2YWQA

Crystal structure of thermus thermophilus protein y n-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
89
Chain Sequence
MNIYKLIGRNLEITDAIRDYVEKKLARLDRYQDGELMAKVVLSLAGKARAEIQVDLPGGLVRVEEEDADLYAAIDRAVDRLETQVKRFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords Ribosomal subunit interface protein
publication title Crystal structure of Thermus thermophilus Protein Y N-terminal domain
rcsb
source organism Thermus thermophilus
total genus 23
structure length 89
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 2ywqA00
3TQMA 2YWQA 2RQLA 1N3GA 4HEIA 1L4SA 1IMUA
chains in the Genus database with same CATH superfamily
2D9HA 1RMDA 2YSPA 2EM7A 2YZTA 5CFFE 4WXDA 1Z1BA 2R76A 3C6MA 3HTXA 1JK1A 2JYAA 3EPKA 4RH8A 1BB8A 1X49A 3HPZA 5A6BA 1UN6B 2GPIA 1T4LB 2EPXA 2V85A 5A2QC 2ENCA 1B69A 2YU5A 5KL5A 2L3JA 1NCSA 2ODRD 4B3RE 1GTKA 2L6MA 3TQMA 2GHFA 3T1YE 2EN4A 2EM9A 2LRSA 1G2DC 1L4SA 2EN3A 4DR6E 2EN8A 4P7DA 2EWLA 1KYQA 2L8TA 2EN6A 2EMXA 3OMLA 5TSEA 2CSHA 2MDRA 1N33E 2EP3A 2V87A 4B3ME 5AC5A 4X62E 4N4RB 3IWCA 2EMBA 2YTOA 2EPKX 2KOUA 1X6EA 1FJGE 2EE8A 1YYWA 1HNWE 5IT9C 1TF3A 1RC7A 4I8OA 2EM0A 4DR5E 2B3TB 2B7TA 3BIDA 1DGCA 3EPHA 4OX9E 1GQEA 4WFTA 3ADLA 1UILA 2M4IA 4X65E 5A6AA 2RTXA 1YYKA 2VQFE 1HNZE 1TN9A 4R2SA 2EM5A 4R2EA 2DRPA 1WJPA 1XNQE 2L92A 2EQ1A 2LTRA 1X47A 4BMJA 2UUBE 3UK3C 1X48A 2V8QB 1SFEA 2L2MA 4F9BB 4F6NA 2EN7A 3AUZA 2EL5A 2MC6A 3ZOQB 4LF5E 2WZOA 5A69A 2N3HA 2EPMX 4IJDA 1BBGA 2EN1A 4F54A 4GZNC 4JI5E 2JPAA 1MGTA 3T1HE 3ADGA 2FTXB 2HGHA 2GLIA 2F4VE 2LJHA 4R2AA 4WSPA 5KL4A 1T38A 2VQEE 1XNRE 3EQ1A 2E1MA 2YTEA 2EMFA 2CPNA 3LLHA 1GZ6A 2ELYA 2ZM6E 4LU9A 4DV0E 2EPZA 2EMKA 1EKZA 4R2QA 4JI7E 2YU8A 1PJSA 4LTYA 2I9IA 3IWDA 3RMPA 2L2NA 4DR1E 2EPLX 2JXPA 2EOXA 2MKNA 4Q35B 2EZ6A 1MEYC 1ZAAC 3KZYA 2NUEA 1IBKE 4X66E 2G7HA 1KJKA 1A1GA 2DLQA 3IWBA 2UXDE 4JV5E 1YPNA 3AV0A 1YUJA 4M2ZA 4JI2E 2EMGA 3L00A 2EOEA 4DV4E 2BBGA 2YWQA 2J7JA 2EQ3A 2LJUA 2FV4B 2B9DA 3KWRA 2LUPB 2UUAE 2K4VA 2EMAA 5AE3A 2BB8A 4JI6E 1PJQA 5KL6A 4R2DA 3C6KA 4O43A 5LMUE 1YZ9A 2RSMA 4ZYHA 2UU9E 2EOFA 2ENHA 2H36X 2EPAA 1X5WA 4DMIA 4JI0E 1ZR9A 2EMCA 3DJWA 2A25A 4M9VC 3EPLA 1A1LA 3MHHC 4WYQB 1O0WA 1EH8A 1YYOA 2R1FA 3THNA 5IV8B 5AASA 4F6MA 4O5GA 1DI2A 3BF2A 2YTIA 2EN2A 2EOYA 3VK6A 4MLVA 2ENAA 2LE2A 2E5LE 2FGGA 1ZBTA 2EMYA 5T6JA 1FKAE 1AH5A 4DV5E 1N34E 4FK5C 3JAMC 4DR4E 4NXNE 2YTNA 5FLXC 1T4NA 1JK2A 1NEIA 5A6BD 2L2KB 2LO3A 1STUA 2MKDA 1T4OA 2MDGA 4F9AB 4J8ZA 2RS7A 2YTFA 4R03A 3C4BA 3J80C 4IS1C 4RHBB 4Q28A 2LTSA 1X6HA 2EQ0A 1XMOE 1BBOA 3H09A 2YTDA 4YHHE 4MLQA 2EPNA 3MHSC 1YSAC 4F2JC 4B3TE 5AE1A 2YRMA 2EPPA 2YTPA 3C4TA 4DV1E 5F3WA 2EPOA 1HNXE 5KL2A 4DR7E 2EPRA 2N8XA 2VF1A 2DMYA 2UXBE 4X64E 4ZYEA 2ELZA 1DQ3A 1IBME 1J26A 2EPCA 2K7IA 1HR0E 2YRKA 2CT1A 2RS6A 2EMLA 4DKKA 2UUCE 2NA2A 4BBYA 5KL3A 3QG5C 2EORA 2L33A 4NZVA 4DV2E 1A1KA 4O24A 4M30A 4X9JA 1N32E 2WCC3 2V89A 2MC5A 4KZSA 2JY9A 2V86A 2EOOA 5LMNE 2WBUA 1WHQA 3P1XA 3ECRA 2RPCA 3LMLA 2B7VA 4JI4E 2JR1A 2DLKA 2EL6A 2EOSA 4BC7A 4HEIA 1A1FA 1EH7A 4LF9E 2LT7A 2Q8UA 1YUIA 2DIXA 4R2PA 1PKPA 1G2FC 2LBSB 1UBDC 2LMZA 4JYAE 3DF6A 1AAYA 2YSOA 4GKJE 2EM4A 1XMQE 1WRJA 3ADIA 1N3GA 4R2CA 4GKKE 3M99B 2L3CA 2JWOA 4P78A 4LF7E 2WBTA 5BR8E 3BBGA 3HPSA 1WHNA 2WBSA 1TF6A 2EOMA 2V83A 3J7Yp 2EMHA 1ZBQA 3HXLA 4TUGA 2EMIA 4DUYE 1X6FA 5A6JA 5DNYA 1IBLE 3HQ1A 1PDAA 4DR2E 4DUZE 4LF8E 4BS9A 2EM3A 2YTGA 3OTOE 2KONA 1WXRA 2EM8A 4K0KE 4WSGA 1N36E 1QNTA 2UXCE 2HC5A 5ADZA 2DB2A 2EMWA 1T39A 2HJJA 2DMIA 2YT4A 2N3GA 2EPUA 2LVHA 4YY3E 4LFAE 4WPYA 2NUFA 4BC9A 2RSIA 1RQ0A 3MSWA 4M0VA 5IWAE 2YPNA 2EOQA 2YTJA 2DGCA 3EPJA 4WX9A 5AC4A 4R8OA 1UHZA 4LFBE 2JVAA 2F8BA 3J7AG 2EM2A 2M1SA 2ODRC 5KL7A 2KHXA 2JP9A 1IQSA 5LLQA 2LV2A 1PJTA 1P47A 3J81C 4GEQB 2M7QA 4KHPE 1QU6A 5AE2A 3JU0A 1J5EE 4JI3E 4KWYA 3F6GA 2IHR1 3VYYA 1I94E 2RQLA 2EM6A 2HHHE 2EOIA 4TUIA 4ZYDA 4JI1E 1F2IG 4AQYE 1YFHA 5A6KA 2YRHA 4DV7E 4R2RA 2M9AA 2EOJA 4L5NC 4DV6E 4DR3E 4L8NA 3VHTB 4O4KA 5IXMB 4NHRA 4NXME 1SR9A 2EOHA 4WXCA 3VYXA 1IMUA 4BCAA 4LF6E 2YTQA 3BGHA 2JOBA 2NABA 1ZU1A 2NUGA 2I13A 4JI8E 4BHBA 3FIGA 2DSYA 2ADRA 4DV3E 1A1JA 2EJ4A 2V88A 4ZYGA 1A1IA 2CTDA 5LL6R 2EOZA 2VE7C 4F9CB 2E72A 4LF4E 4HTGA 3ADJA 3THOB 4OOGC 2PRTA 4LFCE 2EL4A 1EH6A 2LUQA 3JTZA 2EMZA 2JOXA 1X3CA 4BHCA 4X8WA 2VRDA 1A1HA 1LLMC 3KZZA 3F6HA 3K6QA 4B3SE 2LCEA 1IQOA
chains in the Genus database with same CATH topology
3TQMA 2YWQA 2RQLA 1N3GA 4HEIA 1L4SA 1IMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQM A;  2YWQ A;  2RQL A;  1N3G A;  4HEI A;  1L4S A;  1IMU A; 
#chains in the Genus database with same CATH topology
 2D9H A;  1RMD A;  2YSP A;  2EM7 A;  2YZT A;  5CFF E;  4WXD A;  1Z1B A;  2R76 A;  3C6M A;  3HTX A;  1JK1 A;  2JYA A;  3EPK A;  4RH8 A;  1BB8 A;  1X49 A;  3HPZ A;  5A6B A;  1UN6 B;  2GPI A;  1T4L B;  2EPX A;  2V85 A;  5A2Q C;  2ENC A;  1B69 A;  2YU5 A;  5KL5 A;  2L3J A;  1NCS A;  2ODR D;  4B3R E;  1GTK A;  2L6M A;  3TQM A;  2GHF A;  3T1Y E;  2EN4 A;  2EM9 A;  2LRS A;  1G2D C;  1L4S A;  2EN3 A;  4DR6 E;  2EN8 A;  4P7D A;  2EWL A;  1KYQ A;  2L8T A;  2EN6 A;  2EMX A;  3OML A;  5TSE A;  2CSH A;  2MDR A;  1N33 E;  2EP3 A;  2V87 A;  4B3M E;  5AC5 A;  4X62 E;  4N4R B;  3IWC A;  2EMB A;  2YTO A;  2EPK X;  2KOU A;  1X6E A;  1FJG E;  2EE8 A;  1YYW A;  1HNW E;  5IT9 C;  1TF3 A;  1RC7 A;  4I8O A;  2EM0 A;  4DR5 E;  2B3T B;  2B7T A;  3BID A;  1DGC A;  3EPH A;  4OX9 E;  1GQE A;  4WFT A;  3ADL A;  1UIL A;  2M4I A;  4X65 E;  5A6A A;  2RTX A;  1YYK A;  2VQF E;  1HNZ E;  1TN9 A;  4R2S A;  2EM5 A;  4R2E A;  2DRP A;  1WJP A;  1XNQ E;  2L92 A;  2EQ1 A;  2LTR A;  1X47 A;  4BMJ A;  2UUB E;  3UK3 C;  1X48 A;  2V8Q B;  1SFE A;  2L2M A;  4F9B B;  4F6N A;  2EN7 A;  3AUZ A;  2EL5 A;  2MC6 A;  3ZOQ B;  4LF5 E;  2WZO A;  5A69 A;  2N3H A;  2EPM X;  4IJD A;  1BBG A;  2EN1 A;  4F54 A;  4GZN C;  4JI5 E;  2JPA A;  1MGT A;  3T1H E;  3ADG A;  2FTX B;  2HGH A;  2GLI A;  2F4V E;  2LJH A;  4R2A A;  4WSP A;  5KL4 A;  1T38 A;  2VQE E;  1XNR E;  3EQ1 A;  2E1M A;  2YTE A;  2EMF A;  2CPN A;  3LLH A;  1GZ6 A;  2ELY A;  2ZM6 E;  4LU9 A;  4DV0 E;  2EPZ A;  2EMK A;  1EKZ A;  4R2Q A;  4JI7 E;  2YU8 A;  1PJS A;  4LTY A;  2I9I A;  3IWD A;  3RMP A;  2L2N A;  4DR1 E;  2EPL X;  2JXP A;  2EOX A;  2MKN A;  4Q35 B;  2EZ6 A;  1MEY C;  1ZAA C;  3KZY A;  2NUE A;  1IBK E;  4X66 E;  2G7H A;  1KJK A;  1A1G A;  2DLQ A;  3IWB A;  2UXD E;  4JV5 E;  1YPN A;  3AV0 A;  1YUJ A;  4M2Z A;  4JI2 E;  2EMG A;  3L00 A;  2EOE A;  4DV4 E;  2BBG A;  2YWQ A;  2J7J A;  2EQ3 A;  2LJU A;  2FV4 B;  2B9D A;  3KWR A;  2LUP B;  2UUA E;  2K4V A;  2EMA A;  5AE3 A;  2BB8 A;  4JI6 E;  1PJQ A;  5KL6 A;  4R2D A;  3C6K A;  4O43 A;  5LMU E;  1YZ9 A;  2RSM A;  4ZYH A;  2UU9 E;  2EOF A;  2ENH A;  2H36 X;  2EPA A;  1X5W A;  4DMI A;  4JI0 E;  1ZR9 A;  2EMC A;  3DJW A;  2A25 A;  4M9V C;  3EPL A;  1A1L A;  3MHH C;  4WYQ B;  1O0W A;  1EH8 A;  1YYO A;  2R1F A;  3THN A;  5IV8 B;  5AAS A;  4F6M A;  4O5G A;  1DI2 A;  3BF2 A;  2YTI A;  2EN2 A;  2EOY A;  3VK6 A;  4MLV A;  2ENA A;  2LE2 A;  2E5L E;  2FGG A;  1ZBT A;  2EMY A;  5T6J A;  1FKA E;  1AH5 A;  4DV5 E;  1N34 E;  4FK5 C;  3JAM C;  4DR4 E;  4NXN E;  2YTN A;  5FLX C;  1T4N A;  1JK2 A;  1NEI A;  5A6B D;  2L2K B;  2LO3 A;  1STU A;  2MKD A;  1T4O A;  2MDG A;  4F9A B;  4J8Z A;  2RS7 A;  2YTF A;  4R03 A;  3C4B A;  3J80 C;  4IS1 C;  4RHB B;  4Q28 A;  2LTS A;  1X6H A;  2EQ0 A;  1XMO E;  1BBO A;  3H09 A;  2YTD A;  4YHH E;  4MLQ A;  2EPN A;  3MHS C;  1YSA C;  4F2J C;  4B3T E;  5AE1 A;  2YRM A;  2EPP A;  2YTP A;  3C4T A;  4DV1 E;  5F3W A;  2EPO A;  1HNX E;  5KL2 A;  4DR7 E;  2EPR A;  2N8X A;  2VF1 A;  2DMY A;  2UXB E;  4X64 E;  4ZYE A;  2ELZ A;  1DQ3 A;  1IBM E;  1J26 A;  2EPC A;  2K7I A;  1HR0 E;  2YRK A;  2CT1 A;  2RS6 A;  2EML A;  4DKK A;  2UUC E;  2NA2 A;  4BBY A;  5KL3 A;  3QG5 C;  2EOR A;  2L33 A;  4NZV A;  4DV2 E;  1A1K A;  4O24 A;  4M30 A;  4X9J A;  1N32 E;  2WCC 3;  2V89 A;  2MC5 A;  4KZS A;  2JY9 A;  2V86 A;  2EOO A;  5LMN E;  2WBU A;  1WHQ A;  3P1X A;  3ECR A;  2RPC A;  3LML A;  2B7V A;  4JI4 E;  2JR1 A;  2DLK A;  2EL6 A;  2EOS A;  4BC7 A;  4HEI A;  1A1F A;  1EH7 A;  4LF9 E;  2LT7 A;  2Q8U A;  1YUI A;  2DIX A;  4R2P A;  1PKP A;  1G2F C;  2LBS B;  1UBD C;  2LMZ A;  4JYA E;  3DF6 A;  1AAY A;  2YSO A;  4GKJ E;  2EM4 A;  1XMQ E;  1WRJ A;  3ADI A;  1N3G A;  4R2C A;  4GKK E;  3M99 B;  2L3C A;  2JWO A;  4P78 A;  4LF7 E;  2WBT A;  5BR8 E;  3BBG A;  3HPS A;  1WHN A;  2WBS A;  1TF6 A;  2EOM A;  2V83 A;  3J7Y p;  2EMH A;  1ZBQ A;  3HXL A;  4TUG A;  2EMI A;  4DUY E;  1X6F A;  5A6J A;  5DNY A;  1IBL E;  3HQ1 A;  1PDA A;  4DR2 E;  4DUZ E;  4LF8 E;  4BS9 A;  2EM3 A;  2YTG A;  3OTO E;  2KON A;  1WXR A;  2EM8 A;  4K0K E;  4WSG A;  1N36 E;  1QNT A;  2UXC E;  2HC5 A;  5ADZ A;  2DB2 A;  2EMW A;  1T39 A;  2HJJ A;  2DMI A;  2YT4 A;  2N3G A;  2EPU A;  2LVH A;  4YY3 E;  4LFA E;  4WPY A;  2NUF A;  4BC9 A;  2RSI A;  1RQ0 A;  3MSW A;  4M0V A;  5IWA E;  2YPN A;  2EOQ A;  2YTJ A;  2DGC A;  3EPJ A;  4WX9 A;  5AC4 A;  4R8O A;  1UHZ A;  4LFB E;  2JVA A;  2F8B A;  3J7A G;  2EM2 A;  2M1S A;  2ODR C;  5KL7 A;  2KHX A;  2JP9 A;  1IQS A;  5LLQ A;  2LV2 A;  1PJT A;  1P47 A;  3J81 C;  4GEQ B;  2M7Q A;  4KHP E;  1QU6 A;  5AE2 A;  3JU0 A;  1J5E E;  4JI3 E;  4KWY A;  3F6G A;  2IHR 1;  3VYY A;  1I94 E;  2RQL A;  2EM6 A;  2HHH E;  2EOI A;  4TUI A;  4ZYD A;  4JI1 E;  1F2I G;  4AQY E;  1YFH A;  5A6K A;  2YRH A;  4DV7 E;  4R2R A;  2M9A A;  2EOJ A;  4L5N C;  4DV6 E;  4DR3 E;  4L8N A;  3VHT B;  4O4K A;  5IXM B;  4NHR A;  4NXM E;  1SR9 A;  2EOH A;  4WXC A;  3VYX A;  1IMU A;  4BCA A;  4LF6 E;  2YTQ A;  3BGH A;  2JOB A;  2NAB A;  1ZU1 A;  2NUG A;  2I13 A;  4JI8 E;  4BHB A;  3FIG A;  2DSY A;  2ADR A;  4DV3 E;  1A1J A;  2EJ4 A;  2V88 A;  4ZYG A;  1A1I A;  2CTD A;  5LL6 R;  2EOZ A;  2VE7 C;  4F9C B;  2E72 A;  4LF4 E;  4HTG A;  3ADJ A;  3THO B;  4OOG C;  2PRT A;  4LFC E;  2EL4 A;  1EH6 A;  2LUQ A;  3JTZ A;  2EMZ A;  2JOX A;  1X3C A;  4BHC A;  4X8W A;  2VRD A;  1A1H A;  1LLM C;  3KZZ A;  3F6H A;  3K6Q A;  4B3S E;  2LCE A;  1IQO A; 
#chains in the Genus database with same CATH homology
 3TQM A;  2YWQ A;  2RQL A;  1N3G A;  4HEI A;  1L4S A;  1IMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...