genus database with same CATH homology
 3BGH A;  2I9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...