2YWQA

Crystal structure of thermus thermophilus protein y n-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
89
Chain Sequence
MNIYKLIGRNLEITDAIRDYVEKKLARLDRYQDGELMAKVVLSLAGKARAEIQVDLPGGLVRVEEEDADLYAAIDRAVDRLETQVKRFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thermus thermophilus Protein Y N-terminal domain
rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords Ribosomal subunit interface protein
total genus 23
structure length 89
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 2ywqA00
2YWQA 3TQMA 1IMUA 1L4SA 4HEIA 1N3GA 2RQLA
chains in the Genus database with same CATH superfamily
2Q8UA 4IS1C 5LMNE 3EQ1A 5AC4A 2ENCA 2UUCE 3LLHA 2DMIA 2B7TA 1X48A 2GPIA 5IWAE 3BIDA 1GTKA 2NUGA 2UUBE 1GQEA 2FV4B 2EM2A 5A6AA 2YTPA 4LFBE 3C4BA 1PJTA 4X8WA 1BBOA 2EE8A 3F6GA 1STUA 2JP9A 1YUIA 2KONA 1EH6A 1O0WA 1UHZA 3LMLA 1A1LA 2UXBE 3MSWA 2YRKA 4N4RB 4DKKA 1TF3A 2YSOA 2VRDA 1NEIA 4NXNE 2L2NA 1UILA 4K0KE 2YTIA 2RS6A 2EOXA 2JVAA 3FIGA 2WBUA 1YYWA 4X9JA 3KZYA 4X65E 3AUZA 2F8BA 1PJSA 4ZYEA 2EP3A 4DR5E 3THOB 2JOXA 5AE2A 2YTNA 5IXMB 2DSYA 2MKNA 4ZYDA 2EQ0A 2WCC3 4OOGC 1WHQA 1NCSA 4LF4E 4KWYA 4DV3E 2EMZA 2EM6A 3P1XA 1FJGE 4R2QA 2JPAA 4YHHE 4WFTA 4WSPA 1T4OA 4DV5E 2UUAE 4LF9E 2DMYA 1WRJA 2YU5A 3ADGA 1IQOA 1TF6A 5KL4A 4BHBA 1A1FA 3K6QA 2ENHA 4DV2E 1FKAE 5A2QC 2A25A 2EMCA 1MEYC 2EMAA 2VF1A 1EKZA 2WZOA 2EM7A 4R8OA 2ELYA 2EMHA 2EMGA 2YTQA 2ZM6E 4TUGA 1G2FC 4F2JC 2ADRA 3EPKA 1QU6A 3ADJA 4BC9A 3F6HA 4JYAE 3C6KA 4L8NA 2DLKA 2RSIA 2HC5A 4DUZE 3J7AG 3M99B 2EPCA 2L3JA 4F6NA 5FLXC 1X6EA 2GLIA 4J8ZA 2R1FA 2EMWA 5A6JA 4M9VC 5A6BD 1GZ6A 2YTGA 2CTDA 2EMXA 4WPYA 2WBTA 1A1GA 2YTEA 2DB2A 1XNQE 1LLMC 1RMDA 4R2SA 4LFCE 4MLVA 5TSEA 4R2EA 2EN6A 2EL5A 4IJDA 1X5WA 1RQ0A 3JU0A 4WYQB 4JI6E 5IV8B 4YY3E 2L3CA 4LTYA 4O4KA 4KHPE 1A1KA 2LRSA 4X64E 2V86A 2EMFA 2PRTA 1X49A 2UXCE 5LLQA 1EH7A 4F6MA 3BBGA 2E5LE 1YZ9A 4B3TE 2EMYA 2L2KB 1T4NA 2EOSA 2V85A 2EM4A 4DV0E 5F3WA 4DV7E 2LBSB 2DRPA 4B3SE 2IHR1 1YYKA 4DR1E 2BB8A 5KL5A 3BF2A 2EM9A 4X62E 4BS9A 1J5EE 4R2CA 2JYAA 2EMIA 3H09A 4JI0E 3EPLA 1ZR9A 1WHNA 2LTRA 1N34E 2M4IA 2NA2A 4ZYHA 3MHSC 3VHTB 5ADZA 2NUFA 3THNA 1SFEA 4B3ME 4M2ZA 4BBYA 2VQFE 4RH8A 3ZOQB 4BC7A 1KJKA 2N8XA 2EM3A 5AE1A 4GZNC 2I9IA 4O43A 1ZBQA 1Z1BA 1PJQA 1AH5A 2J7JA 3JTZA 1ZU1A 2YTJA 3J7Yp 2YRHA 4BHCA 4I8OA 1HNXE 2DIXA 2LMZA 5BR8E 4NHRA 2EL4A 4JI2E 3J80C 2MC5A 4ZYGA 4F9AB 1N32E 1TN9A 4JV5E 1YFHA 5A69A 3BGHA 5LL6R 2LO3A 2M9AA 2YTOA 4NZVA 2EPMX 2EPLX 4NXME 5KL3A 1MGTA 2EMLA 2V83A 4DR3E 3VYYA 2BBGA 2YU8A 4GEQB 3EPHA 4JI7E 4R2AA 1JK2A 1A1IA 1JK1A 4LU9A 2UU9E 3MHHC 5IT9C 1T38A 2EMKA 2HHHE 4HEIA 3IWCA 3J81C 3EPJA 2YPNA 4DUYE 4F9CB 2EPOA 2R76A 2YRMA 2EQ1A 1T4LB 1KYQA 1IBME 2MC6A 1X6FA 2ELZA 1XMQE 2NABA 2EN2A 2EPRA 2EN3A 4DV4E 2EM0A 1J26A 2M1SA 2I13A 2EM5A 2V88A 2FTXB 2JXPA 1IBLE 2EPKX 2FGGA 1YPNA 2GHFA 2EN1A 4O5GA 2EOHA 2CT1A 4Q35B 5DNYA 1N33E 2JR1A 3KZZA 4WSGA 2B3TB 4R03A 4P78A 4LFAE 2EN7A 5T6JA 1WXRA 2EOJA 4M30A 3JAMC 2L2MA 1BB8A 2L6MA 4DV6E 4WXDA 4JI3E 1F2IG 2RSMA 3UK3C 3HTXA 3OTOE 1IMUA 2V8QB 2F4VE 2LVHA 1ZAAC 5KL6A 4DV1E 2HJJA 2D9HA 4DMIA 4FK5C 5A6BA 2YT4A 2YTDA 4X66E 3TQMA 1EH8A 4AQYE 1A1JA 4DR6E 4JI8E 2V87A 5AC5A 4JI5E 1IQSA 2KHXA 3C6MA 2JOBA 4F54A 1L4SA 2YSPA 5CFFE 4LF6E 3OMLA 2EOMA 2EJ4A 3ECRA 3C4TA 1DI2A 1N36E 2EM8A 2EORA 1X6HA 1X47A 2EZ6A 2YWQA 3DF6A 1B69A 3DJWA 1PKPA 2RQLA 3IWBA 4LF5E 4R2PA 2G7HA 1P47A 1HNZE 1UN6B 1DGCA 2JWOA 2LUPB 2RS7A 1BBGA 4HTGA 4KZSA 2MKDA 1YUJA 1YSAC 1XNRE 2EPZA 1T39A 2CSHA 4RHBB 5KL7A 1YYOA 3ADLA 4F9BB 2EWLA 2B7VA 2LT7A 2YZTA 1PDAA 4BCAA 1ZBTA 2LUQA 2E1MA 2ODRD 3HQ1A 4L5NC 3HXLA 2EQ3A 2EPXA 2E72A 2UXDE 3VYXA 2LTSA 4O24A 1QNTA 1DQ3A 2EPPA 2VE7C 4TUIA 2M7QA 2KOUA 2EPUA 2L92A 3L00A 2EOYA 4M0VA 4GKKE 3IWDA 2RPCA 2JY9A 2EN8A 2LJHA 4JI1E 4WX9A 2EOZA 1UBDC 2K4VA 3RMPA 2K7IA 2EOOA 5AASA 1AAYA 1N3GA 2EPAA 2EPNA 2LV2A 3T1YE 2DGCA 1X3CA 4R2DA 1HNWE 4WXCA 1WJPA 4JI4E 1IBKE 1A1HA 2EMBA 2H36X 4R2RA 2EN4A 4LF8E 4Q28A 4OX9E 1I94E 3HPZA 1RC7A 4DR7E 2N3HA 1G2DC 1SR9A 2LE2A 2EOQA 2L33A 5A6KA 4B3RE 3QG5C 4GKJE 2EOFA 2L8TA 2MDRA 2V89A 2EOEA 2N3GA 3VK6A 1HR0E 2HGHA 3ADIA 2CPNA 2MDGA 2EOIA 2ODRC 4BMJA 3AV0A 4MLQA 5LMUE 4DR4E 5AE3A 3T1HE 4LF7E 2DLQA 3HPSA 2YTFA 1XMOE 4DR2E 2B9DA 3KWRA 2RTXA 2LJUA 2EL6A 2VQEE 2ENAA 2WBSA 2NUEA 2LCEA 4P7DA 5KL2A
chains in the Genus database with same CATH topology
2YWQA 3TQMA 1IMUA 1L4SA 4HEIA 1N3GA 2RQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YWQ A;  3TQM A;  1IMU A;  1L4S A;  4HEI A;  1N3G A;  2RQL A; 
#chains in the Genus database with same CATH topology
 2Q8U A;  4IS1 C;  5LMN E;  3EQ1 A;  5AC4 A;  2ENC A;  2UUC E;  3LLH A;  2DMI A;  2B7T A;  1X48 A;  2GPI A;  5IWA E;  3BID A;  1GTK A;  2NUG A;  2UUB E;  1GQE A;  2FV4 B;  2EM2 A;  5A6A A;  2YTP A;  4LFB E;  3C4B A;  1PJT A;  4X8W A;  1BBO A;  2EE8 A;  3F6G A;  1STU A;  2JP9 A;  1YUI A;  2KON A;  1EH6 A;  1O0W A;  1UHZ A;  3LML A;  1A1L A;  2UXB E;  3MSW A;  2YRK A;  4N4R B;  4DKK A;  1TF3 A;  2YSO A;  2VRD A;  1NEI A;  4NXN E;  2L2N A;  1UIL A;  4K0K E;  2YTI A;  2RS6 A;  2EOX A;  2JVA A;  3FIG A;  2WBU A;  1YYW A;  4X9J A;  3KZY A;  4X65 E;  3AUZ A;  2F8B A;  1PJS A;  4ZYE A;  2EP3 A;  4DR5 E;  3THO B;  2JOX A;  5AE2 A;  2YTN A;  5IXM B;  2DSY A;  2MKN A;  4ZYD A;  2EQ0 A;  2WCC 3;  4OOG C;  1WHQ A;  1NCS A;  4LF4 E;  4KWY A;  4DV3 E;  2EMZ A;  2EM6 A;  3P1X A;  1FJG E;  4R2Q A;  2JPA A;  4YHH E;  4WFT A;  4WSP A;  1T4O A;  4DV5 E;  2UUA E;  4LF9 E;  2DMY A;  1WRJ A;  2YU5 A;  3ADG A;  1IQO A;  1TF6 A;  5KL4 A;  4BHB A;  1A1F A;  3K6Q A;  2ENH A;  4DV2 E;  1FKA E;  5A2Q C;  2A25 A;  2EMC A;  1MEY C;  2EMA A;  2VF1 A;  1EKZ A;  2WZO A;  2EM7 A;  4R8O A;  2ELY A;  2EMH A;  2EMG A;  2YTQ A;  2ZM6 E;  4TUG A;  1G2F C;  4F2J C;  2ADR A;  3EPK A;  1QU6 A;  3ADJ A;  4BC9 A;  3F6H A;  4JYA E;  3C6K A;  4L8N A;  2DLK A;  2RSI A;  2HC5 A;  4DUZ E;  3J7A G;  3M99 B;  2EPC A;  2L3J A;  4F6N A;  5FLX C;  1X6E A;  2GLI A;  4J8Z A;  2R1F A;  2EMW A;  5A6J A;  4M9V C;  5A6B D;  1GZ6 A;  2YTG A;  2CTD A;  2EMX A;  4WPY A;  2WBT A;  1A1G A;  2YTE A;  2DB2 A;  1XNQ E;  1LLM C;  1RMD A;  4R2S A;  4LFC E;  4MLV A;  5TSE A;  4R2E A;  2EN6 A;  2EL5 A;  4IJD A;  1X5W A;  1RQ0 A;  3JU0 A;  4WYQ B;  4JI6 E;  5IV8 B;  4YY3 E;  2L3C A;  4LTY A;  4O4K A;  4KHP E;  1A1K A;  2LRS A;  4X64 E;  2V86 A;  2EMF A;  2PRT A;  1X49 A;  2UXC E;  5LLQ A;  1EH7 A;  4F6M A;  3BBG A;  2E5L E;  1YZ9 A;  4B3T E;  2EMY A;  2L2K B;  1T4N A;  2EOS A;  2V85 A;  2EM4 A;  4DV0 E;  5F3W A;  4DV7 E;  2LBS B;  2DRP A;  4B3S E;  2IHR 1;  1YYK A;  4DR1 E;  2BB8 A;  5KL5 A;  3BF2 A;  2EM9 A;  4X62 E;  4BS9 A;  1J5E E;  4R2C A;  2JYA A;  2EMI A;  3H09 A;  4JI0 E;  3EPL A;  1ZR9 A;  1WHN A;  2LTR A;  1N34 E;  2M4I A;  2NA2 A;  4ZYH A;  3MHS C;  3VHT B;  5ADZ A;  2NUF A;  3THN A;  1SFE A;  4B3M E;  4M2Z A;  4BBY A;  2VQF E;  4RH8 A;  3ZOQ B;  4BC7 A;  1KJK A;  2N8X A;  2EM3 A;  5AE1 A;  4GZN C;  2I9I A;  4O43 A;  1ZBQ A;  1Z1B A;  1PJQ A;  1AH5 A;  2J7J A;  3JTZ A;  1ZU1 A;  2YTJ A;  3J7Y p;  2YRH A;  4BHC A;  4I8O A;  1HNX E;  2DIX A;  2LMZ A;  5BR8 E;  4NHR A;  2EL4 A;  4JI2 E;  3J80 C;  2MC5 A;  4ZYG A;  4F9A B;  1N32 E;  1TN9 A;  4JV5 E;  1YFH A;  5A69 A;  3BGH A;  5LL6 R;  2LO3 A;  2M9A A;  2YTO A;  4NZV A;  2EPM X;  2EPL X;  4NXM E;  5KL3 A;  1MGT A;  2EML A;  2V83 A;  4DR3 E;  3VYY A;  2BBG A;  2YU8 A;  4GEQ B;  3EPH A;  4JI7 E;  4R2A A;  1JK2 A;  1A1I A;  1JK1 A;  4LU9 A;  2UU9 E;  3MHH C;  5IT9 C;  1T38 A;  2EMK A;  2HHH E;  4HEI A;  3IWC A;  3J81 C;  3EPJ A;  2YPN A;  4DUY E;  4F9C B;  2EPO A;  2R76 A;  2YRM A;  2EQ1 A;  1T4L B;  1KYQ A;  1IBM E;  2MC6 A;  1X6F A;  2ELZ A;  1XMQ E;  2NAB A;  2EN2 A;  2EPR A;  2EN3 A;  4DV4 E;  2EM0 A;  1J26 A;  2M1S A;  2I13 A;  2EM5 A;  2V88 A;  2FTX B;  2JXP A;  1IBL E;  2EPK X;  2FGG A;  1YPN A;  2GHF A;  2EN1 A;  4O5G A;  2EOH A;  2CT1 A;  4Q35 B;  5DNY A;  1N33 E;  2JR1 A;  3KZZ A;  4WSG A;  2B3T B;  4R03 A;  4P78 A;  4LFA E;  2EN7 A;  5T6J A;  1WXR A;  2EOJ A;  4M30 A;  3JAM C;  2L2M A;  1BB8 A;  2L6M A;  4DV6 E;  4WXD A;  4JI3 E;  1F2I G;  2RSM A;  3UK3 C;  3HTX A;  3OTO E;  1IMU A;  2V8Q B;  2F4V E;  2LVH A;  1ZAA C;  5KL6 A;  4DV1 E;  2HJJ A;  2D9H A;  4DMI A;  4FK5 C;  5A6B A;  2YT4 A;  2YTD A;  4X66 E;  3TQM A;  1EH8 A;  4AQY E;  1A1J A;  4DR6 E;  4JI8 E;  2V87 A;  5AC5 A;  4JI5 E;  1IQS A;  2KHX A;  3C6M A;  2JOB A;  4F54 A;  1L4S A;  2YSP A;  5CFF E;  4LF6 E;  3OML A;  2EOM A;  2EJ4 A;  3ECR A;  3C4T A;  1DI2 A;  1N36 E;  2EM8 A;  2EOR A;  1X6H A;  1X47 A;  2EZ6 A;  2YWQ A;  3DF6 A;  1B69 A;  3DJW A;  1PKP A;  2RQL A;  3IWB A;  4LF5 E;  4R2P A;  2G7H A;  1P47 A;  1HNZ E;  1UN6 B;  1DGC A;  2JWO A;  2LUP B;  2RS7 A;  1BBG A;  4HTG A;  4KZS A;  2MKD A;  1YUJ A;  1YSA C;  1XNR E;  2EPZ A;  1T39 A;  2CSH A;  4RHB B;  5KL7 A;  1YYO A;  3ADL A;  4F9B B;  2EWL A;  2B7V A;  2LT7 A;  2YZT A;  1PDA A;  4BCA A;  1ZBT A;  2LUQ A;  2E1M A;  2ODR D;  3HQ1 A;  4L5N C;  3HXL A;  2EQ3 A;  2EPX A;  2E72 A;  2UXD E;  3VYX A;  2LTS A;  4O24 A;  1QNT A;  1DQ3 A;  2EPP A;  2VE7 C;  4TUI A;  2M7Q A;  2KOU A;  2EPU A;  2L92 A;  3L00 A;  2EOY A;  4M0V A;  4GKK E;  3IWD A;  2RPC A;  2JY9 A;  2EN8 A;  2LJH A;  4JI1 E;  4WX9 A;  2EOZ A;  1UBD C;  2K4V A;  3RMP A;  2K7I A;  2EOO A;  5AAS A;  1AAY A;  1N3G A;  2EPA A;  2EPN A;  2LV2 A;  3T1Y E;  2DGC A;  1X3C A;  4R2D A;  1HNW E;  4WXC A;  1WJP A;  4JI4 E;  1IBK E;  1A1H A;  2EMB A;  2H36 X;  4R2R A;  2EN4 A;  4LF8 E;  4Q28 A;  4OX9 E;  1I94 E;  3HPZ A;  1RC7 A;  4DR7 E;  2N3H A;  1G2D C;  1SR9 A;  2LE2 A;  2EOQ A;  2L33 A;  5A6K A;  4B3R E;  3QG5 C;  4GKJ E;  2EOF A;  2L8T A;  2MDR A;  2V89 A;  2EOE A;  2N3G A;  3VK6 A;  1HR0 E;  2HGH A;  3ADI A;  2CPN A;  2MDG A;  2EOI A;  2ODR C;  4BMJ A;  3AV0 A;  4MLQ A;  5LMU E;  4DR4 E;  5AE3 A;  3T1H E;  4LF7 E;  2DLQ A;  3HPS A;  2YTF A;  1XMO E;  4DR2 E;  2B9D A;  3KWR A;  2RTX A;  2LJU A;  2EL6 A;  2VQE E;  2ENA A;  2WBS A;  2NUE A;  2LCE A;  4P7D A;  5KL2 A; 
#chains in the Genus database with same CATH homology
 2YWQ A;  3TQM A;  1IMU A;  1L4S A;  4HEI A;  1N3G A;  2RQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...