3ADGA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
SHVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F21M12.9 protein
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 20
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adgA00
1N36E 1RQ0A 4LF7E 1WHQA 4DV1E 2LUPB 2DB2A 4DV4E 3P1XA 4GKJE 4JI8E 4DUYE 4NXNE 2B7VA 4X8WA 3ADGA 2LBSB 5CFFE 1X49A 4OOGC 2L3CA 3LLHA 4LFCE 4JI4E 1T4LB 2L33A 2RS6A 2VQEE 1X47A 5LMUE 2UXDE 4DV7E 4X62E 1YYWA 4DV0E 3T1YE 4DV5E 2B3TB 1J26A 4JI3E 2MDRA 1IBLE 4B3SE 2DMYA 4YY3E 1XMQE 2VQFE 1EKZA 3C4TA 1FKAE 2JY9A 4JI2E 2LTSA 5LMNE 2DIXA 4LF9E 2ZM6E 4JI5E 3T1HE 4WFTA 4DR7E 2LJHA 3ADIA 1T4NA 1YZ9A 2UXBE 4DR1E 2LRSA 2N3GA 4DKKA 1HNXE 2N3HA 2L2NA 1I94E 2UXCE 3C4BA 3ADJA 4WYQB 3OTOE 1RC7A 4LFBE 4DR4E 4DV2E 1YYOA 1HNZE 2NUFA 1UILA 2NA2A 4X65E 2RS7A 4B3TE 2LUQA 4JI0E 1XNQE 2EZ6A 2NUEA 1XNRE 4DR6E 4JV5E 4K0KE 1N34E 4LFAE 2B7TA 2CPNA 2RTXA 1UHZA 4X64E 2IHR1 2HHHE 3J7Yp 4M30A 1GQEA 5BR8E 1HR0E 4DR3E 2UUAE 4LF4E 1ZBTA 4X66E 2UU9E 2UUCE 1O0WA 1FJGE 1YYKA 4GKKE 2UUBE 1WHNA 2L2MA 1XMOE 4M2ZA 1IBME 4LF8E 1QU6A 2NUGA 2F4VE 4B3RE 4JI6E 4YHHE 1T4OA 4JI1E 3HTXA 1DI2A 4KHPE 4DV6E 2KHXA 2L2KB 4DR5E 4B3ME 4DV3E 5IWAE 4DUZE 3ADLA 1PKPA 4LF6E 3VYXA 2RSMA 4JYAE 3VYYA 4DR2E 4NXME 1X48A 1STUA 2JVAA 4JI7E 4OX9E 1HNWE 2LTRA 2L3JA 1N32E 4LF5E 1J5EE 4AQYE 2YT4A 2E5LE 1N33E 1IBKE
chains in the Genus database with same CATH superfamily
4KWYA 2H36X 1NEIA 2L6MA 3J81C 1KYQA 5A6BA 4LF7E 1X3CA 1ZAAC 4GKJE 4FK5C 1TF6A 2YU8A 4HEIA 2B7VA 2ODRC 5CFFE 4O5GA 1TF3A 4LFCE 4JI4E 2ODRD 2RS6A 2EJ4A 2EMWA 3UK3C 5A6KA 4X62E 2ELYA 2EMGA 3IWCA 5KL4A 3T1YE 2EM9A 4DV5E 2I9IA 3BGHA 2EPKX 3M99B 1FKAE 5IXMB 2ENAA 3L00A 3DJWA 3F6HA 5A69A 2EPNA 1T4NA 1YZ9A 1P47A 3MHSC 2UXBE 3HPSA 2GLIA 2HC5A 1T38A 4P78A 2M4IA 2EM4A 2V86A 4R8OA 1HNXE 3K6QA 2L2NA 1I94E 1PDAA 2EPCA 4MLQA 3RMPA 4F9BB 2KOUA 1YYOA 1G2FC 1NCSA 2ELZA 4IJDA 5AE2A 4TUIA 2RS7A 2LUQA 2G7HA 1XNQE 2EMAA 2EZ6A 2PRTA 3VHTB 4JV5E 2J7JA 2V8QB 2IHR1 4F54A 2EOIA 1A1KA 2HHHE 4M30A 2YRHA 1HR0E 2EN6A 1PJTA 1WRJA 1EH8A 4O43A 1O0WA 4BHCA 4DMIA 2ENHA 4J8ZA 4ZYHA 2L2MA 1ZBQA 2NUGA 1IMUA 1T4OA 1DI2A 4WX9A 4DV6E 2KHXA 2BBGA 2YTNA 4DR5E 2EMFA 1YFHA 2M1SA 2LV2A 3OMLA 1T39A 4R2RA 5AC4A 4WXDA 2JVAA 1HNWE 2EOFA 3F6GA 1J5EE 2DGCA 4L5NC 1IBKE 2GHFA 2CTDA 1N36E 4P7DA 4WSGA 2YPNA 4R2QA 4KZSA 1WHQA 2LUPB 2DB2A 2EL4A 1QNTA 4X8WA 2LBSB 4L8NA 4NHRA 1X49A 4OOGC 4ZYEA 2KONA 4RH8A 1X47A 5LMUE 4BBYA 2UXDE 2EPXA 3QG5C 4DV7E 2DMIA 5DNYA 1X6EA 2B3TB 4ZYDA 3EPLA 4X9JA 4MLVA 1IBLE 4R2AA 4R2EA 5T6JA 2DMYA 1JK1A 2V85A 3THOB 2VQFE 4WPYA 4JI2E 4F9AB 1GZ6A 1X6FA 2EPOA 4JI5E 1ZR9A 3EQ1A 3IWBA 4DR7E 1PJSA 2VE7C 3TQMA 4Q28A 1SFEA 2LT7A 1RMDA 2VRDA 1PJQA 5AE1A 3FIGA 2HJJA 4M9VC 4BHBA 2EN2A 3OTOE 1RC7A 2YU5A 2EMXA 3EPKA 2JYAA 2R1FA 1MGTA 2GPIA 2RQLA 1A1IA 2EPAA 5KL7A 3AV0A 2LVHA 2B9DA 2EN3A 2LO3A 2CSHA 2Q8UA 1N34E 2EMHA 2B7TA 2LE2A 5FLXC 3J7AG 3BF2A 4X64E 2V88A 2EOOA 2EM0A 2EP3A 3JU0A 2EOHA 2E72A 2EOQA 2F8BA 5BR8E 2EM7A 2YSPA 3J80C 2EOJA 1ZBTA 1BBGA 2EPRA 4NZVA 1X5WA 4BCAA 3JAMC 1WHNA 1XMOE 2EL6A 3BBGA 2EL5A 3C6KA 3H09A 4YHHE 3HTXA 2EQ3A 2FTXB 2JR1A 2L2KB 1X6HA 5IWAE 4DUZE 2EOXA 4LF6E 2RSIA 4JYAE 4BC7A 5IV8B 5A2QC 2I13A 4NXME 4OX9E 4JI7E 3KWRA 2LTRA 2L3JA 2EM6A 2YT4A 2EMZA 2V89A 2V87A 2YTPA 1N33E 2EOEA 3VYXA 4BS9A 2EQ1A 2LCEA 2EMBA 3HXLA 1JK2A 4F9CB 1BBOA 2EMCA 2VF1A 2EPZA 3P1XA 4JI8E 3ADGA 2LMZA 2L3CA 3EPHA 1T4LB 2JOXA 3MHHC 2EPLX 2EMKA 2DRPA 4LTYA 2YRMA 1YUIA 2EM8A 3JTZA 2EM5A 1J26A 2BB8A 4JI3E 2EMYA 2JPAA 2FGGA 1Z1BA 4B3SE 2JWOA 2EPMX 2EOZA 4YY3E 1EKZA 2ENCA 2ZM6E 5KL5A 4WFTA 5A6AA 1AH5A 1GTKA 2YTFA 3ADIA 4N4RB 1DGCA 1EH7A 4DKKA 5KL3A 1YUJA 1A1FA 3ADJA 4WYQB 5A6JA 4LFBE 5TSEA 2JOBA 1HNZE 1UILA 2NA2A 5LLQA 2DLKA 1ZU1A 2D9HA 5AC5A 2JXPA 4R2SA 1XNRE 4DR6E 2FV4B 3IWDA 5IT9C 2YTJA 4K0KE 4TUGA 4LFAE 5AE3A 4R2DA 4RHBB 2WBSA 3C6MA 1YSAC 1IQOA 1GQEA 1B69A 2UUAE 2RPCA 2E1MA 4X66E 2UU9E 1FJGE 4GKKE 4M2ZA 1IBME 4Q35B 4B3RE 2M9AA 4O24A 4KHPE 1IQSA 3EPJA 4DV3E 4I8OA 2EPPA 4LU9A 2YTEA 3VYYA 4DR2E 2EE8A 3ZOQB 3HPZA 1A1GA 2EN7A 1N32E 5F3WA 4LF5E 3ECRA 1UBDC 5KL2A 1G2DC 2K4VA 1RQ0A 2L8TA 4M0VA 4R2PA 4DV1E 3BIDA 2EN1A 2DLQA 2LJUA 4DV4E 2N8XA 2EOYA 4DUYE 4NXNE 1KJKA 4O4KA 2K7IA 3LLHA 2EOMA 2L33A 2VQEE 2EM2A 3HQ1A 4HTGA 2EWLA 2NABA 2WZOA 1LLMC 1F2IG 4DV0E 1A1HA 1YYWA 2YTDA 3KZYA 3AUZA 2CT1A 3MSWA 5A6BD 3DF6A 2MDRA 4BC9A 1WXRA 1XMQE 3C4TA 2JY9A 2LTSA 5KL6A 5LMNE 2DIXA 4LF9E 1A1JA 3T1HE 2YTOA 1WJPA 2R76A 2EOSA 2YTQA 2LJHA 4ZYGA 2EMLA 2YTGA 2WBUA 2MC5A 2YTIA 4DR1E 2LRSA 2MDGA 2N3GA 1MEYC 2EM3A 2N3HA 2WBTA 2YWQA 3KZZA 2YZTA 2JP9A 2UXCE 3C4BA 5ADZA 4IS1C 1SR9A 4DR4E 1A1LA 2MKNA 4DV2E 2M7QA 2NUFA 1L4SA 4X65E 4B3TE 4JI0E 2NUEA 1N3GA 2EMIA 2A25A 1BB8A 3LMLA 2CPNA 2RTXA 1UHZA 2HGHA 2ADRA 4BMJA 3J7Yp 2MKDA 2YSOA 4R2CA 4DR3E 4GZNC 4LF4E 2EPUA 2V83A 2UUCE 1YYKA 2UUBE 4LF8E 1QU6A 2F4VE 1EH6A 5LL6R 2EN4A 4F6NA 4JI6E 4JI1E 2L92A 1TN9A 4B3ME 4R03A 4F2JC 3ADLA 1PKPA 2RSMA 4WSPA 1UN6B 1X48A 1STUA 2WCC3 2EORA 2MC6A 4GEQB 1YPNA 4WXCA 1AAYA 5AASA 4F6MA 4AQYE 2EQ0A 2E5LE 1DQ3A 2EN8A 3THNA 3VK6A 2DSYA 2YRKA
chains in the Genus database with same CATH topology
2H36X 4BS9A 3J81C 2L6MA 1N36E 4P7DA 1RQ0A 3HXLA 2L8TA 4KZSA 4M0VA 4F9CB 4LF7E 1WHQA 4DV1E 2LUPB 2DB2A 2VF1A 3P1XA 4DV4E 4GKJE 4JI8E 4DUYE 4NXNE 2B7VA 2ODRC 3ADGA 4X8WA 4L8NA 5CFFE 2LBSB 4OX9E 2LMZA 1IBKE 1X49A 4OOGC 2L3CA 2KONA 3LLHA 4LFCE 4JI4E 1T4LB 2L33A 2ODRD 2RS6A 2VQEE 1X47A 2JOXA 5LMUE 3HQ1A 4BBYA 2UXDE 2EWLA 2WZOA 4LTYA 4X62E 4DV7E 4DV0E 1YYWA 5DNYA 3IWCA 3T1YE 3JTZA 4DV5E 2B3TB 1J26A 3AUZA 4JI3E 3MSWA 2FGGA 3DF6A 2MDRA 4BC9A 1IBLE 2JWOA 5T6JA 2DMYA 4B3SE 2V85A 4YY3E 1WXRA 2VQFE 4WPYA 3C4TA 1XMQE 1EKZA 2JY9A 1FKAE 2LTSA 4JI2E 5LMNE 4F9AB 1GZ6A 2DIXA 4LF9E 2ZM6E 4JI5E 3T1HE 3DJWA 3F6HA 3IWBA 4WFTA 4DR7E 2VE7C 2LJHA 4Q28A 3ADIA 1T4NA 1YZ9A 2UXBE 3HPSA 2MC5A 4DR1E 2LRSA 2N3GA 4P78A 2M4IA 4DKKA 2V86A 4R8OA 5AE1A 1HNXE 2N3HA 3FIGA 3K6QA 2YZTA 2L2NA 1I94E 2UXCE 3ADJA 3C4BA 4WYQB 5ADZA 3OTOE 3RMPA 1SR9A 1RC7A 4F9BB 4DR4E 4LFBE 2KOUA 2JOBA 4DV2E 1YYOA 2M7QA 1HNZE 2NUFA 1UILA 2NA2A 3AV0A 5AE2A 4TUIA 4X65E 2RS7A 4B3TE 2LUQA 2G7HA 4JI0E 1XNQE 2EZ6A 2NUEA 2B9DA 1XNRE 2FV4B 4DR6E 3IWDA 5IT9C 4JV5E 4K0KE 4TUGA 3LMLA 1N34E 4LFAE 2B7TA 5AE3A 2CPNA 2LE2A 2RTXA 2V8QB 5FLXC 3J7AG 1UHZA 4X64E 2IHR1 2V88A 4F54A 2HHHE 3J7Yp 4M30A 1GQEA 2F8BA 3JU0A 5BR8E 4BMJA 1HR0E 4DR3E 3J80C 2UUAE 4LF4E 1ZBTA 2E1MA 4X66E 2V83A 2UU9E 2UUCE 1O0WA 1FJGE 4BCAA 4DMIA 4J8ZA 1YYKA 4GKKE 3JAMC 1WHNA 2L2MA 1XMOE 2UUBE 1IBME 4M2ZA 1ZBQA 4LF8E 1QU6A 2NUGA 2F4VE 5LL6R 4B3RE 4JI6E 3H09A 4YHHE 1T4OA 4JI1E 3HTXA 1DI2A 2FTXB 2JR1A 4DV6E 4KHPE 2KHXA 2L2KB 2L92A 4DR5E 4B3ME 4R03A 4I8OA 5IWAE 4DV3E 4DUZE 3ADLA 1PKPA 4LF6E 2M1SA 3VYXA 2RSMA 4LU9A 4JYAE 3OMLA 4BC7A 3VYYA 4DR2E 4WSPA 5A2QC 4NXME 1X48A 1STUA 2JVAA 4JI7E 3HPZA 3KWRA 2LTRA 3ZOQB 2MC6A 4GEQB 2L3JA 5F3WA 4LF5E 1N32E 3F6GA 5AASA 4AQYE 1J5EE 2YT4A 2E5LE 1DQ3A 4L5NC 2V89A 2V87A 2K4VA 3VK6A 1HNWE 1N33E 2DSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 E;  1RQ0 A;  4LF7 E;  1WHQ A;  4DV1 E;  2LUP B;  2DB2 A;  4DV4 E;  3P1X A;  4GKJ E;  4JI8 E;  4DUY E;  4NXN E;  2B7V A;  4X8W A;  3ADG A;  2LBS B;  5CFF E;  1X49 A;  4OOG C;  2L3C A;  3LLH A;  4LFC E;  4JI4 E;  1T4L B;  2L33 A;  2RS6 A;  2VQE E;  1X47 A;  5LMU E;  2UXD E;  4DV7 E;  4X62 E;  1YYW A;  4DV0 E;  3T1Y E;  4DV5 E;  2B3T B;  1J26 A;  4JI3 E;  2MDR A;  1IBL E;  4B3S E;  2DMY A;  4YY3 E;  1XMQ E;  2VQF E;  1EKZ A;  3C4T A;  1FKA E;  2JY9 A;  4JI2 E;  2LTS A;  5LMN E;  2DIX A;  4LF9 E;  2ZM6 E;  4JI5 E;  3T1H E;  4WFT A;  4DR7 E;  2LJH A;  3ADI A;  1T4N A;  1YZ9 A;  2UXB E;  4DR1 E;  2LRS A;  2N3G A;  4DKK A;  1HNX E;  2N3H A;  2L2N A;  1I94 E;  2UXC E;  3C4B A;  3ADJ A;  4WYQ B;  3OTO E;  1RC7 A;  4LFB E;  4DR4 E;  4DV2 E;  1YYO A;  1HNZ E;  2NUF A;  1UIL A;  2NA2 A;  4X65 E;  2RS7 A;  4B3T E;  2LUQ A;  4JI0 E;  1XNQ E;  2EZ6 A;  2NUE A;  1XNR E;  4DR6 E;  4JV5 E;  4K0K E;  1N34 E;  4LFA E;  2B7T A;  2CPN A;  2RTX A;  1UHZ A;  4X64 E;  2IHR 1;  2HHH E;  3J7Y p;  4M30 A;  1GQE A;  5BR8 E;  1HR0 E;  4DR3 E;  2UUA E;  4LF4 E;  1ZBT A;  4X66 E;  2UU9 E;  2UUC E;  1O0W A;  1FJG E;  1YYK A;  4GKK E;  2UUB E;  1WHN A;  2L2M A;  1XMO E;  4M2Z A;  1IBM E;  4LF8 E;  1QU6 A;  2NUG A;  2F4V E;  4B3R E;  4JI6 E;  4YHH E;  1T4O A;  4JI1 E;  3HTX A;  1DI2 A;  4KHP E;  4DV6 E;  2KHX A;  2L2K B;  4DR5 E;  4B3M E;  4DV3 E;  5IWA E;  4DUZ E;  3ADL A;  1PKP A;  4LF6 E;  3VYX A;  2RSM A;  4JYA E;  3VYY A;  4DR2 E;  4NXM E;  1X48 A;  1STU A;  2JVA A;  4JI7 E;  4OX9 E;  1HNW E;  2LTR A;  2L3J A;  1N32 E;  4LF5 E;  1J5E E;  4AQY E;  2YT4 A;  2E5L E;  1N33 E;  1IBK E; 
#chains in the Genus database with same CATH topology
 4KWY A;  2H36 X;  1NEI A;  2L6M A;  3J81 C;  1KYQ A;  5A6B A;  4LF7 E;  1X3C A;  1ZAA C;  4GKJ E;  4FK5 C;  1TF6 A;  2YU8 A;  4HEI A;  2B7V A;  2ODR C;  5CFF E;  4O5G A;  1TF3 A;  4LFC E;  4JI4 E;  2ODR D;  2RS6 A;  2EJ4 A;  2EMW A;  3UK3 C;  5A6K A;  4X62 E;  2ELY A;  2EMG A;  3IWC A;  5KL4 A;  3T1Y E;  2EM9 A;  4DV5 E;  2I9I A;  3BGH A;  2EPK X;  3M99 B;  1FKA E;  5IXM B;  2ENA A;  3L00 A;  3DJW A;  3F6H A;  5A69 A;  2EPN A;  1T4N A;  1YZ9 A;  1P47 A;  3MHS C;  2UXB E;  3HPS A;  2GLI A;  2HC5 A;  1T38 A;  4P78 A;  2M4I A;  2EM4 A;  2V86 A;  4R8O A;  1HNX E;  3K6Q A;  2L2N A;  1I94 E;  1PDA A;  2EPC A;  4MLQ A;  3RMP A;  4F9B B;  2KOU A;  1YYO A;  1G2F C;  1NCS A;  2ELZ A;  4IJD A;  5AE2 A;  4TUI A;  2RS7 A;  2LUQ A;  2G7H A;  1XNQ E;  2EMA A;  2EZ6 A;  2PRT A;  3VHT B;  4JV5 E;  2J7J A;  2V8Q B;  2IHR 1;  4F54 A;  2EOI A;  1A1K A;  2HHH E;  4M30 A;  2YRH A;  1HR0 E;  2EN6 A;  1PJT A;  1WRJ A;  1EH8 A;  4O43 A;  1O0W A;  4BHC A;  4DMI A;  2ENH A;  4J8Z A;  4ZYH A;  2L2M A;  1ZBQ A;  2NUG A;  1IMU A;  1T4O A;  1DI2 A;  4WX9 A;  4DV6 E;  2KHX A;  2BBG A;  2YTN A;  4DR5 E;  2EMF A;  1YFH A;  2M1S A;  2LV2 A;  3OML A;  1T39 A;  4R2R A;  5AC4 A;  4WXD A;  2JVA A;  1HNW E;  2EOF A;  3F6G A;  1J5E E;  2DGC A;  4L5N C;  1IBK E;  2GHF A;  2CTD A;  1N36 E;  4P7D A;  4WSG A;  2YPN A;  4R2Q A;  4KZS A;  1WHQ A;  2LUP B;  2DB2 A;  2EL4 A;  1QNT A;  4X8W A;  2LBS B;  4L8N A;  4NHR A;  1X49 A;  4OOG C;  4ZYE A;  2KON A;  4RH8 A;  1X47 A;  5LMU E;  4BBY A;  2UXD E;  2EPX A;  3QG5 C;  4DV7 E;  2DMI A;  5DNY A;  1X6E A;  2B3T B;  4ZYD A;  3EPL A;  4X9J A;  4MLV A;  1IBL E;  4R2A A;  4R2E A;  5T6J A;  2DMY A;  1JK1 A;  2V85 A;  3THO B;  2VQF E;  4WPY A;  4JI2 E;  4F9A B;  1GZ6 A;  1X6F A;  2EPO A;  4JI5 E;  1ZR9 A;  3EQ1 A;  3IWB A;  4DR7 E;  1PJS A;  2VE7 C;  3TQM A;  4Q28 A;  1SFE A;  2LT7 A;  1RMD A;  2VRD A;  1PJQ A;  5AE1 A;  3FIG A;  2HJJ A;  4M9V C;  4BHB A;  2EN2 A;  3OTO E;  1RC7 A;  2YU5 A;  2EMX A;  3EPK A;  2JYA A;  2R1F A;  1MGT A;  2GPI A;  2RQL A;  1A1I A;  2EPA A;  5KL7 A;  3AV0 A;  2LVH A;  2B9D A;  2EN3 A;  2LO3 A;  2CSH A;  2Q8U A;  1N34 E;  2EMH A;  2B7T A;  2LE2 A;  5FLX C;  3J7A G;  3BF2 A;  4X64 E;  2V88 A;  2EOO A;  2EM0 A;  2EP3 A;  3JU0 A;  2EOH A;  2E72 A;  2EOQ A;  2F8B A;  5BR8 E;  2EM7 A;  2YSP A;  3J80 C;  2EOJ A;  1ZBT A;  1BBG A;  2EPR A;  4NZV A;  1X5W A;  4BCA A;  3JAM C;  1WHN A;  1XMO E;  2EL6 A;  3BBG A;  2EL5 A;  3C6K A;  3H09 A;  4YHH E;  3HTX A;  2EQ3 A;  2FTX B;  2JR1 A;  2L2K B;  1X6H A;  5IWA E;  4DUZ E;  2EOX A;  4LF6 E;  2RSI A;  4JYA E;  4BC7 A;  5IV8 B;  5A2Q C;  2I13 A;  4NXM E;  4OX9 E;  4JI7 E;  3KWR A;  2LTR A;  2L3J A;  2EM6 A;  2YT4 A;  2EMZ A;  2V89 A;  2V87 A;  2YTP A;  1N33 E;  2EOE A;  3VYX A;  4BS9 A;  2EQ1 A;  2LCE A;  2EMB A;  3HXL A;  1JK2 A;  4F9C B;  1BBO A;  2EMC A;  2VF1 A;  2EPZ A;  3P1X A;  4JI8 E;  3ADG A;  2LMZ A;  2L3C A;  3EPH A;  1T4L B;  2JOX A;  3MHH C;  2EPL X;  2EMK A;  2DRP A;  4LTY A;  2YRM A;  1YUI A;  2EM8 A;  3JTZ A;  2EM5 A;  1J26 A;  2BB8 A;  4JI3 E;  2EMY A;  2JPA A;  2FGG A;  1Z1B A;  4B3S E;  2JWO A;  2EPM X;  2EOZ A;  4YY3 E;  1EKZ A;  2ENC A;  2ZM6 E;  5KL5 A;  4WFT A;  5A6A A;  1AH5 A;  1GTK A;  2YTF A;  3ADI A;  4N4R B;  1DGC A;  1EH7 A;  4DKK A;  5KL3 A;  1YUJ A;  1A1F A;  3ADJ A;  4WYQ B;  5A6J A;  4LFB E;  5TSE A;  2JOB A;  1HNZ E;  1UIL A;  2NA2 A;  5LLQ A;  2DLK A;  1ZU1 A;  2D9H A;  5AC5 A;  2JXP A;  4R2S A;  1XNR E;  4DR6 E;  2FV4 B;  3IWD A;  5IT9 C;  2YTJ A;  4K0K E;  4TUG A;  4LFA E;  5AE3 A;  4R2D A;  4RHB B;  2WBS A;  3C6M A;  1YSA C;  1IQO A;  1GQE A;  1B69 A;  2UUA E;  2RPC A;  2E1M A;  4X66 E;  2UU9 E;  1FJG E;  4GKK E;  4M2Z A;  1IBM E;  4Q35 B;  4B3R E;  2M9A A;  4O24 A;  4KHP E;  1IQS A;  3EPJ A;  4DV3 E;  4I8O A;  2EPP A;  4LU9 A;  2YTE A;  3VYY A;  4DR2 E;  2EE8 A;  3ZOQ B;  3HPZ A;  1A1G A;  2EN7 A;  1N32 E;  5F3W A;  4LF5 E;  3ECR A;  1UBD C;  5KL2 A;  1G2D C;  2K4V A;  1RQ0 A;  2L8T A;  4M0V A;  4R2P A;  4DV1 E;  3BID A;  2EN1 A;  2DLQ A;  2LJU A;  4DV4 E;  2N8X A;  2EOY A;  4DUY E;  4NXN E;  1KJK A;  4O4K A;  2K7I A;  3LLH A;  2EOM A;  2L33 A;  2VQE E;  2EM2 A;  3HQ1 A;  4HTG A;  2EWL A;  2NAB A;  2WZO A;  1LLM C;  1F2I G;  4DV0 E;  1A1H A;  1YYW A;  2YTD A;  3KZY A;  3AUZ A;  2CT1 A;  3MSW A;  5A6B D;  3DF6 A;  2MDR A;  4BC9 A;  1WXR A;  1XMQ E;  3C4T A;  2JY9 A;  2LTS A;  5KL6 A;  5LMN E;  2DIX A;  4LF9 E;  1A1J A;  3T1H E;  2YTO A;  1WJP A;  2R76 A;  2EOS A;  2YTQ A;  2LJH A;  4ZYG A;  2EML A;  2YTG A;  2WBU A;  2MC5 A;  2YTI A;  4DR1 E;  2LRS A;  2MDG A;  2N3G A;  1MEY C;  2EM3 A;  2N3H A;  2WBT A;  2YWQ A;  3KZZ A;  2YZT A;  2JP9 A;  2UXC E;  3C4B A;  5ADZ A;  4IS1 C;  1SR9 A;  4DR4 E;  1A1L A;  2MKN A;  4DV2 E;  2M7Q A;  2NUF A;  1L4S A;  4X65 E;  4B3T E;  4JI0 E;  2NUE A;  1N3G A;  2EMI A;  2A25 A;  1BB8 A;  3LML A;  2CPN A;  2RTX A;  1UHZ A;  2HGH A;  2ADR A;  4BMJ A;  3J7Y p;  2MKD A;  2YSO A;  4R2C A;  4DR3 E;  4GZN C;  4LF4 E;  2EPU A;  2V83 A;  2UUC E;  1YYK A;  2UUB E;  4LF8 E;  1QU6 A;  2F4V E;  1EH6 A;  5LL6 R;  2EN4 A;  4F6N A;  4JI6 E;  4JI1 E;  2L92 A;  1TN9 A;  4B3M E;  4R03 A;  4F2J C;  3ADL A;  1PKP A;  2RSM A;  4WSP A;  1UN6 B;  1X48 A;  1STU A;  2WCC 3;  2EOR A;  2MC6 A;  4GEQ B;  1YPN A;  4WXC A;  1AAY A;  5AAS A;  4F6M A;  4AQY E;  2EQ0 A;  2E5L E;  1DQ3 A;  2EN8 A;  3THN A;  3VK6 A;  2DSY A;  2YRK A; 
#chains in the Genus database with same CATH homology
 2H36 X;  4BS9 A;  3J81 C;  2L6M A;  1N36 E;  4P7D A;  1RQ0 A;  3HXL A;  2L8T A;  4KZS A;  4M0V A;  4F9C B;  4LF7 E;  1WHQ A;  4DV1 E;  2LUP B;  2DB2 A;  2VF1 A;  3P1X A;  4DV4 E;  4GKJ E;  4JI8 E;  4DUY E;  4NXN E;  2B7V A;  2ODR C;  3ADG A;  4X8W A;  4L8N A;  5CFF E;  2LBS B;  4OX9 E;  2LMZ A;  1IBK E;  1X49 A;  4OOG C;  2L3C A;  2KON A;  3LLH A;  4LFC E;  4JI4 E;  1T4L B;  2L33 A;  2ODR D;  2RS6 A;  2VQE E;  1X47 A;  2JOX A;  5LMU E;  3HQ1 A;  4BBY A;  2UXD E;  2EWL A;  2WZO A;  4LTY A;  4X62 E;  4DV7 E;  4DV0 E;  1YYW A;  5DNY A;  3IWC A;  3T1Y E;  3JTZ A;  4DV5 E;  2B3T B;  1J26 A;  3AUZ A;  4JI3 E;  3MSW A;  2FGG A;  3DF6 A;  2MDR A;  4BC9 A;  1IBL E;  2JWO A;  5T6J A;  2DMY A;  4B3S E;  2V85 A;  4YY3 E;  1WXR A;  2VQF E;  4WPY A;  3C4T A;  1XMQ E;  1EKZ A;  2JY9 A;  1FKA E;  2LTS A;  4JI2 E;  5LMN E;  4F9A B;  1GZ6 A;  2DIX A;  4LF9 E;  2ZM6 E;  4JI5 E;  3T1H E;  3DJW A;  3F6H A;  3IWB A;  4WFT A;  4DR7 E;  2VE7 C;  2LJH A;  4Q28 A;  3ADI A;  1T4N A;  1YZ9 A;  2UXB E;  3HPS A;  2MC5 A;  4DR1 E;  2LRS A;  2N3G A;  4P78 A;  2M4I A;  4DKK A;  2V86 A;  4R8O A;  5AE1 A;  1HNX E;  2N3H A;  3FIG A;  3K6Q A;  2YZT A;  2L2N A;  1I94 E;  2UXC E;  3ADJ A;  3C4B A;  4WYQ B;  5ADZ A;  3OTO E;  3RMP A;  1SR9 A;  1RC7 A;  4F9B B;  4DR4 E;  4LFB E;  2KOU A;  2JOB A;  4DV2 E;  1YYO A;  2M7Q A;  1HNZ E;  2NUF A;  1UIL A;  2NA2 A;  3AV0 A;  5AE2 A;  4TUI A;  4X65 E;  2RS7 A;  4B3T E;  2LUQ A;  2G7H A;  4JI0 E;  1XNQ E;  2EZ6 A;  2NUE A;  2B9D A;  1XNR E;  2FV4 B;  4DR6 E;  3IWD A;  5IT9 C;  4JV5 E;  4K0K E;  4TUG A;  3LML A;  1N34 E;  4LFA E;  2B7T A;  5AE3 A;  2CPN A;  2LE2 A;  2RTX A;  2V8Q B;  5FLX C;  3J7A G;  1UHZ A;  4X64 E;  2IHR 1;  2V88 A;  4F54 A;  2HHH E;  3J7Y p;  4M30 A;  1GQE A;  2F8B A;  3JU0 A;  5BR8 E;  4BMJ A;  1HR0 E;  4DR3 E;  3J80 C;  2UUA E;  4LF4 E;  1ZBT A;  2E1M A;  4X66 E;  2V83 A;  2UU9 E;  2UUC E;  1O0W A;  1FJG E;  4BCA A;  4DMI A;  4J8Z A;  1YYK A;  4GKK E;  3JAM C;  1WHN A;  2L2M A;  1XMO E;  2UUB E;  1IBM E;  4M2Z A;  1ZBQ A;  4LF8 E;  1QU6 A;  2NUG A;  2F4V E;  5LL6 R;  4B3R E;  4JI6 E;  3H09 A;  4YHH E;  1T4O A;  4JI1 E;  3HTX A;  1DI2 A;  2FTX B;  2JR1 A;  4DV6 E;  4KHP E;  2KHX A;  2L2K B;  2L92 A;  4DR5 E;  4B3M E;  4R03 A;  4I8O A;  5IWA E;  4DV3 E;  4DUZ E;  3ADL A;  1PKP A;  4LF6 E;  2M1S A;  3VYX A;  2RSM A;  4LU9 A;  4JYA E;  3OML A;  4BC7 A;  3VYY A;  4DR2 E;  4WSP A;  5A2Q C;  4NXM E;  1X48 A;  1STU A;  2JVA A;  4JI7 E;  3HPZ A;  3KWR A;  2LTR A;  3ZOQ B;  2MC6 A;  4GEQ B;  2L3J A;  5F3W A;  4LF5 E;  1N32 E;  3F6G A;  5AAS A;  4AQY E;  1J5E E;  2YT4 A;  2E5L E;  1DQ3 A;  4L5N C;  2V89 A;  2V87 A;  2K4V A;  3VK6 A;  1HNW E;  1N33 E;  2DSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...