3BGHA

Crystal structure of putative neuraminyllactose-binding hemagglutinin homolog from helicobacter pylori
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
187
Chain Sequence
VELHFHYPIKGKQEPKNSHLVVLIEPKIEINKVIPESYQKEFEKSLFLQLSSFLERKGYSVSQFKDASEIPQDIKEKALLVLRMDGNVAILEDIVEESDALSEEKVIDMSSGYLNLNFVEPKSEDIIHSFGIDVSKIKAVIERVKETDHDQAIRKIMNQAYHKVMVHITKELSKKHMEHYEKVSSEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative neuraminyllactose-binding hemagglutinin homolog from Helicobacter pylori.
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
molecule keywords Putative neuraminyllactose-binding hemagglutinin homolog
total genus 57
structure length 187
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.180 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Putative neuraminyllactose-binding hemagglutinin homolog like domain 3bghA01
2I9IA 3BGHA
chains in the Genus database with same CATH superfamily
3JAMC 2YTGA 4R2AA 3BF2A 4DV0E 1UHZA 4B3TE 2V86A 1ZU1A 4TUIA 4Q35B 4BHCA 2PRTA 2HHHE 2WBUA 1UILA 4WFTA 1RC7A 1G2DC 3ECRA 2B7TA 2KHXA 4MLVA 3HXLA 2MKDA 3J80C 5A6KA 4WYQB 2UXCE 1YUIA 2VRDA 1N32E 1FJGE 4X8WA 5LMNE 4B3RE 3BIDA 2EOFA 1PJQA 2F8BA 2LE2A 2EMWA 4YY3E 4O24A 1G2FC 2YZTA 5F3WA 1YYWA 2YT4A 1J5EE 2UUAE 5TSEA 2YTNA 2GLIA 1WJPA 4F54A 2DLKA 2JY9A 2V88A 5AC5A 3IWBA 1P47A 1Z1BA 1A1HA 2F4VE 1I94E 4JI7E 1UBDC 4HEIA 5AE2A 3VYYA 2ODRC 1XMOE 1HNWE 4JI0E 2EN4A 2LCEA 1N33E 4DV4E 3VK6A 2EOQA 1A1FA 2EMLA 3HTXA 4NHRA 2EPPA 3KZYA 2A25A 4BCAA 1KYQA 5A6AA 4KZSA 4WSGA 2YSPA 1ZBTA 2EOIA 2MDRA 5KL3A 2YTDA 1YYOA 4DV6E 1YSAC 2EOYA 3M99B 3MSWA 2YTQA 5AC4A 5CFFE 3JTZA 4BC7A 2LJUA 4DR4E 1PJSA 2V87A 4KHPE 2YPNA 2EM3A 2MDGA 4BC9A 1X48A 2EN6A 4ZYHA 3OMLA 4BMJA 2EM2A 2E5LE 1T4NA 3J81C 2EPAA 2EPZA 4DV7E 2UUBE 1ZBQA 1IQOA 1A1GA 2DMYA 2DIXA 4BS9A 4FK5C 2LMZA 2YSOA 1X6HA 4F2JC 2JXPA 4L5NC 2E1MA 2EQ1A 1ZAAC 5A6BD 3BBGA 4R2DA 2L3JA 2EOZA 4X66E 1A1KA 5T6JA 4LF7E 2V89A 1JK1A 3IWCA 2L6MA 4JV5E 2Q8UA 2M7QA 4DUYE 4DV3E 4M30A 4LFBE 4LTYA 2EM9A 1X49A 4R2RA 3J7Yp 2DGCA 3EQ1A 2EMBA 4LF8E 2LTSA 2ELYA 5IXMB 4F6MA 1DQ3A 1X6FA 3RMPA 4JI6E 2ZM6E 1RMDA 1NCSA 4BBYA 1N3GA 4R2CA 2E72A 2EP3A 5A6BA 3J7AG 2EMFA 4WPYA 1EH6A 2EOSA 2NABA 4M0VA 1STUA 2EM4A 2BB8A 1T4OA 3VHTB 3TQMA 1AAYA 4RHBB 4HTGA 2L33A 2YRKA 4GEQB 2ENAA 4BHBA 2EM8A 1QNTA 4IS1C 3AUZA 4F6NA 1YFHA 2EL6A 4X64E 4R2EA 1PKPA 2B7VA 4DR3E 3H09A 2RS7A 2EPMX 2EPOA 2LRSA 4DKKA 4MLQA 3ADLA 4X62E 2LV2A 1O0WA 3THNA 4DR5E 1WXRA 1T38A 2WZOA 1BBGA 1DGCA 3LMLA 5KL2A 2RSMA 2WCC3 2EMHA 1EKZA 3HQ1A 1PDAA 1A1LA 2KONA 2RQLA 3OTOE 5BR8E 2WBTA 2M9AA 2YTOA 2NUEA 2EMIA 5A2QC 2UXBE 4WXCA 2EN8A 4JI1E 4R03A 1IBLE 1X3CA 4R8OA 4WX9A 4LF4E 2NUGA 4DUZE 4J8ZA 2EPNA 2EJ4A 5IWAE 4LFAE 2FGGA 1EH7A 1TF3A 4LFCE 2N3HA 2MKNA 2LTRA 4X9JA 1PJTA 2DLQA 2G7HA 2YRHA 2UUCE 4NZVA 3HPZA 2EN3A 2EM7A 2EMAA 1YUJA 1EH8A 2CPNA 4DR6E 3DF6A 2DRPA 3MHHC 2H36X 1TN9A 2EPKX 2YTEA 2EM0A 2YWQA 5IV8B 4DR2E 2DSYA 4ZYDA 2EOJA 2EOOA 2EPCA 2DMIA 1GZ6A 1BBOA 1B69A 2YTIA 2EL5A 3EPLA 4L8NA 4JI2E 2I9IA 4B3ME 5FLXC 4JYAE 5KL5A 2VE7C 1XNQE 2JP9A 1IBME 2L8TA 1WRJA 4K0KE 1BB8A 4TUGA 1WHQA 2LT7A 3F6GA 2HJJA 2EN7A 4ZYEA 2L92A 3KWRA 2LJHA 1SR9A 1IBKE 2M1SA 4DR7E 3ADGA 3K6QA 2J7JA 4GKKE 4WXDA 4M2ZA 3F6HA 2B9DA 1FKAE 2EMXA 3P1XA 3T1HE 1A1JA 2JYAA 3C6KA 3MHSC 5KL7A 2IHR1 3C4BA 2MC6A 4LF9E 4DV5E 2GPIA 2LUQA 3IWDA 4R2SA 4F9AB 1GTKA 3UK3C 4GKJE 1RQ0A 3LLHA 4DV1E 1AH5A 4GZNC 2EPRA 1TF6A 2KOUA 5KL4A 3EPKA 2JVAA 2EPUA 2UU9E 4NXNE 4I8OA 4JI8E 4R2QA 1YYKA 4LU9A 4AQYE 2EN1A 1F2IG 1J26A 2CT1A 2N8XA 2B3TB 4RH8A 1LLMC 4Q28A 2UXDE 1KJKA 2L3CA 2JOXA 5LLQA 1A1IA 1XMQE 2LUPB 2VF1A 1UN6B 1DI2A 2I13A 5A69A 2LBSB 5AASA 2EM6A 1T39A 2FTXB 2EZ6A 3C4TA 5AE1A 2EPXA 2RSIA 2CTDA 4N4RB 2YTPA 4YHHE 3THOB 2RS6A 2D9HA 3HPSA 2L2MA 4R2PA 3ZOQB 3EPHA 2EQ0A 2ENHA 2R76A 2LVHA 1QU6A 1ZR9A 2EMYA 1HR0E 4IJDA 2RPCA 2NA2A 3DJWA 4JI4E 2RTXA 2BBGA 4WSPA 5LL6R 1MGTA 3KZZA 2K7IA 3FIGA 4X65E 4LF6E 2GHFA 2LO3A 4O43A 2VQFE 1YPNA 3ADJA 2YU5A 2EPLX 1MEYC 2JWOA 2JPAA 1NEIA 2L2NA 4JI5E 2EORA 2N3GA 5ADZA 3JU0A 5KL6A 1L4SA 1GQEA 1XNRE 2JOBA 3QG5C 2YTFA 4O5GA 3BGHA 2ODRD 2ENCA 5DNYA 1IMUA 4JI3E 2EMZA 2EMCA 4P7DA 2L2KB 4DR1E 2VQEE 1SFEA 2HC5A 5AE3A 2EMKA 5IT9C 2ELZA 4ZYGA 4DV2E 4B3SE 2R1FA 1WHNA 1JK2A 3L00A 5LMUE 1HNXE 2EQ3A 2V85A 3C6MA 4NXME 2K4VA 2NUFA 4DMIA 4LF5E 2YTJA 4F9BB 2YU8A 4F9CB 2ADRA 4KWYA 2EMGA 4P78A 1N36E 1IQSA 3T1YE 1HNZE 1X6EA 4O4KA 2EWLA 1YZ9A 2V83A 2M4IA 3AV0A 2HGHA 4OX9E 2EM5A 2FV4B 2EOMA 2V8QB 2EOEA 2WBSA 1T4LB 2JR1A 3EPJA 2EOXA 3ADIA 2YRMA 2EE8A 3VYXA 2EOHA 2CSHA 5A6JA 1X47A 4M9VC 2DB2A 4OOGC 2MC5A 2EL4A 1N34E 2EN2A 1X5WA
chains in the Genus database with same CATH topology
2I9IA 3BGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9I A;  3BGH A; 
#chains in the Genus database with same CATH topology
 3JAM C;  2YTG A;  4R2A A;  3BF2 A;  4DV0 E;  1UHZ A;  4B3T E;  2V86 A;  1ZU1 A;  4TUI A;  4Q35 B;  4BHC A;  2PRT A;  2HHH E;  2WBU A;  1UIL A;  4WFT A;  1RC7 A;  1G2D C;  3ECR A;  2B7T A;  2KHX A;  4MLV A;  3HXL A;  2MKD A;  3J80 C;  5A6K A;  4WYQ B;  2UXC E;  1YUI A;  2VRD A;  1N32 E;  1FJG E;  4X8W A;  5LMN E;  4B3R E;  3BID A;  2EOF A;  1PJQ A;  2F8B A;  2LE2 A;  2EMW A;  4YY3 E;  4O24 A;  1G2F C;  2YZT A;  5F3W A;  1YYW A;  2YT4 A;  1J5E E;  2UUA E;  5TSE A;  2YTN A;  2GLI A;  1WJP A;  4F54 A;  2DLK A;  2JY9 A;  2V88 A;  5AC5 A;  3IWB A;  1P47 A;  1Z1B A;  1A1H A;  2F4V E;  1I94 E;  4JI7 E;  1UBD C;  4HEI A;  5AE2 A;  3VYY A;  2ODR C;  1XMO E;  1HNW E;  4JI0 E;  2EN4 A;  2LCE A;  1N33 E;  4DV4 E;  3VK6 A;  2EOQ A;  1A1F A;  2EML A;  3HTX A;  4NHR A;  2EPP A;  3KZY A;  2A25 A;  4BCA A;  1KYQ A;  5A6A A;  4KZS A;  4WSG A;  2YSP A;  1ZBT A;  2EOI A;  2MDR A;  5KL3 A;  2YTD A;  1YYO A;  4DV6 E;  1YSA C;  2EOY A;  3M99 B;  3MSW A;  2YTQ A;  5AC4 A;  5CFF E;  3JTZ A;  4BC7 A;  2LJU A;  4DR4 E;  1PJS A;  2V87 A;  4KHP E;  2YPN A;  2EM3 A;  2MDG A;  4BC9 A;  1X48 A;  2EN6 A;  4ZYH A;  3OML A;  4BMJ A;  2EM2 A;  2E5L E;  1T4N A;  3J81 C;  2EPA A;  2EPZ A;  4DV7 E;  2UUB E;  1ZBQ A;  1IQO A;  1A1G A;  2DMY A;  2DIX A;  4BS9 A;  4FK5 C;  2LMZ A;  2YSO A;  1X6H A;  4F2J C;  2JXP A;  4L5N C;  2E1M A;  2EQ1 A;  1ZAA C;  5A6B D;  3BBG A;  4R2D A;  2L3J A;  2EOZ A;  4X66 E;  1A1K A;  5T6J A;  4LF7 E;  2V89 A;  1JK1 A;  3IWC A;  2L6M A;  4JV5 E;  2Q8U A;  2M7Q A;  4DUY E;  4DV3 E;  4M30 A;  4LFB E;  4LTY A;  2EM9 A;  1X49 A;  4R2R A;  3J7Y p;  2DGC A;  3EQ1 A;  2EMB A;  4LF8 E;  2LTS A;  2ELY A;  5IXM B;  4F6M A;  1DQ3 A;  1X6F A;  3RMP A;  4JI6 E;  2ZM6 E;  1RMD A;  1NCS A;  4BBY A;  1N3G A;  4R2C A;  2E72 A;  2EP3 A;  5A6B A;  3J7A G;  2EMF A;  4WPY A;  1EH6 A;  2EOS A;  2NAB A;  4M0V A;  1STU A;  2EM4 A;  2BB8 A;  1T4O A;  3VHT B;  3TQM A;  1AAY A;  4RHB B;  4HTG A;  2L33 A;  2YRK A;  4GEQ B;  2ENA A;  4BHB A;  2EM8 A;  1QNT A;  4IS1 C;  3AUZ A;  4F6N A;  1YFH A;  2EL6 A;  4X64 E;  4R2E A;  1PKP A;  2B7V A;  4DR3 E;  3H09 A;  2RS7 A;  2EPM X;  2EPO A;  2LRS A;  4DKK A;  4MLQ A;  3ADL A;  4X62 E;  2LV2 A;  1O0W A;  3THN A;  4DR5 E;  1WXR A;  1T38 A;  2WZO A;  1BBG A;  1DGC A;  3LML A;  5KL2 A;  2RSM A;  2WCC 3;  2EMH A;  1EKZ A;  3HQ1 A;  1PDA A;  1A1L A;  2KON A;  2RQL A;  3OTO E;  5BR8 E;  2WBT A;  2M9A A;  2YTO A;  2NUE A;  2EMI A;  5A2Q C;  2UXB E;  4WXC A;  2EN8 A;  4JI1 E;  4R03 A;  1IBL E;  1X3C A;  4R8O A;  4WX9 A;  4LF4 E;  2NUG A;  4DUZ E;  4J8Z A;  2EPN A;  2EJ4 A;  5IWA E;  4LFA E;  2FGG A;  1EH7 A;  1TF3 A;  4LFC E;  2N3H A;  2MKN A;  2LTR A;  4X9J A;  1PJT A;  2DLQ A;  2G7H A;  2YRH A;  2UUC E;  4NZV A;  3HPZ A;  2EN3 A;  2EM7 A;  2EMA A;  1YUJ A;  1EH8 A;  2CPN A;  4DR6 E;  3DF6 A;  2DRP A;  3MHH C;  2H36 X;  1TN9 A;  2EPK X;  2YTE A;  2EM0 A;  2YWQ A;  5IV8 B;  4DR2 E;  2DSY A;  4ZYD A;  2EOJ A;  2EOO A;  2EPC A;  2DMI A;  1GZ6 A;  1BBO A;  1B69 A;  2YTI A;  2EL5 A;  3EPL A;  4L8N A;  4JI2 E;  2I9I A;  4B3M E;  5FLX C;  4JYA E;  5KL5 A;  2VE7 C;  1XNQ E;  2JP9 A;  1IBM E;  2L8T A;  1WRJ A;  4K0K E;  1BB8 A;  4TUG A;  1WHQ A;  2LT7 A;  3F6G A;  2HJJ A;  2EN7 A;  4ZYE A;  2L92 A;  3KWR A;  2LJH A;  1SR9 A;  1IBK E;  2M1S A;  4DR7 E;  3ADG A;  3K6Q A;  2J7J A;  4GKK E;  4WXD A;  4M2Z A;  3F6H A;  2B9D A;  1FKA E;  2EMX A;  3P1X A;  3T1H E;  1A1J A;  2JYA A;  3C6K A;  3MHS C;  5KL7 A;  2IHR 1;  3C4B A;  2MC6 A;  4LF9 E;  4DV5 E;  2GPI A;  2LUQ A;  3IWD A;  4R2S A;  4F9A B;  1GTK A;  3UK3 C;  4GKJ E;  1RQ0 A;  3LLH A;  4DV1 E;  1AH5 A;  4GZN C;  2EPR A;  1TF6 A;  2KOU A;  5KL4 A;  3EPK A;  2JVA A;  2EPU A;  2UU9 E;  4NXN E;  4I8O A;  4JI8 E;  4R2Q A;  1YYK A;  4LU9 A;  4AQY E;  2EN1 A;  1F2I G;  1J26 A;  2CT1 A;  2N8X A;  2B3T B;  4RH8 A;  1LLM C;  4Q28 A;  2UXD E;  1KJK A;  2L3C A;  2JOX A;  5LLQ A;  1A1I A;  1XMQ E;  2LUP B;  2VF1 A;  1UN6 B;  1DI2 A;  2I13 A;  5A69 A;  2LBS B;  5AAS A;  2EM6 A;  1T39 A;  2FTX B;  2EZ6 A;  3C4T A;  5AE1 A;  2EPX A;  2RSI A;  2CTD A;  4N4R B;  2YTP A;  4YHH E;  3THO B;  2RS6 A;  2D9H A;  3HPS A;  2L2M A;  4R2P A;  3ZOQ B;  3EPH A;  2EQ0 A;  2ENH A;  2R76 A;  2LVH A;  1QU6 A;  1ZR9 A;  2EMY A;  1HR0 E;  4IJD A;  2RPC A;  2NA2 A;  3DJW A;  4JI4 E;  2RTX A;  2BBG A;  4WSP A;  5LL6 R;  1MGT A;  3KZZ A;  2K7I A;  3FIG A;  4X65 E;  4LF6 E;  2GHF A;  2LO3 A;  4O43 A;  2VQF E;  1YPN A;  3ADJ A;  2YU5 A;  2EPL X;  1MEY C;  2JWO A;  2JPA A;  1NEI A;  2L2N A;  4JI5 E;  2EOR A;  2N3G A;  5ADZ A;  3JU0 A;  5KL6 A;  1L4S A;  1GQE A;  1XNR E;  2JOB A;  3QG5 C;  2YTF A;  4O5G A;  3BGH A;  2ODR D;  2ENC A;  5DNY A;  1IMU A;  4JI3 E;  2EMZ A;  2EMC A;  4P7D A;  2L2K B;  4DR1 E;  2VQE E;  1SFE A;  2HC5 A;  5AE3 A;  2EMK A;  5IT9 C;  2ELZ A;  4ZYG A;  4DV2 E;  4B3S E;  2R1F A;  1WHN A;  1JK2 A;  3L00 A;  5LMU E;  1HNX E;  2EQ3 A;  2V85 A;  3C6M A;  4NXM E;  2K4V A;  2NUF A;  4DMI A;  4LF5 E;  2YTJ A;  4F9B B;  2YU8 A;  4F9C B;  2ADR A;  4KWY A;  2EMG A;  4P78 A;  1N36 E;  1IQS A;  3T1Y E;  1HNZ E;  1X6E A;  4O4K A;  2EWL A;  1YZ9 A;  2V83 A;  2M4I A;  3AV0 A;  2HGH A;  4OX9 E;  2EM5 A;  2FV4 B;  2EOM A;  2V8Q B;  2EOE A;  2WBS A;  1T4L B;  2JR1 A;  3EPJ A;  2EOX A;  3ADI A;  2YRM A;  2EE8 A;  3VYX A;  2EOH A;  2CSH A;  5A6J A;  1X47 A;  4M9V C;  2DB2 A;  4OOG C;  2MC5 A;  2EL4 A;  1N34 E;  2EN2 A;  1X5W A; 
#chains in the Genus database with same CATH homology
 2I9I A;  3BGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...