2YWQA

Crystal structure of thermus thermophilus protein y n-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
89
Chain Sequence
MNIYKLIGRNLEITDAIRDYVEKKLARLDRYQDGELMAKVVLSLAGKARAEIQVDLPGGLVRVEEEDADLYAAIDRAVDRLETQVKRFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal subunit interface protein
publication title Crystal structure of Thermus thermophilus Protein Y N-terminal domain
rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 23
structure length 89
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 2ywqA00
2YWQA 1N3GA 4HEIA 2RQLA 1L4SA 3TQMA 1IMUA
chains in the Genus database with same CATH superfamily
2F8BA 3C4TA 1BBOA 4DV3E 2EPLX 4ZYHA 2EM7A 2EPKX 2NUFA 1N33E 4B3TE 1A1KA 2DLKA 2VQEE 2ZM6E 2BB8A 1XMQE 2K7IA 2JVAA 2EM0A 1G2DC 3MHSC 4IJDA 4LFBE 2V86A 5F3WA 5AC5A 3HPSA 1YZ9A 2EPOA 3HQ1A 2EMKA 4R2SA 2LCEA 1N3GA 2EMXA 4R2CA 1TF3A 2RTXA 1AH5A 2JPAA 4L5NC 4WXDA 2EMBA 4BC7A 3EPKA 1HNWE 2EMWA 2LE2A 4KZSA 1ZBTA 2WBUA 4NXME 1NCSA 2N8XA 4MLQA 3F6HA 2EL5A 3QG5C 5A6KA 4B3ME 2YRKA 4JI0E 1XNRE 2EPPA 2K4VA 5AE2A 5IXMB 1WHNA 4F54A 2MKNA 2WZOA 2B3TB 2ELYA 2UXCE 4AQYE 1DQ3A 4WXCA 4ZYGA 5A6JA 2EZ6A 2YTIA 4X66E 4JI4E 2EN2A 5AASA 1XMOE 1IBKE 1B69A 1UN6B 3UK3C 2DMIA 1STUA 5AE3A 2YRHA 5IWAE 2EMLA 4BC9A 5A6BA 3DJWA 2M4IA 4DV0E 3IWDA 4N4RB 2EMCA 4MLVA 2UU9E 5LMNE 2Q8UA 3ADIA 1P47A 1FJGE 2RS6A 4M30A 2EN3A 2DB2A 3K6QA 3BBGA 1HR0E 4P78A 2B9DA 1RMDA 2HJJA 3BIDA 2LMZA 1GQEA 2L33A 4LU9A 2E5LE 1IQOA 3AUZA 5IT9C 3ADJA 2EOMA 1YUIA 4WFTA 4L8NA 2JP9A 2E72A 2EN4A 3FIGA 4WX9A 2EOHA 3H09A 1J5EE 5CFFE 1AAYA 1IMUA 4DR7E 4HEIA 3OMLA 3BGHA 2JY9A 5ADZA 1L4SA 4LF5E 2LJUA 4NZVA 2YTDA 1DGCA 4F9CB 4YHHE 3BF2A 3EQ1A 2EORA 1G2FC 1A1HA 2EM2A 2YTGA 2LV2A 1EH7A 2BBGA 2RS7A 2IHR1 4J8ZA 4BHCA 1UILA 1EKZA 2LRSA 4LF9E 2B7VA 3J7AG 2CTDA 2L8TA 4X64E 2LJHA 5TSEA 4DR3E 2YTOA 2EN6A 4DUYE 2WBTA 2LTRA 1UBDC 2UXDE 1YFHA 4RH8A 2F4VE 2N3GA 4OX9E 1UHZA 2H36X 4M0VA 2ELZA 3JAMC 2VQFE 2EOEA 4HTGA 5KL5A 5BR8E 2EPUA 1SR9A 2EMIA 3KZZA 3THOB 1PKPA 1N32E 3EPJA 2HC5A 1YYOA 3VYXA 2V89A 2YRMA 1YUJA 4KWYA 2YSPA 5T6JA 1GZ6A 4WSGA 1QNTA 1X6FA 1DI2A 2MDRA 1ZAAC 2GPIA 2EPAA 4DR5E 4GEQB 3MHHC 2EPCA 4M9VC 1XNQE 4JV5E 4O5GA 4JI8E 2EN7A 4LF7E 3JTZA 3TQMA 4F6MA 2ENCA 2L2KB 1J26A 2M1SA 2EWLA 2NABA 2J7JA 2VE7C 1ZBQA 5KL2A 2UXBE 4Q28A 2HHHE 2I9IA 1WHQA 3VK6A 2LUPB 3ADGA 4R2RA 5LMUE 4DR2E 3VHTB 2YU8A 3LLHA 2EOYA 4DV5E 2EQ3A 4I8OA 3EPHA 2KONA 2RPCA 2LT7A 1KYQA 1EH6A 2FGGA 2VRDA 2YTFA 2UUCE 4R2EA 1T38A 2NUEA 2LBSB 2PRTA 4Q35B 2DGCA 4F9AB 4LF4E 1BB8A 1TF6A 2WBSA 2EM5A 3P1XA 4K0KE 2CSHA 3HPZA 2V83A 5A2QC 4LF6E 4JI1E 2V8QB 2EOOA 2L2NA 4WPYA 3MSWA 2CPNA 5A69A 3J81C 3EPLA 1HNZE 4BCAA 2GLIA 4F2JC 4LFCE 4GKKE 3C6MA 1MEYC 1A1JA 4JYAE 2EOIA 1EH8A 2EMYA 2EPNA 1RC7A 2EM3A 3T1YE 1A1FA 4BMJA 2KOUA 3ZOQB 4GZNC 2JR1A 2D9HA 2M7QA 2YZTA 4O24A 1X48A 2DLQA 2G7HA 3JU0A 2EOJA 5KL7A 1X5WA 2EL6A 1IBME 1PDAA 5FLXC 3C4BA 2DSYA 2NA2A 2YWQA 1X6HA 1ZR9A 3AV0A 4F6NA 2L6MA 3KZYA 4JI6E 1T4LB 1TN9A 5KL3A 2L92A 2VF1A 4GKJE 1JK1A 1BBGA 2EPXA 1NEIA 4B3SE 4R2DA 1YPNA 1PJQA 4NXNE 4FK5C 4DV7E 2FV4B 2WCC3 1YYWA 3HXLA 1ZU1A 4R03A 4ZYEA 5DNYA 2L2MA 1Z1BA 4O4KA 2EOSA 2DRPA 4B3RE 4O43A 1FKAE 2UUBE 2R76A 1I94E 4DV2E 3OTOE 2YTPA 4X62E 2V85A 4BHBA 2V88A 2YTQA 1WXRA 2JOXA 3F6GA 2CT1A 4JI7E 2YSOA 2MC6A 3VYYA 4R8OA 5KL6A 3RMPA 2L3CA 3THNA 2EPZA 2I13A 1T4OA 4DR6E 2EQ1A 2E1MA 4R2QA 1WJPA 2LO3A 5A6AA 2YTNA 2A25A 4IS1C 4DR4E 1X3CA 4R2AA 4DV4E 2EOZA 2M9AA 1IQSA 2EM8A 1T4NA 3IWBA 5LL6R 2EJ4A 2JOBA 2EPMX 1LLMC 2EOFA 3M99B 1WRJA 1PJTA 1X47A 1T39A 4X65E 2EN8A 2B7TA 2EMGA 2EL4A 2JYAA 3DF6A 2YPNA 4DR1E 2RSIA 2EPRA 1RQ0A 4DKKA 1IBLE 2ENAA 4NHRA 2RSMA 5IV8B 2MDGA 2KHXA 1YSAC 1QU6A 3J7Yp 2DMYA 4F9BB 3T1HE 1YYKA 1JK2A 3HTXA 1PJSA 2EOXA 2LTSA 1X6EA 3IWCA 2V87A 4OOGC 4P7DA 2LUQA 1A1IA 4BBYA 2EM9A 1SFEA 2EN1A 1N36E 4YY3E 2LVHA 2YTJA 2N3HA 2EMHA 5AC4A 2EMZA 2EMFA 2R1FA 4WYQB 5AE1A 2ENHA 4X8WA 5A6BD 4TUIA 2JWOA 2YU5A 1GTKA 4KHPE 2YTEA 2ODRD 3KWRA 1F2IG 3ECRA 4DV6E 2YT4A 3L00A 2GHFA 2EQ0A 1O0WA 5KL4A 1A1GA 1HNXE 4X9JA 2EM6A 2ODRC 4LTYA 2JXPA 4BS9A 2EP3A 2UUAE 2ADRA 4LFAE 1MGTA 1A1LA 2FTXB 2RQLA 2EMAA 1KJKA 4DMIA 4M2ZA 3ADLA 2MKDA 2DIXA 1N34E 2EE8A 4JI2E 3J80C 4R2PA 4TUGA 2HGHA 2MC5A 2EOQA 4JI5E 4LF8E 4JI3E 2L3JA 4WSPA 3C6KA 4RHBB 4ZYDA 1X49A 2EM4A 3LMLA 2NUGA 4DV1E 5LLQA 4DUZE
chains in the Genus database with same CATH topology
2YWQA 1N3GA 4HEIA 2RQLA 1L4SA 3TQMA 1IMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YWQ A;  1N3G A;  4HEI A;  2RQL A;  1L4S A;  3TQM A;  1IMU A; 
#chains in the Genus database with same CATH topology
 2F8B A;  3C4T A;  1BBO A;  4DV3 E;  2EPL X;  4ZYH A;  2EM7 A;  2EPK X;  2NUF A;  1N33 E;  4B3T E;  1A1K A;  2DLK A;  2VQE E;  2ZM6 E;  2BB8 A;  1XMQ E;  2K7I A;  2JVA A;  2EM0 A;  1G2D C;  3MHS C;  4IJD A;  4LFB E;  2V86 A;  5F3W A;  5AC5 A;  3HPS A;  1YZ9 A;  2EPO A;  3HQ1 A;  2EMK A;  4R2S A;  2LCE A;  1N3G A;  2EMX A;  4R2C A;  1TF3 A;  2RTX A;  1AH5 A;  2JPA A;  4L5N C;  4WXD A;  2EMB A;  4BC7 A;  3EPK A;  1HNW E;  2EMW A;  2LE2 A;  4KZS A;  1ZBT A;  2WBU A;  4NXM E;  1NCS A;  2N8X A;  4MLQ A;  3F6H A;  2EL5 A;  3QG5 C;  5A6K A;  4B3M E;  2YRK A;  4JI0 E;  1XNR E;  2EPP A;  2K4V A;  5AE2 A;  5IXM B;  1WHN A;  4F54 A;  2MKN A;  2WZO A;  2B3T B;  2ELY A;  2UXC E;  4AQY E;  1DQ3 A;  4WXC A;  4ZYG A;  5A6J A;  2EZ6 A;  2YTI A;  4X66 E;  4JI4 E;  2EN2 A;  5AAS A;  1XMO E;  1IBK E;  1B69 A;  1UN6 B;  3UK3 C;  2DMI A;  1STU A;  5AE3 A;  2YRH A;  5IWA E;  2EML A;  4BC9 A;  5A6B A;  3DJW A;  2M4I A;  4DV0 E;  3IWD A;  4N4R B;  2EMC A;  4MLV A;  2UU9 E;  5LMN E;  2Q8U A;  3ADI A;  1P47 A;  1FJG E;  2RS6 A;  4M30 A;  2EN3 A;  2DB2 A;  3K6Q A;  3BBG A;  1HR0 E;  4P78 A;  2B9D A;  1RMD A;  2HJJ A;  3BID A;  2LMZ A;  1GQE A;  2L33 A;  4LU9 A;  2E5L E;  1IQO A;  3AUZ A;  5IT9 C;  3ADJ A;  2EOM A;  1YUI A;  4WFT A;  4L8N A;  2JP9 A;  2E72 A;  2EN4 A;  3FIG A;  4WX9 A;  2EOH A;  3H09 A;  1J5E E;  5CFF E;  1AAY A;  1IMU A;  4DR7 E;  4HEI A;  3OML A;  3BGH A;  2JY9 A;  5ADZ A;  1L4S A;  4LF5 E;  2LJU A;  4NZV A;  2YTD A;  1DGC A;  4F9C B;  4YHH E;  3BF2 A;  3EQ1 A;  2EOR A;  1G2F C;  1A1H A;  2EM2 A;  2YTG A;  2LV2 A;  1EH7 A;  2BBG A;  2RS7 A;  2IHR 1;  4J8Z A;  4BHC A;  1UIL A;  1EKZ A;  2LRS A;  4LF9 E;  2B7V A;  3J7A G;  2CTD A;  2L8T A;  4X64 E;  2LJH A;  5TSE A;  4DR3 E;  2YTO A;  2EN6 A;  4DUY E;  2WBT A;  2LTR A;  1UBD C;  2UXD E;  1YFH A;  4RH8 A;  2F4V E;  2N3G A;  4OX9 E;  1UHZ A;  2H36 X;  4M0V A;  2ELZ A;  3JAM C;  2VQF E;  2EOE A;  4HTG A;  5KL5 A;  5BR8 E;  2EPU A;  1SR9 A;  2EMI A;  3KZZ A;  3THO B;  1PKP A;  1N32 E;  3EPJ A;  2HC5 A;  1YYO A;  3VYX A;  2V89 A;  2YRM A;  1YUJ A;  4KWY A;  2YSP A;  5T6J A;  1GZ6 A;  4WSG A;  1QNT A;  1X6F A;  1DI2 A;  2MDR A;  1ZAA C;  2GPI A;  2EPA A;  4DR5 E;  4GEQ B;  3MHH C;  2EPC A;  4M9V C;  1XNQ E;  4JV5 E;  4O5G A;  4JI8 E;  2EN7 A;  4LF7 E;  3JTZ A;  3TQM A;  4F6M A;  2ENC A;  2L2K B;  1J26 A;  2M1S A;  2EWL A;  2NAB A;  2J7J A;  2VE7 C;  1ZBQ A;  5KL2 A;  2UXB E;  4Q28 A;  2HHH E;  2I9I A;  1WHQ A;  3VK6 A;  2LUP B;  3ADG A;  4R2R A;  5LMU E;  4DR2 E;  3VHT B;  2YU8 A;  3LLH A;  2EOY A;  4DV5 E;  2EQ3 A;  4I8O A;  3EPH A;  2KON A;  2RPC A;  2LT7 A;  1KYQ A;  1EH6 A;  2FGG A;  2VRD A;  2YTF A;  2UUC E;  4R2E A;  1T38 A;  2NUE A;  2LBS B;  2PRT A;  4Q35 B;  2DGC A;  4F9A B;  4LF4 E;  1BB8 A;  1TF6 A;  2WBS A;  2EM5 A;  3P1X A;  4K0K E;  2CSH A;  3HPZ A;  2V83 A;  5A2Q C;  4LF6 E;  4JI1 E;  2V8Q B;  2EOO A;  2L2N A;  4WPY A;  3MSW A;  2CPN A;  5A69 A;  3J81 C;  3EPL A;  1HNZ E;  4BCA A;  2GLI A;  4F2J C;  4LFC E;  4GKK E;  3C6M A;  1MEY C;  1A1J A;  4JYA E;  2EOI A;  1EH8 A;  2EMY A;  2EPN A;  1RC7 A;  2EM3 A;  3T1Y E;  1A1F A;  4BMJ A;  2KOU A;  3ZOQ B;  4GZN C;  2JR1 A;  2D9H A;  2M7Q A;  2YZT A;  4O24 A;  1X48 A;  2DLQ A;  2G7H A;  3JU0 A;  2EOJ A;  5KL7 A;  1X5W A;  2EL6 A;  1IBM E;  1PDA A;  5FLX C;  3C4B A;  2DSY A;  2NA2 A;  2YWQ A;  1X6H A;  1ZR9 A;  3AV0 A;  4F6N A;  2L6M A;  3KZY A;  4JI6 E;  1T4L B;  1TN9 A;  5KL3 A;  2L92 A;  2VF1 A;  4GKJ E;  1JK1 A;  1BBG A;  2EPX A;  1NEI A;  4B3S E;  4R2D A;  1YPN A;  1PJQ A;  4NXN E;  4FK5 C;  4DV7 E;  2FV4 B;  2WCC 3;  1YYW A;  3HXL A;  1ZU1 A;  4R03 A;  4ZYE A;  5DNY A;  2L2M A;  1Z1B A;  4O4K A;  2EOS A;  2DRP A;  4B3R E;  4O43 A;  1FKA E;  2UUB E;  2R76 A;  1I94 E;  4DV2 E;  3OTO E;  2YTP A;  4X62 E;  2V85 A;  4BHB A;  2V88 A;  2YTQ A;  1WXR A;  2JOX A;  3F6G A;  2CT1 A;  4JI7 E;  2YSO A;  2MC6 A;  3VYY A;  4R8O A;  5KL6 A;  3RMP A;  2L3C A;  3THN A;  2EPZ A;  2I13 A;  1T4O A;  4DR6 E;  2EQ1 A;  2E1M A;  4R2Q A;  1WJP A;  2LO3 A;  5A6A A;  2YTN A;  2A25 A;  4IS1 C;  4DR4 E;  1X3C A;  4R2A A;  4DV4 E;  2EOZ A;  2M9A A;  1IQS A;  2EM8 A;  1T4N A;  3IWB A;  5LL6 R;  2EJ4 A;  2JOB A;  2EPM X;  1LLM C;  2EOF A;  3M99 B;  1WRJ A;  1PJT A;  1X47 A;  1T39 A;  4X65 E;  2EN8 A;  2B7T A;  2EMG A;  2EL4 A;  2JYA A;  3DF6 A;  2YPN A;  4DR1 E;  2RSI A;  2EPR A;  1RQ0 A;  4DKK A;  1IBL E;  2ENA A;  4NHR A;  2RSM A;  5IV8 B;  2MDG A;  2KHX A;  1YSA C;  1QU6 A;  3J7Y p;  2DMY A;  4F9B B;  3T1H E;  1YYK A;  1JK2 A;  3HTX A;  1PJS A;  2EOX A;  2LTS A;  1X6E A;  3IWC A;  2V87 A;  4OOG C;  4P7D A;  2LUQ A;  1A1I A;  4BBY A;  2EM9 A;  1SFE A;  2EN1 A;  1N36 E;  4YY3 E;  2LVH A;  2YTJ A;  2N3H A;  2EMH A;  5AC4 A;  2EMZ A;  2EMF A;  2R1F A;  4WYQ B;  5AE1 A;  2ENH A;  4X8W A;  5A6B D;  4TUI A;  2JWO A;  2YU5 A;  1GTK A;  4KHP E;  2YTE A;  2ODR D;  3KWR A;  1F2I G;  3ECR A;  4DV6 E;  2YT4 A;  3L00 A;  2GHF A;  2EQ0 A;  1O0W A;  5KL4 A;  1A1G A;  1HNX E;  4X9J A;  2EM6 A;  2ODR C;  4LTY A;  2JXP A;  4BS9 A;  2EP3 A;  2UUA E;  2ADR A;  4LFA E;  1MGT A;  1A1L A;  2FTX B;  2RQL A;  2EMA A;  1KJK A;  4DMI A;  4M2Z A;  3ADL A;  2MKD A;  2DIX A;  1N34 E;  2EE8 A;  4JI2 E;  3J80 C;  4R2P A;  4TUG A;  2HGH A;  2MC5 A;  2EOQ A;  4JI5 E;  4LF8 E;  4JI3 E;  2L3J A;  4WSP A;  3C6K A;  4RHB B;  4ZYD A;  1X49 A;  2EM4 A;  3LML A;  2NUG A;  4DV1 E;  5LLQ A;  4DUZ E; 
#chains in the Genus database with same CATH homology
 2YWQ A;  1N3G A;  4HEI A;  2RQL A;  1L4S A;  3TQM A;  1IMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...