3ADGA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
SHVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords F21M12.9 protein
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 20
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adgA00
1XMOE 1RQ0A 4WYQB 3T1YE 2KHXA 2LUQA 4DV0E 4JI6E 4DV4E 1XMQE 1HNWE 4LF9E 4OX9E 2F4VE 2N3GA 1HNXE 2B3TB 1WHNA 1J5EE 1WHQA 4DR7E 1T4OA 1IBLE 3HTXA 5BR8E 4KHPE 3T1HE 2MDRA 4DV6E 1EKZA 4LFAE 5IWAE 2IHR1 2RSMA 4X8WA 4JI5E 4M2ZA 1I94E 3OTOE 4B3TE 1N34E 2L3CA 4K0KE 4JI8E 2LUPB 4NXNE 2NUGA 4GKKE 4JI3E 3ADIA 2VQFE 1YYWA 3VYXA 2UXDE 3VYYA 4JI1E 2RTXA 3J7Yp 1FKAE 2JVAA 2CPNA 3LLHA 4X66E 4LF4E 1YYKA 4YHHE 1T4NA 4OOGC 4B3SE 2DIXA 4DKKA 1IBKE 4LF7E 1QU6A 4M30A 4JYAE 1IBME 2L2NA 2LBSB 5LMNE 3ADJA 4DR1E 2UUCE 4LF6E 3ADGA 4JI0E 1HR0E 2L3JA 4DV3E 2NA2A 1RC7A 4DR6E 2DB2A 4LF5E 2EZ6A 1UHZA 2JY9A 4WFTA 4DR4E 4NXME 2UU9E 2YT4A 2LTRA 4DR3E 3P1XA 4DUZE 4AQYE 1O0WA 4LFBE 1YZ9A 4B3RE 4JI2E 4JI4E 1UILA 1XNRE 1PKPA 5CFFE 2UUBE 2RS6A 2VQEE 2N3HA 1ZBTA 1N36E 2UXBE 4X62E 2NUEA 2NUFA 4JI7E 2B7TA 2RS7A 4JV5E 1FJGE 2DMYA 2UUAE 1GQEA 4DV1E 4X64E 2L2MA 4LFCE 3ADLA 4GKJE 1X48A 1J26A 2B7VA 2L33A 4DUYE 4DR5E 1HNZE 1STUA 2E5LE 4DV7E 4X65E 4LF8E 1T4LB 1N32E 4YY3E 4DV5E 3C4BA 1YYOA 2L2KB 1DI2A 2LRSA 2LJHA 2ZM6E 5LMUE 2UXCE 1N33E 4B3ME 1X47A 4DR2E 4DV2E 1XNQE 3C4TA 2HHHE 1X49A 2LTSA
chains in the Genus database with same CATH superfamily
2YTPA 3T1YE 1BBGA 2A25A 2EMFA 2R1FA 2D9HA 1HNWE 1NCSA 4BC9A 1YSAC 3RMPA 2B3TB 1IBLE 3HXLA 5BR8E 4KHPE 2V85A 1A1JA 1B69A 2BBGA 4NZVA 4R8OA 1A1IA 4HEIA 2YTDA 1EH6A 5IWAE 2RSMA 2B9DA 2YRHA 1WXRA 1F2IG 2WBTA 2EM3A 2M1SA 2EN4A 2NUGA 1IMUA 2EQ1A 2EM9A 2EPXA 2F8BA 5KL5A 4WSPA 1G2DC 5ADZA 1LLMC 1A1LA 5KL4A 2EP3A 1TF3A 3JU0A 3LLHA 4LF4E 1P47A 3FIGA 2HJJA 2EE8A 2M7QA 2EOFA 1A1KA 3ADJA 4JI0E 2EMGA 2NA2A 1YUIA 2DB2A 2EMAA 4ZYDA 4WFTA 2DGCA 3IWDA 2UU9E 2EOQA 3P1XA 5KL2A 1JK1A 4O4KA 5A6BA 1O0WA 1A1FA 2YPNA 3TQMA 4B3RE 4JI2E 3JTZA 1ZBQA 2ENAA 2YTGA 2UUBE 2YSPA 3ZOQB 1N36E 2EPLX 2EOZA 4JI7E 2YTNA 2RS7A 1A1HA 4KZSA 2EMKA 4X64E 4LFCE 5AASA 2EM8A 4WXDA 2EOYA 1YPNA 1N32E 1YFHA 4LF8E 4YY3E 1ZAAC 3DJWA 2EPUA 2KOUA 3C6KA 2E72A 1X47A 4F54A 4DV2E 2MKDA 4BHBA 2HHHE 2YTOA 5IV8B 4WYQB 1EH8A 1IQOA 3K6QA 1SR9A 4DV0E 2LUQA 4MLVA 1X6HA 4RH8A 3THNA 1MGTA 2MC5A 1T39A 2N3GA 2JXPA 2NABA 2EPMX 1HNXE 1J5EE 2EMWA 2LE2A 3HTXA 2RSIA 2JR1A 4WX9A 2EOSA 4F2JC 2MDRA 2V8QB 4WSGA 4R03A 2IHR1 3MSWA 4X8WA 4M2ZA 2JOBA 5AC5A 2JPAA 2YU5A 3OTOE 4O24A 4R2CA 3J7AG 4F9AB 2E1MA 3KZYA 4GKKE 2VE7C 2WCC3 3ADIA 2WBSA 2UXDE 4R2SA 2EPPA 2RTXA 2EPAA 2N8XA 2RQLA 4LU9A 2EOEA 1BB8A 4WXCA 4X66E 2DMIA 1DGCA 1T4NA 1QNTA 3QG5C 2V83A 2K4VA 2L8TA 1IBKE 1QU6A 4LF6E 3EPKA 1SFEA 2R76A 4NHRA 3DF6A 5T6JA 4DR6E 2EZ6A 5KL3A 4I8OA 2YT4A 2LTRA 5LLQA 3BIDA 4LFBE 2EM0A 2M4IA 2YSOA 4GZNC 4BCAA 3IWBA 2V87A 2RS6A 2EPKX 2VQEE 1ZBTA 5A6AA 4F9CB 1A1GA 4X62E 2LVHA 2NUFA 2YTJA 3KWRA 5A6JA 1GQEA 4DV1E 2ODRC 4DMIA 5LL6R 4BHCA 2EL6A 2MDGA 1X6EA 4Q35B 2YTEA 5A6KA 2ELZA 2PRTA 2EMIA 1J26A 4DUYE 2L33A 3H09A 4DV7E 4DV5E 3C4BA 1YYOA 2L2KB 5TSEA 1N33E 4DR2E 2M9AA 4TUGA 3C4TA 3EQ1A 4O43A 2CT1A 2WBUA 2EPOA 4F9BB 1XMOE 4WPYA 2CTDA 3EPHA 1MEYC 1PJSA 2KHXA 2H36X 4JI6E 1XMQE 4Q28A 4LF9E 2LJUA 2EN3A 1WHNA 3MHSC 2EOMA 2MC6A 3T1HE 1EKZA 4DV6E 2DLQA 2MKNA 2BB8A 4JI5E 1X3CA 3ECRA 4B3TE 1JK2A 1BBOA 2ENHA 1L4SA 2JYAA 1N34E 2L3CA 2J7JA 2LUPB 4M9VC 4NXNE 4O5GA 4ZYGA 3VYXA 2VQFE 2LV2A 4R2PA 3VYYA 4P78A 5F3WA 1PDAA 2EPRA 3J7Yp 2Q8UA 2V89A 5A6BD 3VK6A 1KJKA 4R2RA 5AE3A 2EWLA 2YU8A 2CPNA 2DLKA 4YHHE 3OMLA 4OOGC 2DIXA 1KYQA 2EM4A 1WRJA 2LO3A 4M30A 4JYAE 2DSYA 1IBME 3IWCA 1WJPA 2ADRA 5LMNE 2HC5A 4DR1E 2UUCE 3ADGA 3F6GA 1HR0E 2EMLA 2L3JA 4DV3E 2JOXA 1RC7A 2EORA 5IXMB 2YRKA 4LF5E 5IT9C 2JY9A 3THOB 4DR4E 1NEIA 4NXME 2I9IA 1TF6A 4M0VA 2JWOA 1YZ9A 2EOOA 2GPIA 3J81C 2FTXB 2VRDA 2EPCA 2V88A 2EMCA 4TUIA 1XNRE 5CFFE 4BMJA 3M99B 2EQ3A 2N3HA 3BBGA 4FK5C 3F6HA 2EMBA 2EOJA 2EPZA 2EQ0A 5A2QC 2EMHA 2EN6A 4HTGA 3ADLA 2EN2A 4P7DA 3L00A 4MLQA 1AH5A 3BGHA 5AE2A 2B7VA 1STUA 1UBDC 1PJTA 4X9JA 4IS1C 2EMXA 4R2EA 2YRMA 4B3ME 1XNQE 2EL4A 4BC7A 2EJ4A 4GKJE 1RQ0A 2YTFA 4ZYEA 1AAYA 2YTQA 5A69A 3AUZA 2K7IA 4DV4E 4OX9E 1RMDA 2EM7A 2F4VE 2LT7A 5KL6A 1WHQA 4DR7E 1T4OA 2HGHA 4R2QA 3HPSA 3AV0A 2FGGA 2ODRD 2EMYA 4LFAE 2EN1A 2KONA 1T38A 1GTKA 1I94E 1IQSA 4KWYA 4K0KE 2EM5A 4JI8E 3UK3C 2GLIA 2EM6A 2CSHA 4JI3E 1YYWA 2YZTA 4JI1E 2V86A 4BS9A 1FKAE 2DRPA 5KL7A 2JVAA 1YYKA 2EM2A 1ZU1A 3VHTB 3EPJA 1X5WA 2EN8A 2LMZA 5FLXC 4B3SE 5AC4A 4DKKA 4LF7E 2EOIA 2WZOA 2L2NA 2EL5A 2LBSB 3LMLA 1YUJA 2L92A 2YTIA 2EOXA 2G7HA 4F6MA 1Z1BA 2EOHA 1UHZA 3MHHC 2EPNA 4DR3E 4DUZE 3KZZA 1UN6B 4AQYE 4BBYA 2I13A 5DNYA 1ZR9A 1TN9A 2L6MA 4RHBB 4JI4E 1UILA 4J8ZA 1PKPA 5AE1A 3EPLA 2JP9A 3BF2A 2LCEA 4ZYHA 4LTYA 3JAMC 1N3GA 2UXBE 2NUEA 2EN7A 4R2AA 4N4RB 1PJQA 2RPCA 2B7TA 4JV5E 1FJGE 2DMYA 2UUAE 1G2FC 4GEQB 4R2DA 2ELYA 2ENCA 2L2MA 2VF1A 1X48A 3J80C 2FV4B 4DR5E 1HNZE 2E5LE 2GHFA 4X65E 1T4LB 1GZ6A 3C6MA 3HQ1A 1DI2A 2LRSA 2LJHA 2ZM6E 5LMUE 1X6FA 2UXCE 2YWQA 2EMZA 3HPZA 4L8NA 4IJDA 1DQ3A 4F6NA 4L5NC 1EH7A 1X49A 2LTSA
chains in the Genus database with same CATH topology
1XMOE 1RQ0A 4F9BB 4WYQB 4WPYA 3T1YE 3K6QA 1SR9A 2KHXA 2LUQA 2H36X 3AUZA 4DV0E 4DV4E 4Q28A 1XMQE 2MC5A 4JI6E 4LF9E 4OX9E 2N3GA 4BC9A 2F4VE 1HNWE 1HNXE 3RMPA 2B3TB 1WHNA 1J5EE 1WHQA 2LE2A 1T4OA 4DR7E 1IBLE 3HXLA 3HTXA 5BR8E 4KHPE 3HPSA 2V85A 3AV0A 2FGGA 2JR1A 2ODRD 2MC6A 3T1HE 2MDRA 2V8QB 4R8OA 4DV6E 4R03A 1EKZA 4LFAE 2KONA 2IHR1 2RSMA 3MSWA 4X8WA 2JOBA 2B9DA 5IWAE 4JI5E 4M2ZA 1WXRA 1I94E 2HHHE 3OTOE 4B3TE 3J7AG 2M1SA 1N34E 2L3CA 4K0KE 4JI8E 4F9AB 2LUPB 4NXNE 2NUGA 2E1MA 4GKKE 2VE7C 4JI3E 3ADIA 2VQFE 1YYWA 3VYXA 2F8BA 2YZTA 2UXDE 3VYYA 4P78A 5F3WA 2V86A 2RTXA 4JI1E 3J7Yp 2V89A 4WSPA 3VK6A 5ADZA 4BS9A 1FKAE 5AE3A 2EWLA 4LU9A 2JVAA 3JU0A 2CPNA 3LLHA 4X66E 4LF4E 1YYKA 4YHHE 1T4NA 2LMZA 3OMLA 4OOGC 2V83A 3FIGA 5FLXC 4B3SE 2DIXA 2K4VA 2L8TA 4DKKA 1IBKE 4LF7E 1QU6A 4M30A 4JYAE 2DSYA 2WZOA 2M7QA 2L2NA 2LBSB 3IWCA 3LMLA 1IBME 5LMNE 3ADJA 4DR1E 2L92A 2UUCE 3ADGA 4JI0E 4LF6E 3F6GA 1HR0E 2L3JA 2G7HA 4DV3E 2JOXA 2NA2A 3DF6A 5T6JA 1RC7A 4DR6E 2DB2A 4LF5E 2EZ6A 5IT9C 1UHZA 2JY9A 4WFTA 4DR4E 4NXME 3IWDA 4I8OA 2UU9E 2YT4A 2LTRA 4DR3E 3P1XA 4DUZE 4M0VA 4AQYE 1O0WA 2JWOA 4BBYA 4LFBE 1YZ9A 5DNYA 4B3RE 3J81C 4JI2E 2FTXB 3JTZA 2L6MA 2M4IA 1ZBQA 2V88A 4BCAA 4JI4E 1UILA 4TUIA 4J8ZA 1PKPA 5AE1A 5CFFE 1XNRE 4BMJA 2UUBE 3IWBA 2V87A 2RS6A 2VQEE 4LTYA 3JAMC 2N3HA 3ZOQB 1ZBTA 1N36E 4F9CB 2UXBE 4X62E 2NUEA 2NUFA 4JI7E 2B7TA 3KWRA 2RS7A 4JV5E 1FJGE 2DMYA 2UUAE 1GQEA 3F6HA 4GEQB 4KZSA 4DV1E 2ODRC 5A2QC 4X64E 2L2MA 4LFCE 5AASA 3ADLA 4DMIA 5LL6R 4GKJE 4P7DA 2VF1A 1X48A 1J26A 3J80C 2FV4B 5AE2A 2B7VA 2L33A 4DUYE 4DR5E 1HNZE 1STUA 2E5LE 3H09A 4DV7E 4X65E 4LF8E 1T4LB 1N32E 1GZ6A 4YY3E 4DV5E 3DJWA 3C4BA 1YYOA 3HQ1A 2L2KB 1DI2A 2LRSA 2LJHA 2ZM6E 5LMUE 2UXCE 3HPZA 1N33E 2KOUA 4F54A 4L8NA 1X47A 4B3ME 4DR2E 4TUGA 4DV2E 1XNQE 3C4TA 1DQ3A 4L5NC 4BC7A 1X49A 2LTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO E;  1RQ0 A;  4WYQ B;  3T1Y E;  2KHX A;  2LUQ A;  4DV0 E;  4JI6 E;  4DV4 E;  1XMQ E;  1HNW E;  4LF9 E;  4OX9 E;  2F4V E;  2N3G A;  1HNX E;  2B3T B;  1WHN A;  1J5E E;  1WHQ A;  4DR7 E;  1T4O A;  1IBL E;  3HTX A;  5BR8 E;  4KHP E;  3T1H E;  2MDR A;  4DV6 E;  1EKZ A;  4LFA E;  5IWA E;  2IHR 1;  2RSM A;  4X8W A;  4JI5 E;  4M2Z A;  1I94 E;  3OTO E;  4B3T E;  1N34 E;  2L3C A;  4K0K E;  4JI8 E;  2LUP B;  4NXN E;  2NUG A;  4GKK E;  4JI3 E;  3ADI A;  2VQF E;  1YYW A;  3VYX A;  2UXD E;  3VYY A;  4JI1 E;  2RTX A;  3J7Y p;  1FKA E;  2JVA A;  2CPN A;  3LLH A;  4X66 E;  4LF4 E;  1YYK A;  4YHH E;  1T4N A;  4OOG C;  4B3S E;  2DIX A;  4DKK A;  1IBK E;  4LF7 E;  1QU6 A;  4M30 A;  4JYA E;  1IBM E;  2L2N A;  2LBS B;  5LMN E;  3ADJ A;  4DR1 E;  2UUC E;  4LF6 E;  3ADG A;  4JI0 E;  1HR0 E;  2L3J A;  4DV3 E;  2NA2 A;  1RC7 A;  4DR6 E;  2DB2 A;  4LF5 E;  2EZ6 A;  1UHZ A;  2JY9 A;  4WFT A;  4DR4 E;  4NXM E;  2UU9 E;  2YT4 A;  2LTR A;  4DR3 E;  3P1X A;  4DUZ E;  4AQY E;  1O0W A;  4LFB E;  1YZ9 A;  4B3R E;  4JI2 E;  4JI4 E;  1UIL A;  1XNR E;  1PKP A;  5CFF E;  2UUB E;  2RS6 A;  2VQE E;  2N3H A;  1ZBT A;  1N36 E;  2UXB E;  4X62 E;  2NUE A;  2NUF A;  4JI7 E;  2B7T A;  2RS7 A;  4JV5 E;  1FJG E;  2DMY A;  2UUA E;  1GQE A;  4DV1 E;  4X64 E;  2L2M A;  4LFC E;  3ADL A;  4GKJ E;  1X48 A;  1J26 A;  2B7V A;  2L33 A;  4DUY E;  4DR5 E;  1HNZ E;  1STU A;  2E5L E;  4DV7 E;  4X65 E;  4LF8 E;  1T4L B;  1N32 E;  4YY3 E;  4DV5 E;  3C4B A;  1YYO A;  2L2K B;  1DI2 A;  2LRS A;  2LJH A;  2ZM6 E;  5LMU E;  2UXC E;  1N33 E;  4B3M E;  1X47 A;  4DR2 E;  4DV2 E;  1XNQ E;  3C4T A;  2HHH E;  1X49 A;  2LTS A; 
#chains in the Genus database with same CATH topology
 2YTP A;  3T1Y E;  1BBG A;  2A25 A;  2EMF A;  2R1F A;  2D9H A;  1HNW E;  1NCS A;  4BC9 A;  1YSA C;  3RMP A;  2B3T B;  1IBL E;  3HXL A;  5BR8 E;  4KHP E;  2V85 A;  1A1J A;  1B69 A;  2BBG A;  4NZV A;  4R8O A;  1A1I A;  4HEI A;  2YTD A;  1EH6 A;  5IWA E;  2RSM A;  2B9D A;  2YRH A;  1WXR A;  1F2I G;  2WBT A;  2EM3 A;  2M1S A;  2EN4 A;  2NUG A;  1IMU A;  2EQ1 A;  2EM9 A;  2EPX A;  2F8B A;  5KL5 A;  4WSP A;  1G2D C;  5ADZ A;  1LLM C;  1A1L A;  5KL4 A;  2EP3 A;  1TF3 A;  3JU0 A;  3LLH A;  4LF4 E;  1P47 A;  3FIG A;  2HJJ A;  2EE8 A;  2M7Q A;  2EOF A;  1A1K A;  3ADJ A;  4JI0 E;  2EMG A;  2NA2 A;  1YUI A;  2DB2 A;  2EMA A;  4ZYD A;  4WFT A;  2DGC A;  3IWD A;  2UU9 E;  2EOQ A;  3P1X A;  5KL2 A;  1JK1 A;  4O4K A;  5A6B A;  1O0W A;  1A1F A;  2YPN A;  3TQM A;  4B3R E;  4JI2 E;  3JTZ A;  1ZBQ A;  2ENA A;  2YTG A;  2UUB E;  2YSP A;  3ZOQ B;  1N36 E;  2EPL X;  2EOZ A;  4JI7 E;  2YTN A;  2RS7 A;  1A1H A;  4KZS A;  2EMK A;  4X64 E;  4LFC E;  5AAS A;  2EM8 A;  4WXD A;  2EOY A;  1YPN A;  1N32 E;  1YFH A;  4LF8 E;  4YY3 E;  1ZAA C;  3DJW A;  2EPU A;  2KOU A;  3C6K A;  2E72 A;  1X47 A;  4F54 A;  4DV2 E;  2MKD A;  4BHB A;  2HHH E;  2YTO A;  5IV8 B;  4WYQ B;  1EH8 A;  1IQO A;  3K6Q A;  1SR9 A;  4DV0 E;  2LUQ A;  4MLV A;  1X6H A;  4RH8 A;  3THN A;  1MGT A;  2MC5 A;  1T39 A;  2N3G A;  2JXP A;  2NAB A;  2EPM X;  1HNX E;  1J5E E;  2EMW A;  2LE2 A;  3HTX A;  2RSI A;  2JR1 A;  4WX9 A;  2EOS A;  4F2J C;  2MDR A;  2V8Q B;  4WSG A;  4R03 A;  2IHR 1;  3MSW A;  4X8W A;  4M2Z A;  2JOB A;  5AC5 A;  2JPA A;  2YU5 A;  3OTO E;  4O24 A;  4R2C A;  3J7A G;  4F9A B;  2E1M A;  3KZY A;  4GKK E;  2VE7 C;  2WCC 3;  3ADI A;  2WBS A;  2UXD E;  4R2S A;  2EPP A;  2RTX A;  2EPA A;  2N8X A;  2RQL A;  4LU9 A;  2EOE A;  1BB8 A;  4WXC A;  4X66 E;  2DMI A;  1DGC A;  1T4N A;  1QNT A;  3QG5 C;  2V83 A;  2K4V A;  2L8T A;  1IBK E;  1QU6 A;  4LF6 E;  3EPK A;  1SFE A;  2R76 A;  4NHR A;  3DF6 A;  5T6J A;  4DR6 E;  2EZ6 A;  5KL3 A;  4I8O A;  2YT4 A;  2LTR A;  5LLQ A;  3BID A;  4LFB E;  2EM0 A;  2M4I A;  2YSO A;  4GZN C;  4BCA A;  3IWB A;  2V87 A;  2RS6 A;  2EPK X;  2VQE E;  1ZBT A;  5A6A A;  4F9C B;  1A1G A;  4X62 E;  2LVH A;  2NUF A;  2YTJ A;  3KWR A;  5A6J A;  1GQE A;  4DV1 E;  2ODR C;  4DMI A;  5LL6 R;  4BHC A;  2EL6 A;  2MDG A;  1X6E A;  4Q35 B;  2YTE A;  5A6K A;  2ELZ A;  2PRT A;  2EMI A;  1J26 A;  4DUY E;  2L33 A;  3H09 A;  4DV7 E;  4DV5 E;  3C4B A;  1YYO A;  2L2K B;  5TSE A;  1N33 E;  4DR2 E;  2M9A A;  4TUG A;  3C4T A;  3EQ1 A;  4O43 A;  2CT1 A;  2WBU A;  2EPO A;  4F9B B;  1XMO E;  4WPY A;  2CTD A;  3EPH A;  1MEY C;  1PJS A;  2KHX A;  2H36 X;  4JI6 E;  1XMQ E;  4Q28 A;  4LF9 E;  2LJU A;  2EN3 A;  1WHN A;  3MHS C;  2EOM A;  2MC6 A;  3T1H E;  1EKZ A;  4DV6 E;  2DLQ A;  2MKN A;  2BB8 A;  4JI5 E;  1X3C A;  3ECR A;  4B3T E;  1JK2 A;  1BBO A;  2ENH A;  1L4S A;  2JYA A;  1N34 E;  2L3C A;  2J7J A;  2LUP B;  4M9V C;  4NXN E;  4O5G A;  4ZYG A;  3VYX A;  2VQF E;  2LV2 A;  4R2P A;  3VYY A;  4P78 A;  5F3W A;  1PDA A;  2EPR A;  3J7Y p;  2Q8U A;  2V89 A;  5A6B D;  3VK6 A;  1KJK A;  4R2R A;  5AE3 A;  2EWL A;  2YU8 A;  2CPN A;  2DLK A;  4YHH E;  3OML A;  4OOG C;  2DIX A;  1KYQ A;  2EM4 A;  1WRJ A;  2LO3 A;  4M30 A;  4JYA E;  2DSY A;  1IBM E;  3IWC A;  1WJP A;  2ADR A;  5LMN E;  2HC5 A;  4DR1 E;  2UUC E;  3ADG A;  3F6G A;  1HR0 E;  2EML A;  2L3J A;  4DV3 E;  2JOX A;  1RC7 A;  2EOR A;  5IXM B;  2YRK A;  4LF5 E;  5IT9 C;  2JY9 A;  3THO B;  4DR4 E;  1NEI A;  4NXM E;  2I9I A;  1TF6 A;  4M0V A;  2JWO A;  1YZ9 A;  2EOO A;  2GPI A;  3J81 C;  2FTX B;  2VRD A;  2EPC A;  2V88 A;  2EMC A;  4TUI A;  1XNR E;  5CFF E;  4BMJ A;  3M99 B;  2EQ3 A;  2N3H A;  3BBG A;  4FK5 C;  3F6H A;  2EMB A;  2EOJ A;  2EPZ A;  2EQ0 A;  5A2Q C;  2EMH A;  2EN6 A;  4HTG A;  3ADL A;  2EN2 A;  4P7D A;  3L00 A;  4MLQ A;  1AH5 A;  3BGH A;  5AE2 A;  2B7V A;  1STU A;  1UBD C;  1PJT A;  4X9J A;  4IS1 C;  2EMX A;  4R2E A;  2YRM A;  4B3M E;  1XNQ E;  2EL4 A;  4BC7 A;  2EJ4 A;  4GKJ E;  1RQ0 A;  2YTF A;  4ZYE A;  1AAY A;  2YTQ A;  5A69 A;  3AUZ A;  2K7I A;  4DV4 E;  4OX9 E;  1RMD A;  2EM7 A;  2F4V E;  2LT7 A;  5KL6 A;  1WHQ A;  4DR7 E;  1T4O A;  2HGH A;  4R2Q A;  3HPS A;  3AV0 A;  2FGG A;  2ODR D;  2EMY A;  4LFA E;  2EN1 A;  2KON A;  1T38 A;  1GTK A;  1I94 E;  1IQS A;  4KWY A;  4K0K E;  2EM5 A;  4JI8 E;  3UK3 C;  2GLI A;  2EM6 A;  2CSH A;  4JI3 E;  1YYW A;  2YZT A;  4JI1 E;  2V86 A;  4BS9 A;  1FKA E;  2DRP A;  5KL7 A;  2JVA A;  1YYK A;  2EM2 A;  1ZU1 A;  3VHT B;  3EPJ A;  1X5W A;  2EN8 A;  2LMZ A;  5FLX C;  4B3S E;  5AC4 A;  4DKK A;  4LF7 E;  2EOI A;  2WZO A;  2L2N A;  2EL5 A;  2LBS B;  3LML A;  1YUJ A;  2L92 A;  2YTI A;  2EOX A;  2G7H A;  4F6M A;  1Z1B A;  2EOH A;  1UHZ A;  3MHH C;  2EPN A;  4DR3 E;  4DUZ E;  3KZZ A;  1UN6 B;  4AQY E;  4BBY A;  2I13 A;  5DNY A;  1ZR9 A;  1TN9 A;  2L6M A;  4RHB B;  4JI4 E;  1UIL A;  4J8Z A;  1PKP A;  5AE1 A;  3EPL A;  2JP9 A;  3BF2 A;  2LCE A;  4ZYH A;  4LTY A;  3JAM C;  1N3G A;  2UXB E;  2NUE A;  2EN7 A;  4R2A A;  4N4R B;  1PJQ A;  2RPC A;  2B7T A;  4JV5 E;  1FJG E;  2DMY A;  2UUA E;  1G2F C;  4GEQ B;  4R2D A;  2ELY A;  2ENC A;  2L2M A;  2VF1 A;  1X48 A;  3J80 C;  2FV4 B;  4DR5 E;  1HNZ E;  2E5L E;  2GHF A;  4X65 E;  1T4L B;  1GZ6 A;  3C6M A;  3HQ1 A;  1DI2 A;  2LRS A;  2LJH A;  2ZM6 E;  5LMU E;  1X6F A;  2UXC E;  2YWQ A;  2EMZ A;  3HPZ A;  4L8N A;  4IJD A;  1DQ3 A;  4F6N A;  4L5N C;  1EH7 A;  1X49 A;  2LTS A; 
#chains in the Genus database with same CATH homology
 1XMO E;  1RQ0 A;  4F9B B;  4WYQ B;  4WPY A;  3T1Y E;  3K6Q A;  1SR9 A;  2KHX A;  2LUQ A;  2H36 X;  3AUZ A;  4DV0 E;  4DV4 E;  4Q28 A;  1XMQ E;  2MC5 A;  4JI6 E;  4LF9 E;  4OX9 E;  2N3G A;  4BC9 A;  2F4V E;  1HNW E;  1HNX E;  3RMP A;  2B3T B;  1WHN A;  1J5E E;  1WHQ A;  2LE2 A;  1T4O A;  4DR7 E;  1IBL E;  3HXL A;  3HTX A;  5BR8 E;  4KHP E;  3HPS A;  2V85 A;  3AV0 A;  2FGG A;  2JR1 A;  2ODR D;  2MC6 A;  3T1H E;  2MDR A;  2V8Q B;  4R8O A;  4DV6 E;  4R03 A;  1EKZ A;  4LFA E;  2KON A;  2IHR 1;  2RSM A;  3MSW A;  4X8W A;  2JOB A;  2B9D A;  5IWA E;  4JI5 E;  4M2Z A;  1WXR A;  1I94 E;  2HHH E;  3OTO E;  4B3T E;  3J7A G;  2M1S A;  1N34 E;  2L3C A;  4K0K E;  4JI8 E;  4F9A B;  2LUP B;  4NXN E;  2NUG A;  2E1M A;  4GKK E;  2VE7 C;  4JI3 E;  3ADI A;  2VQF E;  1YYW A;  3VYX A;  2F8B A;  2YZT A;  2UXD E;  3VYY A;  4P78 A;  5F3W A;  2V86 A;  2RTX A;  4JI1 E;  3J7Y p;  2V89 A;  4WSP A;  3VK6 A;  5ADZ A;  4BS9 A;  1FKA E;  5AE3 A;  2EWL A;  4LU9 A;  2JVA A;  3JU0 A;  2CPN A;  3LLH A;  4X66 E;  4LF4 E;  1YYK A;  4YHH E;  1T4N A;  2LMZ A;  3OML A;  4OOG C;  2V83 A;  3FIG A;  5FLX C;  4B3S E;  2DIX A;  2K4V A;  2L8T A;  4DKK A;  1IBK E;  4LF7 E;  1QU6 A;  4M30 A;  4JYA E;  2DSY A;  2WZO A;  2M7Q A;  2L2N A;  2LBS B;  3IWC A;  3LML A;  1IBM E;  5LMN E;  3ADJ A;  4DR1 E;  2L92 A;  2UUC E;  3ADG A;  4JI0 E;  4LF6 E;  3F6G A;  1HR0 E;  2L3J A;  2G7H A;  4DV3 E;  2JOX A;  2NA2 A;  3DF6 A;  5T6J A;  1RC7 A;  4DR6 E;  2DB2 A;  4LF5 E;  2EZ6 A;  5IT9 C;  1UHZ A;  2JY9 A;  4WFT A;  4DR4 E;  4NXM E;  3IWD A;  4I8O A;  2UU9 E;  2YT4 A;  2LTR A;  4DR3 E;  3P1X A;  4DUZ E;  4M0V A;  4AQY E;  1O0W A;  2JWO A;  4BBY A;  4LFB E;  1YZ9 A;  5DNY A;  4B3R E;  3J81 C;  4JI2 E;  2FTX B;  3JTZ A;  2L6M A;  2M4I A;  1ZBQ A;  2V88 A;  4BCA A;  4JI4 E;  1UIL A;  4TUI A;  4J8Z A;  1PKP A;  5AE1 A;  5CFF E;  1XNR E;  4BMJ A;  2UUB E;  3IWB A;  2V87 A;  2RS6 A;  2VQE E;  4LTY A;  3JAM C;  2N3H A;  3ZOQ B;  1ZBT A;  1N36 E;  4F9C B;  2UXB E;  4X62 E;  2NUE A;  2NUF A;  4JI7 E;  2B7T A;  3KWR A;  2RS7 A;  4JV5 E;  1FJG E;  2DMY A;  2UUA E;  1GQE A;  3F6H A;  4GEQ B;  4KZS A;  4DV1 E;  2ODR C;  5A2Q C;  4X64 E;  2L2M A;  4LFC E;  5AAS A;  3ADL A;  4DMI A;  5LL6 R;  4GKJ E;  4P7D A;  2VF1 A;  1X48 A;  1J26 A;  3J80 C;  2FV4 B;  5AE2 A;  2B7V A;  2L33 A;  4DUY E;  4DR5 E;  1HNZ E;  1STU A;  2E5L E;  3H09 A;  4DV7 E;  4X65 E;  4LF8 E;  1T4L B;  1N32 E;  1GZ6 A;  4YY3 E;  4DV5 E;  3DJW A;  3C4B A;  1YYO A;  3HQ1 A;  2L2K B;  1DI2 A;  2LRS A;  2LJH A;  2ZM6 E;  5LMU E;  2UXC E;  3HPZ A;  1N33 E;  2KOU A;  4F54 A;  4L8N A;  1X47 A;  4B3M E;  4DR2 E;  4TUG A;  4DV2 E;  1XNQ E;  3C4T A;  1DQ3 A;  4L5N C;  4BC7 A;  1X49 A;  2LTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...