2YWQA

Crystal structure of thermus thermophilus protein y n-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
89
Chain Sequence
b'MNIYKLIGRNLEITDAIRDYVEKKLARLDRYQDGELMAKVVLSLAGKARAEIQVDLPGGLVRVEEEDADLYAAIDRAVDRLETQVKRFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal subunit interface protein
publication title Crystal structure of Thermus thermophilus Protein Y N-terminal domain
rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 23
structure length 89
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 2ywqA00
1N3GA 1IMUA 1L4SA 2YWQA 4HEIA 2RQLA 3TQMA
chains in the Genus database with same CATH superfamily
1TN9A 2EMWA 2E72A 2YTOA 2UUCE 1YYKA 3P1XA 2K4VA 1ZBTA 1WJPA 4P7DA 1AH5A 2JYAA 2ENHA 4R2QA 4DV4E 4NXNE 2LUPB 2GHFA 2YT4A 2LE2A 1L4SA 4L5NC 4GZNC 2ZM6E 5AASA 2ENAA 1PDAA 4IJDA 2F8BA 2UXDE 4R2CA 4Q28A 4TUIA 2LVHA 4DV7E 3HQ1A 3LMLA 2JPAA 1JK2A 1FJGE 2EOXA 1G2FC 1YZ9A 1B69A 1X48A 4M0VA 4MLVA 5AC5A 2R76A 3KWRA 4JI3E 5ADZA 1F2IG 2RS6A 2EOJA 1FKAE 3TQMA 4WSGA 2YRKA 1YYWA 2DB2A 2PRTA 1IQSA 2GLIA 2NUFA 3ADLA 4BCAA 4NZVA 2D9HA 3J7Yp 3KZYA 2LJHA 4JI8E 2LBSB 4WXCA 1RMDA 2VQEE 3HTXA 1EH7A 3ECRA 1P47A 4LTYA 4F6MA 4OOGC 4JI6E 1WRJA 2JVAA 1A1GA 2UU9E 1WHQA 2J7JA 2EP3A 3K6QA 5A6JA 1T4LB 1DI2A 2DRPA 2YTNA 4J8ZA 2EM0A 2B7TA 3OTOE 3VYYA 2EOMA 5A6BA 3OMLA 5DNYA 4R2AA 2MDRA 4WFTA 2EM6A 4R2SA 2V86A 1BBOA 1IBKE 2DMIA 2VF1A 4BBYA 5A6KA 2RS7A 1YUIA 2NUEA 1ZBQA 2JY9A 1GZ6A 2V8QB 4I8OA 3ZOQB 2EPAA 5IT9C 4Q35B 2EM2A 4BC7A 2V83A 3ADJA 1YFHA 4B3TE 2M1SA 2HGHA 4R03A 3MHHC 2ODRD 2ODRC 2UUBE 2EN3A 2R1FA 1UN6B 2MC5A 5A2QC 2DSYA 2EPCA 2K7IA 2EOHA 2M9AA 3VYXA 2ADRA 2YSOA 1A1HA 1UBDC 1J26A 4JI2E 2L6MA 2DGCA 2LJUA 2LUQA 3THNA 5KL3A 1PKPA 4KZSA 4GKJE 1HR0E 2EN7A 3M99B 4LF9E 4JI1E 5AE2A 3BF2A 4JI5E 2E1MA 2ENCA 2EQ0A 2L92A 2WBUA 4KHPE 2EPZA 4DR5E 1ZAAC 1QU6A 2L2MA 4X66E 2KOUA 2WZOA 5KL4A 1DQ3A 1Z1BA 2A25A 3FIGA 2M7QA 4F9CB 4NXME 3HXLA 2MC6A 5IV8B 5F3WA 1JK1A 2EWLA 1EH8A 5AE3A 5AC4A 2NUGA 4O24A 4R2DA 2EE8A 2EMYA 2RSIA 1BB8A 1EH6A 2JOBA 1SFEA 2V89A 2YTIA 2LMZA 2MKNA 4BC9A 2V85A 2F4VE 3EPLA 2JWOA 1HNWE 4ZYDA 2EMCA 4FK5C 2MDGA 5KL6A 1KYQA 1A1FA 2JXPA 2LRSA 2L33A 2EPMX 2YU8A 2YSPA 3ADIA 3L00A 4TUGA 1EKZA 3F6HA 2EMAA 2G7HA 4WYQB 2EOFA 4BS9A 1GTKA 2YRMA 4X8WA 2EMLA 4YHHE 2EN8A 2LTRA 4O43A 4NHRA 4F9AB 5A6BD 1X3CA 1N34E 2FGGA 2RPCA 1A1LA 4OX9E 2DMYA 2EPKX 2YTGA 2EM8A 2EN6A 2ELYA 1A1KA 2YWQA 4R2PA 4M30A 4DV3E 4M9VC 2ELZA 4N4RB 2YTJA 4DR6E 2EOYA 2WBTA 3C4BA 3THOB 5T6JA 2N8XA 2YPNA 1YSAC 2L2KB 1TF3A 4KWYA 2L8TA 1A1JA 1XNRE 2EPOA 3BIDA 2EMKA 4LF6E 1PJSA 3KZZA 1YUJA 1J5EE 4DR7E 3IWDA 4B3SE 2UXCE 2EN1A 2EMGA 4LF4E 2GPIA 3T1YE 2E5LE 4MLQA 2NA2A 3JAMC 2EPUA 1N3GA 2YZTA 3MSWA 3J80C 3JU0A 2DLQA 1NEIA 2N3GA 3DF6A 2EM9A 2EMBA 2RQLA 5BR8E 4X65E 4DV2E 2N3HA 5LL6R 2UUAE 2L3CA 3BGHA 1IBLE 2EM3A 2EOEA 4LF7E 3VHTB 1X49A 3VK6A 2EL6A 1X6FA 4F54A 5LMNE 4LF8E 2EN2A 3EPHA 2BB8A 3EQ1A 2DLKA 4DMIA 1QNTA 2YRHA 1X47A 2V87A 5KL7A 5IWAE 2HHHE 3F6GA 4IS1C 2DIXA 3MHSC 4DUZE 1N33E 2JOXA 2L2NA 2L3JA 1T4OA 4LFAE 2EORA 2KHXA 4RH8A 1DGCA 2LTSA 3C6MA 4R2EA 2HC5A 2EPNA 1STUA 1TF6A 2WBSA 3EPKA 2I9IA 4L8NA 1UHZA 4WPYA 4LF5E 2VQFE 4AQYE 3JTZA 4LFCE 3AUZA 2EQ3A 1KJKA 2YTDA 2YTQA 4X64E 1GQEA 4LU9A 1RC7A 4RHBB 3HPZA 2FTXB 2EJ4A 2VRDA 5AE1A 2EL4A 2EOIA 3EPJA 1WXRA 2EN4A 2YU5A 4B3ME 3HPSA 2YTPA 1IMUA 4DUYE 4M2ZA 1PJQA 2EMXA 4WX9A 4WSPA 2EPXA 5LMUE 2EZ6A 1G2DC 4DV0E 4DR4E 1LLMC 3J7AG 2EOSA 1MGTA 2MKDA 4JI7E 1YYOA 2M4IA 3ADGA 3AV0A 2KONA 4WXDA 2HJJA 3DJWA 2LCEA 2EM7A 4LFBE 2LV2A 4GKKE 2EMFA 1UILA 1XMQE 4YY3E 2H36X 2NABA 4R2RA 4B3RE 3H09A 2EPPA 2UXBE 4JYAE 4HTGA 2EOZA 3C4TA 2EM5A 4F6NA 4P78A 2IHR1 3BBGA 4ZYGA 4DR2E 2CSHA 3LLHA 1YPNA 4JV5E 2B9DA 1WHNA 2V88A 1X6HA 5LLQA 1SR9A 2EMHA 1N32E 1MEYC 2YTEA 4O4KA 1T39A 2EPRA 1N36E 1X6EA 2FV4B 3QG5C 2EMIA 2EOQA 2B3TB 4HEIA 2VE7C 2CT1A 2EPLX 4JI4E 2EQ1A 4O5GA 4BHCA 4F9BB 1X5WA 2RTXA 4ZYHA 3UK3C 5FLXC 2LT7A 1ZU1A 2JP9A 4DR3E 4BMJA 3J81C 4DV5E 3C6KA 1I94E 4DKKA 1A1IA 2EL5A 2YTFA 3RMPA 4F2JC 1XMOE 2EM4A 1XNQE 4JI0E 5CFFE 3T1HE 1PJTA 4R8OA 2EOOA 2I13A 1IQOA 2B7VA 3IWBA 4DR1E 2CTDA 5A69A 1T38A 1IBME 2RSMA 1ZR9A 4BHBA 5IXMB 5KL2A 4GEQB 1BBGA 3IWCA 4DV6E 1HNZE 1T4NA 2Q8UA 4DV1E 1AAYA 1O0WA 1RQ0A 2LO3A 2CPNA 4X9JA 1HNXE 2JR1A 2BBGA 1NCSA 5A6AA 5KL5A 5TSEA 2WCC3 2EMZA 4ZYEA 4X62E 4K0KE
chains in the Genus database with same CATH topology
1N3GA 1IMUA 1L4SA 2YWQA 4HEIA 2RQLA 3TQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3G A;  1IMU A;  1L4S A;  2YWQ A;  4HEI A;  2RQL A;  3TQM A; 
#chains in the Genus database with same CATH topology
 1TN9 A;  2EMW A;  2E72 A;  2YTO A;  2UUC E;  1YYK A;  3P1X A;  2K4V A;  1ZBT A;  1WJP A;  4P7D A;  1AH5 A;  2JYA A;  2ENH A;  4R2Q A;  4DV4 E;  4NXN E;  2LUP B;  2GHF A;  2YT4 A;  2LE2 A;  1L4S A;  4L5N C;  4GZN C;  2ZM6 E;  5AAS A;  2ENA A;  1PDA A;  4IJD A;  2F8B A;  2UXD E;  4R2C A;  4Q28 A;  4TUI A;  2LVH A;  4DV7 E;  3HQ1 A;  3LML A;  2JPA A;  1JK2 A;  1FJG E;  2EOX A;  1G2F C;  1YZ9 A;  1B69 A;  1X48 A;  4M0V A;  4MLV A;  5AC5 A;  2R76 A;  3KWR A;  4JI3 E;  5ADZ A;  1F2I G;  2RS6 A;  2EOJ A;  1FKA E;  3TQM A;  4WSG A;  2YRK A;  1YYW A;  2DB2 A;  2PRT A;  1IQS A;  2GLI A;  2NUF A;  3ADL A;  4BCA A;  4NZV A;  2D9H A;  3J7Y p;  3KZY A;  2LJH A;  4JI8 E;  2LBS B;  4WXC A;  1RMD A;  2VQE E;  3HTX A;  1EH7 A;  3ECR A;  1P47 A;  4LTY A;  4F6M A;  4OOG C;  4JI6 E;  1WRJ A;  2JVA A;  1A1G A;  2UU9 E;  1WHQ A;  2J7J A;  2EP3 A;  3K6Q A;  5A6J A;  1T4L B;  1DI2 A;  2DRP A;  2YTN A;  4J8Z A;  2EM0 A;  2B7T A;  3OTO E;  3VYY A;  2EOM A;  5A6B A;  3OML A;  5DNY A;  4R2A A;  2MDR A;  4WFT A;  2EM6 A;  4R2S A;  2V86 A;  1BBO A;  1IBK E;  2DMI A;  2VF1 A;  4BBY A;  5A6K A;  2RS7 A;  1YUI A;  2NUE A;  1ZBQ A;  2JY9 A;  1GZ6 A;  2V8Q B;  4I8O A;  3ZOQ B;  2EPA A;  5IT9 C;  4Q35 B;  2EM2 A;  4BC7 A;  2V83 A;  3ADJ A;  1YFH A;  4B3T E;  2M1S A;  2HGH A;  4R03 A;  3MHH C;  2ODR D;  2ODR C;  2UUB E;  2EN3 A;  2R1F A;  1UN6 B;  2MC5 A;  5A2Q C;  2DSY A;  2EPC A;  2K7I A;  2EOH A;  2M9A A;  3VYX A;  2ADR A;  2YSO A;  1A1H A;  1UBD C;  1J26 A;  4JI2 E;  2L6M A;  2DGC A;  2LJU A;  2LUQ A;  3THN A;  5KL3 A;  1PKP A;  4KZS A;  4GKJ E;  1HR0 E;  2EN7 A;  3M99 B;  4LF9 E;  4JI1 E;  5AE2 A;  3BF2 A;  4JI5 E;  2E1M A;  2ENC A;  2EQ0 A;  2L92 A;  2WBU A;  4KHP E;  2EPZ A;  4DR5 E;  1ZAA C;  1QU6 A;  2L2M A;  4X66 E;  2KOU A;  2WZO A;  5KL4 A;  1DQ3 A;  1Z1B A;  2A25 A;  3FIG A;  2M7Q A;  4F9C B;  4NXM E;  3HXL A;  2MC6 A;  5IV8 B;  5F3W A;  1JK1 A;  2EWL A;  1EH8 A;  5AE3 A;  5AC4 A;  2NUG A;  4O24 A;  4R2D A;  2EE8 A;  2EMY A;  2RSI A;  1BB8 A;  1EH6 A;  2JOB A;  1SFE A;  2V89 A;  2YTI A;  2LMZ A;  2MKN A;  4BC9 A;  2V85 A;  2F4V E;  3EPL A;  2JWO A;  1HNW E;  4ZYD A;  2EMC A;  4FK5 C;  2MDG A;  5KL6 A;  1KYQ A;  1A1F A;  2JXP A;  2LRS A;  2L33 A;  2EPM X;  2YU8 A;  2YSP A;  3ADI A;  3L00 A;  4TUG A;  1EKZ A;  3F6H A;  2EMA A;  2G7H A;  4WYQ B;  2EOF A;  4BS9 A;  1GTK A;  2YRM A;  4X8W A;  2EML A;  4YHH E;  2EN8 A;  2LTR A;  4O43 A;  4NHR A;  4F9A B;  5A6B D;  1X3C A;  1N34 E;  2FGG A;  2RPC A;  1A1L A;  4OX9 E;  2DMY A;  2EPK X;  2YTG A;  2EM8 A;  2EN6 A;  2ELY A;  1A1K A;  2YWQ A;  4R2P A;  4M30 A;  4DV3 E;  4M9V C;  2ELZ A;  4N4R B;  2YTJ A;  4DR6 E;  2EOY A;  2WBT A;  3C4B A;  3THO B;  5T6J A;  2N8X A;  2YPN A;  1YSA C;  2L2K B;  1TF3 A;  4KWY A;  2L8T A;  1A1J A;  1XNR E;  2EPO A;  3BID A;  2EMK A;  4LF6 E;  1PJS A;  3KZZ A;  1YUJ A;  1J5E E;  4DR7 E;  3IWD A;  4B3S E;  2UXC E;  2EN1 A;  2EMG A;  4LF4 E;  2GPI A;  3T1Y E;  2E5L E;  4MLQ A;  2NA2 A;  3JAM C;  2EPU A;  1N3G A;  2YZT A;  3MSW A;  3J80 C;  3JU0 A;  2DLQ A;  1NEI A;  2N3G A;  3DF6 A;  2EM9 A;  2EMB A;  2RQL A;  5BR8 E;  4X65 E;  4DV2 E;  2N3H A;  5LL6 R;  2UUA E;  2L3C A;  3BGH A;  1IBL E;  2EM3 A;  2EOE A;  4LF7 E;  3VHT B;  1X49 A;  3VK6 A;  2EL6 A;  1X6F A;  4F54 A;  5LMN E;  4LF8 E;  2EN2 A;  3EPH A;  2BB8 A;  3EQ1 A;  2DLK A;  4DMI A;  1QNT A;  2YRH A;  1X47 A;  2V87 A;  5KL7 A;  5IWA E;  2HHH E;  3F6G A;  4IS1 C;  2DIX A;  3MHS C;  4DUZ E;  1N33 E;  2JOX A;  2L2N A;  2L3J A;  1T4O A;  4LFA E;  2EOR A;  2KHX A;  4RH8 A;  1DGC A;  2LTS A;  3C6M A;  4R2E A;  2HC5 A;  2EPN A;  1STU A;  1TF6 A;  2WBS A;  3EPK A;  2I9I A;  4L8N A;  1UHZ A;  4WPY A;  4LF5 E;  2VQF E;  4AQY E;  3JTZ A;  4LFC E;  3AUZ A;  2EQ3 A;  1KJK A;  2YTD A;  2YTQ A;  4X64 E;  1GQE A;  4LU9 A;  1RC7 A;  4RHB B;  3HPZ A;  2FTX B;  2EJ4 A;  2VRD A;  5AE1 A;  2EL4 A;  2EOI A;  3EPJ A;  1WXR A;  2EN4 A;  2YU5 A;  4B3M E;  3HPS A;  2YTP A;  1IMU A;  4DUY E;  4M2Z A;  1PJQ A;  2EMX A;  4WX9 A;  4WSP A;  2EPX A;  5LMU E;  2EZ6 A;  1G2D C;  4DV0 E;  4DR4 E;  1LLM C;  3J7A G;  2EOS A;  1MGT A;  2MKD A;  4JI7 E;  1YYO A;  2M4I A;  3ADG A;  3AV0 A;  2KON A;  4WXD A;  2HJJ A;  3DJW A;  2LCE A;  2EM7 A;  4LFB E;  2LV2 A;  4GKK E;  2EMF A;  1UIL A;  1XMQ E;  4YY3 E;  2H36 X;  2NAB A;  4R2R A;  4B3R E;  3H09 A;  2EPP A;  2UXB E;  4JYA E;  4HTG A;  2EOZ A;  3C4T A;  2EM5 A;  4F6N A;  4P78 A;  2IHR 1;  3BBG A;  4ZYG A;  4DR2 E;  2CSH A;  3LLH A;  1YPN A;  4JV5 E;  2B9D A;  1WHN A;  2V88 A;  1X6H A;  5LLQ A;  1SR9 A;  2EMH A;  1N32 E;  1MEY C;  2YTE A;  4O4K A;  1T39 A;  2EPR A;  1N36 E;  1X6E A;  2FV4 B;  3QG5 C;  2EMI A;  2EOQ A;  2B3T B;  4HEI A;  2VE7 C;  2CT1 A;  2EPL X;  4JI4 E;  2EQ1 A;  4O5G A;  4BHC A;  4F9B B;  1X5W A;  2RTX A;  4ZYH A;  3UK3 C;  5FLX C;  2LT7 A;  1ZU1 A;  2JP9 A;  4DR3 E;  4BMJ A;  3J81 C;  4DV5 E;  3C6K A;  1I94 E;  4DKK A;  1A1I A;  2EL5 A;  2YTF A;  3RMP A;  4F2J C;  1XMO E;  2EM4 A;  1XNQ E;  4JI0 E;  5CFF E;  3T1H E;  1PJT A;  4R8O A;  2EOO A;  2I13 A;  1IQO A;  2B7V A;  3IWB A;  4DR1 E;  2CTD A;  5A69 A;  1T38 A;  1IBM E;  2RSM A;  1ZR9 A;  4BHB A;  5IXM B;  5KL2 A;  4GEQ B;  1BBG A;  3IWC A;  4DV6 E;  1HNZ E;  1T4N A;  2Q8U A;  4DV1 E;  1AAY A;  1O0W A;  1RQ0 A;  2LO3 A;  2CPN A;  4X9J A;  1HNX E;  2JR1 A;  2BBG A;  1NCS A;  5A6A A;  5KL5 A;  5TSE A;  2WCC 3;  2EMZ A;  4ZYE A;  4X62 E;  4K0K E; 
#chains in the Genus database with same CATH homology
 1N3G A;  1IMU A;  1L4S A;  2YWQ A;  4HEI A;  2RQL A;  3TQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...