3BGHA

Crystal structure of putative neuraminyllactose-binding hemagglutinin homolog from helicobacter pylori
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
187
Chain Sequence
VELHFHYPIKGKQEPKNSHLVVLIEPKIEINKVIPESYQKEFEKSLFLQLSSFLERKGYSVSQFKDASEIPQDIKEKALLVLRMDGNVAILEDIVEESDALSEEKVIDMSSGYLNLNFVEPKSEDIIHSFGIDVSKIKAVIERVKETDHDQAIRKIMNQAYHKVMVHITKELSKKHMEHYEKVSSEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative neuraminyllactose-binding hemagglutinin homolog
publication title Crystal structure of putative neuraminyllactose-binding hemagglutinin homolog from Helicobacter pylori.
rcsb
source organism Helicobacter pylori
total genus 57
structure length 187
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.180 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Putative neuraminyllactose-binding hemagglutinin homolog like domain 3bghA01
3BGHA 2I9IA
chains in the Genus database with same CATH superfamily
1N32E 2EMAA 2LUQA 2M9AA 4BC9A 5AC4A 4JYAE 2EM7A 4JI8E 4R2DA 4LF9E 2LRSA 1YZ9A 4B3TE 1XNQE 2KOUA 5F3WA 1EH7A 2EP3A 2HJJA 2ODRD 2EOMA 3IWCA 2RTXA 4DR1E 2VE7C 1HR0E 4DR3E 3BGHA 3THOB 4JI5E 2EL6A 1RQ0A 2JWOA 2E1MA 2FTXB 3AUZA 4X65E 2LE2A 2LT7A 5T6JA 2MDGA 1AH5A 5ADZA 4B3RE 4GKKE 1PKPA 4JI3E 4BHBA 4HEIA 1T4OA 2ELYA 4P7DA 3KZYA 2Q8UA 3C4BA 1A1HA 4X8WA 2N3GA 4BBYA 4R8OA 2L2NA 1ZU1A 4WFTA 1ZBQA 3J7Yp 5CFFE 2EOHA 1Z1BA 4LFAE 4JI7E 2EMFA 1WRJA 1IBLE 4JI6E 2RPCA 4M9VC 3BIDA 2JVAA 3C6MA 1ZBTA 2EPLX 1HNWE 2YU8A 4JV5E 2EJ4A 2VF1A 2LO3A 1GZ6A 1DGCA 2MDRA 4R2CA 4BS9A 4KZSA 1HNXE 2I13A 1N33E 4WPYA 1A1GA 1YSAC 2EM0A 5AASA 1RMDA 2YTPA 4LF7E 1O0WA 4TUGA 1N3GA 2JR1A 4BHCA 2K4VA 2D9HA 4TUIA 2EMHA 4J8ZA 2LTRA 3THNA 5AE3A 3IWDA 3HPSA 1TF3A 1X6EA 2L2MA 1YYKA 5A6JA 4HTGA 2GPIA 2EQ1A 2EMGA 3T1HE 4X64E 4DV2E 4LF4E 3QG5C 4R2AA 1L4SA 4F6NA 1FJGE 2EMXA 4O43A 2NUEA 2HC5A 2YSOA 2YTQA 2ELZA 3K6QA 2EM6A 1A1KA 2EN3A 2EOSA 4DV1E 4L5NC 2UUCE 3DF6A 3HQ1A 2ZM6E 1IBKE 3VYXA 2EQ3A 2LTSA 2JXPA 2EE8A 4LTYA 3MHHC 1F2IG 1YUIA 2V83A 2CT1A 4M0VA 2EOEA 5BR8E 2R76A 1IBME 1LLMC 2ODRC 3LMLA 1IMUA 1X6HA 2EPKX 5KL3A 4FK5C 4IJDA 2EOZA 2EN2A 1UILA 2ADRA 3P1XA 2JOBA 1YYWA 5IXMB 2DLKA 2K7IA 2L33A 2I9IA 1T4NA 2F8BA 3J7AG 4DR2E 3BF2A 1IQOA 2EMYA 5LMNE 4DV7E 2N3HA 5FLXC 2NABA 2R1FA 1EKZA 1WHNA 2ENAA 2DGCA 3RMPA 1P47A 4BMJA 2UXCE 5KL7A 2GLIA 4ZYEA 2YTIA 2L3CA 4F54A 4DV4E 3ADJA 2B7TA 2YRKA 3LLHA 2RS6A 2UUBE 1J5EE 1DQ3A 4Q35B 4OX9E 1PJSA 2LBSB 3MSWA 3ADGA 2YTFA 4Q28A 2YU5A 2YWQA 4LFCE 3JTZA 4DV5E 2YTOA 2RSMA 2DMYA 2DLQA 2EM3A 2EMCA 2ENCA 2LMZA 3EPJA 5KL5A 2YT4A 5TSEA 2KONA 3JAMC 2EMZA 4YY3E 4NXNE 4M2ZA 3T1YE 4DUYE 4GKJE 2LUPB 2EM5A 2UU9E 2EPCA 2VRDA 2EWLA 4K0KE 1HNZE 3HPZA 1SR9A 4DMIA 2E72A 2EMWA 1A1FA 1PJQA 3OTOE 2EOYA 2EPOA 2HGHA 1T38A 2EMBA 2EM4A 4M30A 4X66E 2GHFA 1G2DC 3KZZA 2E5LE 2YTGA 4F9BB 4LF6E 2YRHA 1TF6A 2N8XA 5A2QC 2EPUA 1AAYA 1XMOE 2EPNA 2EN8A 4BC7A 2RQLA 4O24A 1WXRA 2DB2A 1UBDC 2MC6A 2EL5A 1X48A 3IWBA 5IT9C 1A1LA 4MLVA 2IHR1 2EOIA 4JI1E 5LL6R 5A6AA 1N36E 4P78A 2EM2A 2EM9A 3FIGA 2DIXA 3OMLA 1X5WA 2EOJA 1NCSA 4X9JA 2MC5A 5LMUE 2EN4A 4F9AB 1YPNA 2RS7A 3MHSC 4OOGC 4ZYHA 1SFEA 4O4KA 4NXME 2WCC3 2M1SA 4I8OA 2JPAA 4WSGA 4NHRA 4WXDA 1A1IA 1ZR9A 2WBUA 4WSPA 4GZNC 5A6KA 4WX9A 2BB8A 4GEQB 2HHHE 3JU0A 4JI2E 2DSYA 5A6BD 2L3JA 2V86A 2CTDA 1XNRE 1MGTA 2V87A 1X6FA 2EPAA 2YTEA 4RH8A 2LVHA 1EH8A 2B9DA 1WHQA 3M99B 2PRTA 1NEIA 2EZ6A 2YPNA 2DRPA 4B3SE 4YHHE 2EPPA 2EOOA 4KHPE 3ECRA 5A69A 1I94E 4LU9A 4R2PA 1ZAAC 2V88A 4ZYGA 1GQEA 4NZVA 2L6MA 2NUFA 1JK2A 1X49A 1QU6A 1IQSA 2EN7A 5AE2A 3ADLA 4WXCA 2YSPA 1GTKA 2LJHA 2EPZA 4F9CB 1A1JA 1YFHA 4IS1C 1J26A 2JP9A 1EH6A 3ZOQB 1UN6B 1KJKA 1FKAE 2JYAA 2KHXA 2FGGA 4DR6E 5KL6A 1PJTA 5A6BA 2EPRA 2B3TB 4DV0E 2EOQA 3F6HA 1N34E 3DJWA 4B3ME 1RC7A 4R2SA 4R2RA 2EN1A 2F4VE 2YTJA 3C4TA 4DR7E 4WYQB 2V89A 4AQYE 2MKDA 2YRMA 5LLQA 3F6GA 2VQEE 2LCEA 4DV6E 2EL4A 3BBGA 4F2JC 4DR5E 2L92A 2UXDE 4DV3E 4MLQA 5AE1A 2L2KB 2NUGA 2EOFA 2EOXA 3VYYA 2EPXA 1T39A 2YTDA 4JI0E 4O5GA 2M4IA 1WJPA 1JK1A 3ADIA 1X47A 3HTXA 2EQ0A 3EPKA 1YYOA 1XMQE 2CSHA 3EPLA 4R2EA 2CPNA 4L8NA 2MKNA 4KWYA 2YTNA 2WZOA 2VQFE 1UHZA 2WBSA 4RHBB 1YUJA 1PDAA 3EPHA 4ZYDA 4R2QA 1TN9A 2RSIA 3TQMA 2EMLA 2EORA 2UUAE 2G7HA 3C6KA 3VHTB 2JY9A 4LFBE 2M7QA 2EMIA 3H09A 2L8TA 3VK6A 4F6MA 1G2FC 1MEYC 2UXBE 4BCAA 3AV0A 2V85A 4X62E 3J81C 2EMKA 2WBTA 2J7JA 2DMIA 2ENHA 2A25A 2EM8A 3EQ1A 2JOXA 4DKKA 4LF5E 4DR4E 5IWAE 1KYQA 2EPMX 2LJUA 3J80C 4LF8E 1DI2A 2V8QB 1BBOA 1STUA 2H36X 1B69A 1BBGA 5KL4A 4JI4E 4R03A 2B7VA 1BB8A 3KWRA 1QNTA 4DUZE 2NA2A 2BBGA 5AC5A 5KL2A 2YZTA 2LV2A 2FV4B 2EN6A 1T4LB 5DNYA 3UK3C 1X3CA 4N4RB 3L00A 5IV8B 3HXLA
chains in the Genus database with same CATH topology
3BGHA 2I9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BGH A;  2I9I A; 
#chains in the Genus database with same CATH topology
 1N32 E;  2EMA A;  2LUQ A;  2M9A A;  4BC9 A;  5AC4 A;  4JYA E;  2EM7 A;  4JI8 E;  4R2D A;  4LF9 E;  2LRS A;  1YZ9 A;  4B3T E;  1XNQ E;  2KOU A;  5F3W A;  1EH7 A;  2EP3 A;  2HJJ A;  2ODR D;  2EOM A;  3IWC A;  2RTX A;  4DR1 E;  2VE7 C;  1HR0 E;  4DR3 E;  3BGH A;  3THO B;  4JI5 E;  2EL6 A;  1RQ0 A;  2JWO A;  2E1M A;  2FTX B;  3AUZ A;  4X65 E;  2LE2 A;  2LT7 A;  5T6J A;  2MDG A;  1AH5 A;  5ADZ A;  4B3R E;  4GKK E;  1PKP A;  4JI3 E;  4BHB A;  4HEI A;  1T4O A;  2ELY A;  4P7D A;  3KZY A;  2Q8U A;  3C4B A;  1A1H A;  4X8W A;  2N3G A;  4BBY A;  4R8O A;  2L2N A;  1ZU1 A;  4WFT A;  1ZBQ A;  3J7Y p;  5CFF E;  2EOH A;  1Z1B A;  4LFA E;  4JI7 E;  2EMF A;  1WRJ A;  1IBL E;  4JI6 E;  2RPC A;  4M9V C;  3BID A;  2JVA A;  3C6M A;  1ZBT A;  2EPL X;  1HNW E;  2YU8 A;  4JV5 E;  2EJ4 A;  2VF1 A;  2LO3 A;  1GZ6 A;  1DGC A;  2MDR A;  4R2C A;  4BS9 A;  4KZS A;  1HNX E;  2I13 A;  1N33 E;  4WPY A;  1A1G A;  1YSA C;  2EM0 A;  5AAS A;  1RMD A;  2YTP A;  4LF7 E;  1O0W A;  4TUG A;  1N3G A;  2JR1 A;  4BHC A;  2K4V A;  2D9H A;  4TUI A;  2EMH A;  4J8Z A;  2LTR A;  3THN A;  5AE3 A;  3IWD A;  3HPS A;  1TF3 A;  1X6E A;  2L2M A;  1YYK A;  5A6J A;  4HTG A;  2GPI A;  2EQ1 A;  2EMG A;  3T1H E;  4X64 E;  4DV2 E;  4LF4 E;  3QG5 C;  4R2A A;  1L4S A;  4F6N A;  1FJG E;  2EMX A;  4O43 A;  2NUE A;  2HC5 A;  2YSO A;  2YTQ A;  2ELZ A;  3K6Q A;  2EM6 A;  1A1K A;  2EN3 A;  2EOS A;  4DV1 E;  4L5N C;  2UUC E;  3DF6 A;  3HQ1 A;  2ZM6 E;  1IBK E;  3VYX A;  2EQ3 A;  2LTS A;  2JXP A;  2EE8 A;  4LTY A;  3MHH C;  1F2I G;  1YUI A;  2V83 A;  2CT1 A;  4M0V A;  2EOE A;  5BR8 E;  2R76 A;  1IBM E;  1LLM C;  2ODR C;  3LML A;  1IMU A;  1X6H A;  2EPK X;  5KL3 A;  4FK5 C;  4IJD A;  2EOZ A;  2EN2 A;  1UIL A;  2ADR A;  3P1X A;  2JOB A;  1YYW A;  5IXM B;  2DLK A;  2K7I A;  2L33 A;  2I9I A;  1T4N A;  2F8B A;  3J7A G;  4DR2 E;  3BF2 A;  1IQO A;  2EMY A;  5LMN E;  4DV7 E;  2N3H A;  5FLX C;  2NAB A;  2R1F A;  1EKZ A;  1WHN A;  2ENA A;  2DGC A;  3RMP A;  1P47 A;  4BMJ A;  2UXC E;  5KL7 A;  2GLI A;  4ZYE A;  2YTI A;  2L3C A;  4F54 A;  4DV4 E;  3ADJ A;  2B7T A;  2YRK A;  3LLH A;  2RS6 A;  2UUB E;  1J5E E;  1DQ3 A;  4Q35 B;  4OX9 E;  1PJS A;  2LBS B;  3MSW A;  3ADG A;  2YTF A;  4Q28 A;  2YU5 A;  2YWQ A;  4LFC E;  3JTZ A;  4DV5 E;  2YTO A;  2RSM A;  2DMY A;  2DLQ A;  2EM3 A;  2EMC A;  2ENC A;  2LMZ A;  3EPJ A;  5KL5 A;  2YT4 A;  5TSE A;  2KON A;  3JAM C;  2EMZ A;  4YY3 E;  4NXN E;  4M2Z A;  3T1Y E;  4DUY E;  4GKJ E;  2LUP B;  2EM5 A;  2UU9 E;  2EPC A;  2VRD A;  2EWL A;  4K0K E;  1HNZ E;  3HPZ A;  1SR9 A;  4DMI A;  2E72 A;  2EMW A;  1A1F A;  1PJQ A;  3OTO E;  2EOY A;  2EPO A;  2HGH A;  1T38 A;  2EMB A;  2EM4 A;  4M30 A;  4X66 E;  2GHF A;  1G2D C;  3KZZ A;  2E5L E;  2YTG A;  4F9B B;  4LF6 E;  2YRH A;  1TF6 A;  2N8X A;  5A2Q C;  2EPU A;  1AAY A;  1XMO E;  2EPN A;  2EN8 A;  4BC7 A;  2RQL A;  4O24 A;  1WXR A;  2DB2 A;  1UBD C;  2MC6 A;  2EL5 A;  1X48 A;  3IWB A;  5IT9 C;  1A1L A;  4MLV A;  2IHR 1;  2EOI A;  4JI1 E;  5LL6 R;  5A6A A;  1N36 E;  4P78 A;  2EM2 A;  2EM9 A;  3FIG A;  2DIX A;  3OML A;  1X5W A;  2EOJ A;  1NCS A;  4X9J A;  2MC5 A;  5LMU E;  2EN4 A;  4F9A B;  1YPN A;  2RS7 A;  3MHS C;  4OOG C;  4ZYH A;  1SFE A;  4O4K A;  4NXM E;  2WCC 3;  2M1S A;  4I8O A;  2JPA A;  4WSG A;  4NHR A;  4WXD A;  1A1I A;  1ZR9 A;  2WBU A;  4WSP A;  4GZN C;  5A6K A;  4WX9 A;  2BB8 A;  4GEQ B;  2HHH E;  3JU0 A;  4JI2 E;  2DSY A;  5A6B D;  2L3J A;  2V86 A;  2CTD A;  1XNR E;  1MGT A;  2V87 A;  1X6F A;  2EPA A;  2YTE A;  4RH8 A;  2LVH A;  1EH8 A;  2B9D A;  1WHQ A;  3M99 B;  2PRT A;  1NEI A;  2EZ6 A;  2YPN A;  2DRP A;  4B3S E;  4YHH E;  2EPP A;  2EOO A;  4KHP E;  3ECR A;  5A69 A;  1I94 E;  4LU9 A;  4R2P A;  1ZAA C;  2V88 A;  4ZYG A;  1GQE A;  4NZV A;  2L6M A;  2NUF A;  1JK2 A;  1X49 A;  1QU6 A;  1IQS A;  2EN7 A;  5AE2 A;  3ADL A;  4WXC A;  2YSP A;  1GTK A;  2LJH A;  2EPZ A;  4F9C B;  1A1J A;  1YFH A;  4IS1 C;  1J26 A;  2JP9 A;  1EH6 A;  3ZOQ B;  1UN6 B;  1KJK A;  1FKA E;  2JYA A;  2KHX A;  2FGG A;  4DR6 E;  5KL6 A;  1PJT A;  5A6B A;  2EPR A;  2B3T B;  4DV0 E;  2EOQ A;  3F6H A;  1N34 E;  3DJW A;  4B3M E;  1RC7 A;  4R2S A;  4R2R A;  2EN1 A;  2F4V E;  2YTJ A;  3C4T A;  4DR7 E;  4WYQ B;  2V89 A;  4AQY E;  2MKD A;  2YRM A;  5LLQ A;  3F6G A;  2VQE E;  2LCE A;  4DV6 E;  2EL4 A;  3BBG A;  4F2J C;  4DR5 E;  2L92 A;  2UXD E;  4DV3 E;  4MLQ A;  5AE1 A;  2L2K B;  2NUG A;  2EOF A;  2EOX A;  3VYY A;  2EPX A;  1T39 A;  2YTD A;  4JI0 E;  4O5G A;  2M4I A;  1WJP A;  1JK1 A;  3ADI A;  1X47 A;  3HTX A;  2EQ0 A;  3EPK A;  1YYO A;  1XMQ E;  2CSH A;  3EPL A;  4R2E A;  2CPN A;  4L8N A;  2MKN A;  4KWY A;  2YTN A;  2WZO A;  2VQF E;  1UHZ A;  2WBS A;  4RHB B;  1YUJ A;  1PDA A;  3EPH A;  4ZYD A;  4R2Q A;  1TN9 A;  2RSI A;  3TQM A;  2EML A;  2EOR A;  2UUA E;  2G7H A;  3C6K A;  3VHT B;  2JY9 A;  4LFB E;  2M7Q A;  2EMI A;  3H09 A;  2L8T A;  3VK6 A;  4F6M A;  1G2F C;  1MEY C;  2UXB E;  4BCA A;  3AV0 A;  2V85 A;  4X62 E;  3J81 C;  2EMK A;  2WBT A;  2J7J A;  2DMI A;  2ENH A;  2A25 A;  2EM8 A;  3EQ1 A;  2JOX A;  4DKK A;  4LF5 E;  4DR4 E;  5IWA E;  1KYQ A;  2EPM X;  2LJU A;  3J80 C;  4LF8 E;  1DI2 A;  2V8Q B;  1BBO A;  1STU A;  2H36 X;  1B69 A;  1BBG A;  5KL4 A;  4JI4 E;  4R03 A;  2B7V A;  1BB8 A;  3KWR A;  1QNT A;  4DUZ E;  2NA2 A;  2BBG A;  5AC5 A;  5KL2 A;  2YZT A;  2LV2 A;  2FV4 B;  2EN6 A;  1T4L B;  5DNY A;  3UK3 C;  1X3C A;  4N4R B;  3L00 A;  5IV8 B;  3HXL A; 
#chains in the Genus database with same CATH homology
 3BGH A;  2I9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...