3ADJA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
HGLCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F21M12.9 protein
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 19
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adjA00
2NA2A 3ADLA 2CPNA 1QU6A 4YY3E 4JI5E 2JVAA 1HNWE 2LTRA 2UUAE 2LUQA 3J7Yp 1N32E 4OOGC 4DV2E 2B7VA 4DR3E 4JI0E 4LF8E 4LFCE 1X48A 2DIXA 4JI4E 4JI6E 5LMUE 2UXCE 4M30A 4AQYE 4NXME 2UXBE 5LMNE 2B3TB 2UUCE 3VYXA 4M2ZA 4WYQB 1FJGE 2L2NA 1N34E 1UHZA 2RS6A 2E5LE 1PKPA 2L3CA 4K0KE 1X49A 2LRSA 1ZBTA 2MDRA 2LJHA 2RS7A 2DB2A 4DR1E 1XNQE 2NUGA 2L2KB 1YYOA 1XMOE 1WHQA 1GQEA 2YT4A 2VQFE 4DV3E 1UILA 1YYWA 4YHHE 3ADGA 4DUZE 4LF5E 4JI8E 3VYYA 3OTOE 1RC7A 2RSMA 2NUEA 1RQ0A 4JI1E 1YYKA 2LUPB 2LBSB 2EZ6A 4DR7E 4DV1E 2L3JA 2DMYA 1T4OA 4LF7E 4DUYE 2KHXA 3T1YE 1HNXE 4DKKA 2L2MA 3ADJA 2VQEE 4JV5E 4JI7E 4DV5E 2UUBE 4B3SE 3C4BA 4B3RE 1DI2A 1IBME 1J26A 2F4VE 4LF6E 1J5EE 2RTXA 4OX9E 3C4TA 1IBLE 4JI3E 1T4LB 4LFAE 4DR6E 4X66E 4DV4E 4X64E 2N3HA 4B3ME 1T4NA 1XMQE 2IHR1 3T1HE 2NUFA 3LLHA 4GKKE 4DR2E 4DV7E 3ADIA 4KHPE 1XNRE 1IBKE 3HTXA 4DR5E 2UXDE 4LF9E 2N3GA 1EKZA 1FKAE 4DV6E 2JY9A 5BR8E 4X65E 1YZ9A 4DV0E 5IWAE 4X8WA 2ZM6E 4LF4E 4WFTA 2L33A 4X62E 4LFBE 1I94E 2HHHE 4DR4E 2B7TA 2UU9E 4NXNE 3P1XA 1O0WA 1HR0E 4JI2E 2LTSA 1N36E 1N33E 4B3TE 4GKJE 1STUA 1WHNA 4JYAE 1X47A 1HNZE 5CFFE
chains in the Genus database with same CATH superfamily
1N3GA 2EMHA 1YUIA 4R2SA 1KYQA 1HNWE 2LTRA 4NHRA 2ENHA 1EH6A 1EH7A 3VK6A 4I8OA 2B7VA 4JI0E 1BBGA 3BGHA 1SFEA 4KZSA 3J80C 5AE2A 2J7JA 4IS1C 5LMUE 5AE3A 1G2DC 2UXBE 2EOHA 5AE1A 2FTXB 2JOXA 2EM8A 2ENAA 2L2NA 4L8NA 1PKPA 1A1FA 4K0KE 1X49A 4BBYA 1ZBTA 5A6BD 3EPKA 1DGCA 2YTQA 4F54A 2ELZA 2YTEA 4DR1E 1XNQE 2HC5A 2EN4A 2YT4A 1YFHA 2VQFE 1UILA 5AC5A 1WRJA 2YZTA 2EN8A 4M0VA 3K6QA 1QNTA 2YTIA 2NUEA 1RQ0A 4JI1E 1YYKA 2LO3A 2DMYA 2GHFA 3HPZA 4R2RA 3DJWA 3IWDA 3ZOQB 2N8XA 1IQOA 4DKKA 2JYAA 3ADJA 4DV5E 2M1SA 2EOXA 5T6JA 4B3RE 2DLQA 2JP9A 4BC9A 2HGHA 2RTXA 4OX9E 2ENCA 2BBGA 2VRDA 5IXMB 4DR6E 4X66E 1G2FC 3THOB 2EOFA 2N3HA 1L4SA 4N4RB 4GKKE 3EPJA 4LTYA 4ZYHA 2VF1A 3ADIA 2YTNA 1XNRE 3BIDA 4DR5E 2DSYA 4LF9E 1BBOA 2EM0A 2EM3A 4X65E 3KZZA 4DV0E 5LLQA 3JAMC 2L33A 4X62E 3EQ1A 3QG5C 2B7TA 4NXNE 4F6MA 3P1XA 2YRHA 2LTSA 3TQMA 2LT7A 4KWYA 4GZNC 4GKJE 2DLKA 4JYAE 1HNZE 5CFFE 2NA2A 3UK3C 2LE2A 4NZVA 5KL5A 4JI5E 2JVAA 4X9JA 2EM2A 2YTDA 4P78A 4BCAA 2V83A 2M7QA 1N32E 2EPPA 4DV2E 4M9VC 2YSOA 1AAYA 2DIXA 2ADRA 3THNA 4JI6E 5DNYA 5KL2A 1ZR9A 1X6EA 2EPUA 3MSWA 4M2ZA 1BB8A 2A25A 3KZYA 2DB2A 3EPLA 2NUGA 2L2KB 1YYOA 1XMOE 1GQEA 2WBTA 2EQ3A 4WXDA 2EPLX 5TSEA 4YHHE 2EWLA 1RMDA 2LVHA 2YTFA 1RC7A 1EH8A 3J7AG 4HTGA 2LUPB 2EZ6A 4DR7E 3J81C 2V89A 2L3JA 1A1LA 2EE8A 1JK1A 1GTKA 4DUYE 2EOOA 2KHXA 3FIGA 1HNXE 4DMIA 4O43A 2G7HA 4JI7E 4GEQB 1A1GA 1IBME 4BHBA 4LF6E 5A6KA 1PDAA 4JI3E 1AH5A 2EOIA 2V86A 2EJ4A 1NCSA 2EMFA 4F9BB 4B3ME 1T4NA 2Q8UA 1YUJA 3HTXA 2EOSA 2DGCA 5IWAE 4X8WA 1Z1BA 2MDGA 2CSHA 3IWBA 4LFBE 2HHHE 4F9AB 3RMPA 4LU9A 3F6HA 2L8TA 3ECRA 2JOBA 3JTZA 4WPYA 2EL4A 1N33E 1A1KA 3ADLA 1X5WA 1QU6A 2CPNA 2L92A 5LL6R 4YY3E 2WZOA 3MHHC 2YWQA 2YTJA 2JPAA 2UUAE 1YPNA 2LUQA 3J7Yp 4OOGC 1X3CA 2YRMA 2EOJA 4DR3E 4F2JC 2GPIA 4LF8E 2EMAA 2EORA 2YTOA 4Q35B 2EOYA 4LFCE 2EOZA 2WBSA 2MC6A 1PJQA 2EOQA 2EMWA 2EQ1A 3KWRA 4M30A 4NXME 2EOEA 2B3TB 2UUCE 3VYXA 1ZBQA 3HXLA 3L00A 4WYQB 1FJGE 4WX9A 2EPMX 2EMZA 5KL3A 1UHZA 1N34E 4R03A 2MDRA 2EN6A 4R2AA 2EQ0A 2RS7A 5A6BA 4ZYGA 2R76A 1IQSA 1TN9A 5KL7A 4DV3E 1YYWA 2EPAA 4R2QA 2JWOA 5KL6A 4JI8E 1DQ3A 5AC4A 2EPXA 4DV1E 4J8ZA 4WSGA 1T4OA 4R2CA 2EPRA 4O24A 4RHBB 3VHTB 2MKNA 1A1IA 2VE7C 2BB8A 2L2MA 2VQEE 2DRPA 2EN3A 4O4KA 2HJJA 2EMBA 2YSPA 2PRTA 1J26A 4P7DA 1J5EE 2E1MA 5A6AA 3IWCA 1KJKA 3HPSA 2ELYA 4DV4E 2EPOA 1A1HA 4X64E 1XMQE 2DMIA 5IV8B 1P47A 3T1HE 2NUFA 2YTPA 3LLHA 1NEIA 2LV2A 1GZ6A 2EMKA 2B9DA 1IBKE 2EPKX 1B69A 2UXDE 2N3GA 1FKAE 4DV6E 2JY9A 5BR8E 1YZ9A 4BMJA 1JK2A 2ZM6E 4LF4E 3JU0A 2E72A 4WFTA 3LMLA 1WXRA 4R2DA 2EMXA 2YPNA 4TUIA 5A6JA 1MGTA 5A2QC 2EOMA 3C6MA 2EMYA 4DR4E 2EM7A 3BBGA 2LCEA 5AASA 2EM9A 2EPZA 1HR0E 1MEYC 1N36E 4RH8A 1YSAC 4B3TE 1STUA 1IMUA 2K4VA 2LBSB 1WJPA 2K7IA 1ZU1A 2EM5A 4MLQA 1UN6B 2RPCA 1X6HA 2YU8A 2EMGA 4FK5C 1A1JA 4R2EA 4WXCA 3BF2A 1X48A 2EPCA 5F3WA 2LMZA 2V85A 2EN7A 1T39A 4JI4E 2UXCE 4F9CB 2EM6A 2FGGA 4AQYE 2H36X 5LMNE 4L5NC 4ZYDA 2FV4B 3EPHA 2V88A 2CT1A 5A69A 1SR9A 2M9AA 2RS6A 2EPNA 5IT9C 2EM4A 2L3CA 2E5LE 2LRSA 4HEIA 4R2PA 3H09A 2WCC3 2LJHA 1UBDC 2LJUA 1X6FA 4R8OA 2EL5A 2ODRC 4IJDA 5KL4A 1WHQA 3HQ1A 3OMLA 3ADGA 4DUZE 4LF5E 2D9HA 3VYYA 3OTOE 2EMCA 2RSMA 3MHSC 1PJTA 2V87A 2V8QB 4BC7A 2EP3A 4LF7E 3T1YE 4MLVA 2WBUA 2F8BA 2EN1A 4JV5E 2EMLA 2UUBE 2GLIA 3C4BA 2ODRD 4B3SE 1DI2A 1F2IG 1LLMC 4BHCA 2F4VE 4WSPA 2CTDA 4BS9A 3C4TA 5ADZA 1IBLE 1T38A 1T4LB 2R1FA 4LFAE 2I9IA 2M4IA 1TF3A 1TF6A 2EMIA 2IHR1 4TUGA 1ZAAC 3M99B 2RSIA 4F6NA 4DR2E 2EN2A 4DV7E 3AUZA 4KHPE 4ZYEA 4Q28A 2L6MA 1EKZA 5FLXC 2YRKA 2YTGA 1PJSA 2EL6A 2NABA 2JR1A 2I13A 2MKDA 2KOUA 2MC5A 2KONA 1I94E 2RQLA 3AV0A 2UU9E 3DF6A 2JXPA 1O0WA 4JI2E 3C6KA 3F6GA 4O5GA 1WHNA 1X47A 2YU5A
chains in the Genus database with same CATH topology
2NA2A 3ADLA 2CPNA 1QU6A 2L92A 5LL6R 4YY3E 2LE2A 4JI5E 2JVAA 1HNWE 2LTRA 2WZOA 2UUAE 2LUQA 4P78A 4BCAA 3VK6A 3J7Yp 2V83A 4I8OA 4OOGC 2M7QA 1N32E 4JV5E 4DV2E 2B7VA 4DR3E 4JI0E 4LF8E 4KHPE 4KZSA 4LFCE 1X48A 2DIXA 3J80C 5AE2A 5F3WA 2LMZA 2V85A 2MC6A 4JI4E 4JI6E 5DNYA 5AE3A 5LMUE 2UXCE 3KWRA 4F9CB 4M30A 2FGGA 4AQYE 4NXME 2H36X 2UXBE 5LMNE 2B3TB 2UUCE 3HTXA 3VYXA 1ZBQA 3HXLA 4L5NC 2FTXB 2FV4B 5AE1A 2V88A 2JOXA 3MSWA 4WYQB 4M2ZA 1FJGE 1SR9A 2L2NA 1N34E 4L8NA 1UHZA 2RS6A 5IT9C 1PKPA 2L3CA 2E5LE 4R03A 4K0KE 1X49A 2LRSA 4BBYA 1ZBTA 2MDRA 3H09A 2LJHA 2RS7A 4F54A 2DB2A 4R8OA 4DR1E 2ODRC 1XNQE 2NUGA 2L2KB 1YYOA 1XMOE 1WHQA 1GQEA 2YT4A 2VQFE 3HQ1A 1UILA 3OMLA 4DV3E 1YYWA 4YHHE 3ADGA 2JWOA 4DUZE 4LF5E 2EWLA 2YZTA 4JI8E 4M0VA 3VYYA 3OTOE 1RC7A 1DQ3A 3J7AG 2RSMA 3K6QA 2NUEA 1RQ0A 4JI1E 1YYKA 2LUPB 2LBSB 2EZ6A 4DR7E 3J81C 2V87A 4DV1E 2V89A 2L3JA 2V8QB 4BC7A 2DMYA 4J8ZA 1T4OA 4LF7E 4DUYE 2KHXA 3FIGA 3HPZA 3T1YE 3DJWA 3IWDA 3ZOQB 4DMIA 1HNXE 2VE7C 4DKKA 2L2MA 3ADJA 2F8BA 2G7HA 4JI7E 2VQEE 2M1SA 4DV5E 4GEQB 2UUBE 5T6JA 3C4BA 2ODRD 4B3SE 4B3RE 1DI2A 1IBME 1J26A 4BC9A 4WSPA 4P7DA 4LF6E 2F4VE 1J5EE 2RTXA 4BS9A 2E1MA 3IWCA 4OX9E 3C4TA 5ADZA 1IBLE 4JI3E 2V86A 1T4LB 4LFAE 3HPSA 4DR6E 4X66E 2M4IA 4DV4E 4X64E 4F9BB 2N3HA 4B3ME 1T4NA 1XMQE 2IHR1 4TUGA 3T1HE 2NUFA 3LLHA 4GKKE 4DR2E 4LTYA 4DV7E 2VF1A 1GZ6A 3AUZA 1XNRE 1IBKE 2B9DA 4DR5E 4Q28A 2DSYA 2L6MA 2N3GA 1EKZA 4LF9E 1FKAE 4DV6E 2JY9A 2UXDE 5BR8E 4X65E 5FLXC 1YZ9A 4BMJA 4DV0E 5IWAE 4X8WA 2JR1A 2ZM6E 4LF4E 3JU0A 4JYAE 2KOUA 4WFTA 3JAMC 2L33A 2MC5A 3LMLA 1WXRA 4X62E 3IWBA 2KONA 1I94E 4TUIA 4LFBE 2HHHE 3ADIA 4F9AB 5A2QC 3RMPA 4DR4E 3AV0A 2B7TA 4LU9A 2UU9E 4NXNE 3F6HA 2L8TA 3DF6A 2JOBA 3P1XA 5AASA 3JTZA 1O0WA 1HR0E 4WPYA 2LTSA 4JI2E 1N36E 1N33E 3F6GA 4B3TE 4GKJE 1STUA 1WHNA 2K4VA 1X47A 1HNZE 5CFFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NA2 A;  3ADL A;  2CPN A;  1QU6 A;  4YY3 E;  4JI5 E;  2JVA A;  1HNW E;  2LTR A;  2UUA E;  2LUQ A;  3J7Y p;  1N32 E;  4OOG C;  4DV2 E;  2B7V A;  4DR3 E;  4JI0 E;  4LF8 E;  4LFC E;  1X48 A;  2DIX A;  4JI4 E;  4JI6 E;  5LMU E;  2UXC E;  4M30 A;  4AQY E;  4NXM E;  2UXB E;  5LMN E;  2B3T B;  2UUC E;  3VYX A;  4M2Z A;  4WYQ B;  1FJG E;  2L2N A;  1N34 E;  1UHZ A;  2RS6 A;  2E5L E;  1PKP A;  2L3C A;  4K0K E;  1X49 A;  2LRS A;  1ZBT A;  2MDR A;  2LJH A;  2RS7 A;  2DB2 A;  4DR1 E;  1XNQ E;  2NUG A;  2L2K B;  1YYO A;  1XMO E;  1WHQ A;  1GQE A;  2YT4 A;  2VQF E;  4DV3 E;  1UIL A;  1YYW A;  4YHH E;  3ADG A;  4DUZ E;  4LF5 E;  4JI8 E;  3VYY A;  3OTO E;  1RC7 A;  2RSM A;  2NUE A;  1RQ0 A;  4JI1 E;  1YYK A;  2LUP B;  2LBS B;  2EZ6 A;  4DR7 E;  4DV1 E;  2L3J A;  2DMY A;  1T4O A;  4LF7 E;  4DUY E;  2KHX A;  3T1Y E;  1HNX E;  4DKK A;  2L2M A;  3ADJ A;  2VQE E;  4JV5 E;  4JI7 E;  4DV5 E;  2UUB E;  4B3S E;  3C4B A;  4B3R E;  1DI2 A;  1IBM E;  1J26 A;  2F4V E;  4LF6 E;  1J5E E;  2RTX A;  4OX9 E;  3C4T A;  1IBL E;  4JI3 E;  1T4L B;  4LFA E;  4DR6 E;  4X66 E;  4DV4 E;  4X64 E;  2N3H A;  4B3M E;  1T4N A;  1XMQ E;  2IHR 1;  3T1H E;  2NUF A;  3LLH A;  4GKK E;  4DR2 E;  4DV7 E;  3ADI A;  4KHP E;  1XNR E;  1IBK E;  3HTX A;  4DR5 E;  2UXD E;  4LF9 E;  2N3G A;  1EKZ A;  1FKA E;  4DV6 E;  2JY9 A;  5BR8 E;  4X65 E;  1YZ9 A;  4DV0 E;  5IWA E;  4X8W A;  2ZM6 E;  4LF4 E;  4WFT A;  2L33 A;  4X62 E;  4LFB E;  1I94 E;  2HHH E;  4DR4 E;  2B7T A;  2UU9 E;  4NXN E;  3P1X A;  1O0W A;  1HR0 E;  4JI2 E;  2LTS A;  1N36 E;  1N33 E;  4B3T E;  4GKJ E;  1STU A;  1WHN A;  4JYA E;  1X47 A;  1HNZ E;  5CFF E; 
#chains in the Genus database with same CATH topology
 1N3G A;  2EMH A;  1YUI A;  4R2S A;  1KYQ A;  1HNW E;  2LTR A;  4NHR A;  2ENH A;  1EH6 A;  1EH7 A;  3VK6 A;  4I8O A;  2B7V A;  4JI0 E;  1BBG A;  3BGH A;  1SFE A;  4KZS A;  3J80 C;  5AE2 A;  2J7J A;  4IS1 C;  5LMU E;  5AE3 A;  1G2D C;  2UXB E;  2EOH A;  5AE1 A;  2FTX B;  2JOX A;  2EM8 A;  2ENA A;  2L2N A;  4L8N A;  1PKP A;  1A1F A;  4K0K E;  1X49 A;  4BBY A;  1ZBT A;  5A6B D;  3EPK A;  1DGC A;  2YTQ A;  4F54 A;  2ELZ A;  2YTE A;  4DR1 E;  1XNQ E;  2HC5 A;  2EN4 A;  2YT4 A;  1YFH A;  2VQF E;  1UIL A;  5AC5 A;  1WRJ A;  2YZT A;  2EN8 A;  4M0V A;  3K6Q A;  1QNT A;  2YTI A;  2NUE A;  1RQ0 A;  4JI1 E;  1YYK A;  2LO3 A;  2DMY A;  2GHF A;  3HPZ A;  4R2R A;  3DJW A;  3IWD A;  3ZOQ B;  2N8X A;  1IQO A;  4DKK A;  2JYA A;  3ADJ A;  4DV5 E;  2M1S A;  2EOX A;  5T6J A;  4B3R E;  2DLQ A;  2JP9 A;  4BC9 A;  2HGH A;  2RTX A;  4OX9 E;  2ENC A;  2BBG A;  2VRD A;  5IXM B;  4DR6 E;  4X66 E;  1G2F C;  3THO B;  2EOF A;  2N3H A;  1L4S A;  4N4R B;  4GKK E;  3EPJ A;  4LTY A;  4ZYH A;  2VF1 A;  3ADI A;  2YTN A;  1XNR E;  3BID A;  4DR5 E;  2DSY A;  4LF9 E;  1BBO A;  2EM0 A;  2EM3 A;  4X65 E;  3KZZ A;  4DV0 E;  5LLQ A;  3JAM C;  2L33 A;  4X62 E;  3EQ1 A;  3QG5 C;  2B7T A;  4NXN E;  4F6M A;  3P1X A;  2YRH A;  2LTS A;  3TQM A;  2LT7 A;  4KWY A;  4GZN C;  4GKJ E;  2DLK A;  4JYA E;  1HNZ E;  5CFF E;  2NA2 A;  3UK3 C;  2LE2 A;  4NZV A;  5KL5 A;  4JI5 E;  2JVA A;  4X9J A;  2EM2 A;  2YTD A;  4P78 A;  4BCA A;  2V83 A;  2M7Q A;  1N32 E;  2EPP A;  4DV2 E;  4M9V C;  2YSO A;  1AAY A;  2DIX A;  2ADR A;  3THN A;  4JI6 E;  5DNY A;  5KL2 A;  1ZR9 A;  1X6E A;  2EPU A;  3MSW A;  4M2Z A;  1BB8 A;  2A25 A;  3KZY A;  2DB2 A;  3EPL A;  2NUG A;  2L2K B;  1YYO A;  1XMO E;  1GQE A;  2WBT A;  2EQ3 A;  4WXD A;  2EPL X;  5TSE A;  4YHH E;  2EWL A;  1RMD A;  2LVH A;  2YTF A;  1RC7 A;  1EH8 A;  3J7A G;  4HTG A;  2LUP B;  2EZ6 A;  4DR7 E;  3J81 C;  2V89 A;  2L3J A;  1A1L A;  2EE8 A;  1JK1 A;  1GTK A;  4DUY E;  2EOO A;  2KHX A;  3FIG A;  1HNX E;  4DMI A;  4O43 A;  2G7H A;  4JI7 E;  4GEQ B;  1A1G A;  1IBM E;  4BHB A;  4LF6 E;  5A6K A;  1PDA A;  4JI3 E;  1AH5 A;  2EOI A;  2V86 A;  2EJ4 A;  1NCS A;  2EMF A;  4F9B B;  4B3M E;  1T4N A;  2Q8U A;  1YUJ A;  3HTX A;  2EOS A;  2DGC A;  5IWA E;  4X8W A;  1Z1B A;  2MDG A;  2CSH A;  3IWB A;  4LFB E;  2HHH E;  4F9A B;  3RMP A;  4LU9 A;  3F6H A;  2L8T A;  3ECR A;  2JOB A;  3JTZ A;  4WPY A;  2EL4 A;  1N33 E;  1A1K A;  3ADL A;  1X5W A;  1QU6 A;  2CPN A;  2L92 A;  5LL6 R;  4YY3 E;  2WZO A;  3MHH C;  2YWQ A;  2YTJ A;  2JPA A;  2UUA E;  1YPN A;  2LUQ A;  3J7Y p;  4OOG C;  1X3C A;  2YRM A;  2EOJ A;  4DR3 E;  4F2J C;  2GPI A;  4LF8 E;  2EMA A;  2EOR A;  2YTO A;  4Q35 B;  2EOY A;  4LFC E;  2EOZ A;  2WBS A;  2MC6 A;  1PJQ A;  2EOQ A;  2EMW A;  2EQ1 A;  3KWR A;  4M30 A;  4NXM E;  2EOE A;  2B3T B;  2UUC E;  3VYX A;  1ZBQ A;  3HXL A;  3L00 A;  4WYQ B;  1FJG E;  4WX9 A;  2EPM X;  2EMZ A;  5KL3 A;  1UHZ A;  1N34 E;  4R03 A;  2MDR A;  2EN6 A;  4R2A A;  2EQ0 A;  2RS7 A;  5A6B A;  4ZYG A;  2R76 A;  1IQS A;  1TN9 A;  5KL7 A;  4DV3 E;  1YYW A;  2EPA A;  4R2Q A;  2JWO A;  5KL6 A;  4JI8 E;  1DQ3 A;  5AC4 A;  2EPX A;  4DV1 E;  4J8Z A;  4WSG A;  1T4O A;  4R2C A;  2EPR A;  4O24 A;  4RHB B;  3VHT B;  2MKN A;  1A1I A;  2VE7 C;  2BB8 A;  2L2M A;  2VQE E;  2DRP A;  2EN3 A;  4O4K A;  2HJJ A;  2EMB A;  2YSP A;  2PRT A;  1J26 A;  4P7D A;  1J5E E;  2E1M A;  5A6A A;  3IWC A;  1KJK A;  3HPS A;  2ELY A;  4DV4 E;  2EPO A;  1A1H A;  4X64 E;  1XMQ E;  2DMI A;  5IV8 B;  1P47 A;  3T1H E;  2NUF A;  2YTP A;  3LLH A;  1NEI A;  2LV2 A;  1GZ6 A;  2EMK A;  2B9D A;  1IBK E;  2EPK X;  1B69 A;  2UXD E;  2N3G A;  1FKA E;  4DV6 E;  2JY9 A;  5BR8 E;  1YZ9 A;  4BMJ A;  1JK2 A;  2ZM6 E;  4LF4 E;  3JU0 A;  2E72 A;  4WFT A;  3LML A;  1WXR A;  4R2D A;  2EMX A;  2YPN A;  4TUI A;  5A6J A;  1MGT A;  5A2Q C;  2EOM A;  3C6M A;  2EMY A;  4DR4 E;  2EM7 A;  3BBG A;  2LCE A;  5AAS A;  2EM9 A;  2EPZ A;  1HR0 E;  1MEY C;  1N36 E;  4RH8 A;  1YSA C;  4B3T E;  1STU A;  1IMU A;  2K4V A;  2LBS B;  1WJP A;  2K7I A;  1ZU1 A;  2EM5 A;  4MLQ A;  1UN6 B;  2RPC A;  1X6H A;  2YU8 A;  2EMG A;  4FK5 C;  1A1J A;  4R2E A;  4WXC A;  3BF2 A;  1X48 A;  2EPC A;  5F3W A;  2LMZ A;  2V85 A;  2EN7 A;  1T39 A;  4JI4 E;  2UXC E;  4F9C B;  2EM6 A;  2FGG A;  4AQY E;  2H36 X;  5LMN E;  4L5N C;  4ZYD A;  2FV4 B;  3EPH A;  2V88 A;  2CT1 A;  5A69 A;  1SR9 A;  2M9A A;  2RS6 A;  2EPN A;  5IT9 C;  2EM4 A;  2L3C A;  2E5L E;  2LRS A;  4HEI A;  4R2P A;  3H09 A;  2WCC 3;  2LJH A;  1UBD C;  2LJU A;  1X6F A;  4R8O A;  2EL5 A;  2ODR C;  4IJD A;  5KL4 A;  1WHQ A;  3HQ1 A;  3OML A;  3ADG A;  4DUZ E;  4LF5 E;  2D9H A;  3VYY A;  3OTO E;  2EMC A;  2RSM A;  3MHS C;  1PJT A;  2V87 A;  2V8Q B;  4BC7 A;  2EP3 A;  4LF7 E;  3T1Y E;  4MLV A;  2WBU A;  2F8B A;  2EN1 A;  4JV5 E;  2EML A;  2UUB E;  2GLI A;  3C4B A;  2ODR D;  4B3S E;  1DI2 A;  1F2I G;  1LLM C;  4BHC A;  2F4V E;  4WSP A;  2CTD A;  4BS9 A;  3C4T A;  5ADZ A;  1IBL E;  1T38 A;  1T4L B;  2R1F A;  4LFA E;  2I9I A;  2M4I A;  1TF3 A;  1TF6 A;  2EMI A;  2IHR 1;  4TUG A;  1ZAA C;  3M99 B;  2RSI A;  4F6N A;  4DR2 E;  2EN2 A;  4DV7 E;  3AUZ A;  4KHP E;  4ZYE A;  4Q28 A;  2L6M A;  1EKZ A;  5FLX C;  2YRK A;  2YTG A;  1PJS A;  2EL6 A;  2NAB A;  2JR1 A;  2I13 A;  2MKD A;  2KOU A;  2MC5 A;  2KON A;  1I94 E;  2RQL A;  3AV0 A;  2UU9 E;  3DF6 A;  2JXP A;  1O0W A;  4JI2 E;  3C6K A;  3F6G A;  4O5G A;  1WHN A;  1X47 A;  2YU5 A; 
#chains in the Genus database with same CATH homology
 2NA2 A;  3ADL A;  2CPN A;  1QU6 A;  2L92 A;  5LL6 R;  4YY3 E;  2LE2 A;  4JI5 E;  2JVA A;  1HNW E;  2LTR A;  2WZO A;  2UUA E;  2LUQ A;  4P78 A;  4BCA A;  3VK6 A;  3J7Y p;  2V83 A;  4I8O A;  4OOG C;  2M7Q A;  1N32 E;  4JV5 E;  4DV2 E;  2B7V A;  4DR3 E;  4JI0 E;  4LF8 E;  4KHP E;  4KZS A;  4LFC E;  1X48 A;  2DIX A;  3J80 C;  5AE2 A;  5F3W A;  2LMZ A;  2V85 A;  2MC6 A;  4JI4 E;  4JI6 E;  5DNY A;  5AE3 A;  5LMU E;  2UXC E;  3KWR A;  4F9C B;  4M30 A;  2FGG A;  4AQY E;  4NXM E;  2H36 X;  2UXB E;  5LMN E;  2B3T B;  2UUC E;  3HTX A;  3VYX A;  1ZBQ A;  3HXL A;  4L5N C;  2FTX B;  2FV4 B;  5AE1 A;  2V88 A;  2JOX A;  3MSW A;  4WYQ B;  4M2Z A;  1FJG E;  1SR9 A;  2L2N A;  1N34 E;  4L8N A;  1UHZ A;  2RS6 A;  5IT9 C;  1PKP A;  2L3C A;  2E5L E;  4R03 A;  4K0K E;  1X49 A;  2LRS A;  4BBY A;  1ZBT A;  2MDR A;  3H09 A;  2LJH A;  2RS7 A;  4F54 A;  2DB2 A;  4R8O A;  4DR1 E;  2ODR C;  1XNQ E;  2NUG A;  2L2K B;  1YYO A;  1XMO E;  1WHQ A;  1GQE A;  2YT4 A;  2VQF E;  3HQ1 A;  1UIL A;  3OML A;  4DV3 E;  1YYW A;  4YHH E;  3ADG A;  2JWO A;  4DUZ E;  4LF5 E;  2EWL A;  2YZT A;  4JI8 E;  4M0V A;  3VYY A;  3OTO E;  1RC7 A;  1DQ3 A;  3J7A G;  2RSM A;  3K6Q A;  2NUE A;  1RQ0 A;  4JI1 E;  1YYK A;  2LUP B;  2LBS B;  2EZ6 A;  4DR7 E;  3J81 C;  2V87 A;  4DV1 E;  2V89 A;  2L3J A;  2V8Q B;  4BC7 A;  2DMY A;  4J8Z A;  1T4O A;  4LF7 E;  4DUY E;  2KHX A;  3FIG A;  3HPZ A;  3T1Y E;  3DJW A;  3IWD A;  3ZOQ B;  4DMI A;  1HNX E;  2VE7 C;  4DKK A;  2L2M A;  3ADJ A;  2F8B A;  2G7H A;  4JI7 E;  2VQE E;  2M1S A;  4DV5 E;  4GEQ B;  2UUB E;  5T6J A;  3C4B A;  2ODR D;  4B3S E;  4B3R E;  1DI2 A;  1IBM E;  1J26 A;  4BC9 A;  4WSP A;  4P7D A;  4LF6 E;  2F4V E;  1J5E E;  2RTX A;  4BS9 A;  2E1M A;  3IWC A;  4OX9 E;  3C4T A;  5ADZ A;  1IBL E;  4JI3 E;  2V86 A;  1T4L B;  4LFA E;  3HPS A;  4DR6 E;  4X66 E;  2M4I A;  4DV4 E;  4X64 E;  4F9B B;  2N3H A;  4B3M E;  1T4N A;  1XMQ E;  2IHR 1;  4TUG A;  3T1H E;  2NUF A;  3LLH A;  4GKK E;  4DR2 E;  4LTY A;  4DV7 E;  2VF1 A;  1GZ6 A;  3AUZ A;  1XNR E;  1IBK E;  2B9D A;  4DR5 E;  4Q28 A;  2DSY A;  2L6M A;  2N3G A;  1EKZ A;  4LF9 E;  1FKA E;  4DV6 E;  2JY9 A;  2UXD E;  5BR8 E;  4X65 E;  5FLX C;  1YZ9 A;  4BMJ A;  4DV0 E;  5IWA E;  4X8W A;  2JR1 A;  2ZM6 E;  4LF4 E;  3JU0 A;  4JYA E;  2KOU A;  4WFT A;  3JAM C;  2L33 A;  2MC5 A;  3LML A;  1WXR A;  4X62 E;  3IWB A;  2KON A;  1I94 E;  4TUI A;  4LFB E;  2HHH E;  3ADI A;  4F9A B;  5A2Q C;  3RMP A;  4DR4 E;  3AV0 A;  2B7T A;  4LU9 A;  2UU9 E;  4NXN E;  3F6H A;  2L8T A;  3DF6 A;  2JOB A;  3P1X A;  5AAS A;  3JTZ A;  1O0W A;  1HR0 E;  4WPY A;  2LTS A;  4JI2 E;  1N36 E;  1N33 E;  3F6G A;  4B3T E;  4GKJ E;  1STU A;  1WHN A;  2K4V A;  1X47 A;  1HNZ E;  5CFF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...