3ADJA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
HGLCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F21M12.9 protein
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 19
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adjA00
1FKAE 1UILA 2LBSB 4JI0E 4JYAE 4X8WA 2LJHA 1J26A 4LF4E 2IHR1 1I94E 1XNQE 2NUGA 2VQEE 4DR6E 1T4OA 3OTOE 1N36E 2L2MA 2L2KB 2DB2A 2L3CA 3VYYA 1IBKE 1N34E 1YYOA 4K0KE 1STUA 4DUZE 4GKJE 1RQ0A 4B3TE 4JV5E 4OOGC 2NUEA 4DV3E 4B3ME 1QU6A 4GKKE 2LRSA 1UHZA 3T1YE 4DKKA 1X48A 2LTSA 4DV1E 2RTXA 2B7VA 1IBLE 2UU9E 2MDRA 4LF5E 1HNWE 2B7TA 2LUPB 4WYQB 1FJGE 5CFFE 4X65E 1HNZE 1WHQA 4JI3E 1EKZA 3C4TA 3P1XA 3J7Yp 4NXNE 1X49A 3ADIA 1HR0E 1N33E 2HHHE 4DV4E 1WHNA 2CPNA 4DUYE 4X64E 1YYWA 2UXDE 5IWAE 1O0WA 4LFCE 1T4LB 2ZM6E 4KHPE 1IBME 4LF9E 5LMNE 2DMYA 4DV0E 2B3TB 1PKPA 4JI6E 1X47A 4DR1E 4DV7E 2N3GA 1J5EE 3LLHA 4AQYE 2L33A 2UUAE 1HNXE 3ADGA 4JI5E 1N32E 2L3JA 1DI2A 1T4NA 4JI1E 3ADLA 2UXCE 2RS7A 4LF8E 2JY9A 4M30A 3C4BA 2UXBE 1YYKA 2NUFA 2LTRA 4DR5E 4DR4E 2EZ6A 4DR2E 4LF7E 4JI2E 2YT4A 5LMUE 4YHHE 4DV2E 3T1HE 1GQEA 1XNRE 3VYXA 5BR8E 4JI4E 4LF6E 2LUQA 1RC7A 2JVAA 4WFTA 4X66E 2E5LE 2F4VE 2UUBE 1ZBTA 4OX9E 4NXME 2RSMA 2L2NA 1XMQE 2UUCE 2KHXA 3HTXA 4LFAE 3ADJA 4LFBE 2N3HA 4X62E 1YZ9A 2NA2A 4JI7E 1XMOE 4DR7E 4DR3E 4YY3E 4DV6E 2DIXA 4B3SE 4M2ZA 2VQFE 4B3RE 2RS6A 4JI8E 4DV5E
chains in the Genus database with same CATH superfamily
1FKAE 3THOB 1J26A 2PRTA 2LJHA 3F6HA 3K6QA 5T6JA 4F9AB 1A1FA 1A1JA 2VQEE 1T4OA 1N36E 2EOEA 2ENHA 2ODRC 3C6KA 3VYYA 2L3CA 4F54A 1YUJA 4K0KE 2EQ1A 5AE1A 3HPSA 2LJUA 4DUZE 2M1SA 3IWDA 4OOGC 1TF6A 4DV3E 5A6AA 1X6EA 4GKKE 2DRPA 2EM3A 4DV1E 3JTZA 3TQMA 4LF5E 4RH8A 2M7QA 3MSWA 2YTQA 4X65E 4JI3E 3DJWA 1UBDC 2V83A 2GPIA 4I8OA 4NZVA 4GZNC 1IQOA 3J7Yp 3AV0A 4FK5C 1MEYC 2BBGA 3KWRA 2HHHE 1KYQA 5KL5A 4LFCE 3KZZA 4KHPE 2LO3A 4DMIA 2DMYA 2V87A 5TSEA 2L92A 2B3TB 2K4VA 1X47A 4DV7E 2N3GA 2EPKX 4AQYE 4BC7A 1QNTA 1PJSA 1TN9A 2VF1A 3FIGA 1A1GA 3MHSC 1N32E 2YTOA 2UXCE 3EPJA 2H36X 2FV4B 2EMHA 5AASA 2R1FA 2NUFA 1X3CA 2LVHA 4BHCA 2RSIA 4LF7E 2JP9A 2YT4A 3IWCA 2EN3A 4MLVA 2I9IA 1GQEA 3UK3C 5BR8E 4JI4E 4GEQB 1G2DC 2DMIA 2EMZA 1ZBQA 2EL6A 3EPKA 4KZSA 1ZBTA 2EM6A 2Q8UA 1XMQE 2UUCE 2YTPA 2V8QB 2EOZA 4DR3E 2MDGA 1ZR9A 4B3SE 1N3GA 5AC5A 1YPNA 3AUZA 4BS9A 2EMLA 4R2RA 4ZYEA 5LL6R 4B3RE 1DGCA 4JI8E 2I13A 3HXLA 2YRHA 2EPPA 4M9VC 2EOXA 2NABA 2IHR1 4DR6E 3OTOE 3EPLA 2EPXA 4R2PA 2KOUA 2L2MA 1EH7A 2EPNA 4NHRA 1WJPA 5AE2A 2JOBA 2EQ0A 4R2DA 1A1HA 3F6GA 5AE3A 2MKNA 2LV2A 3RMPA 4O43A 2FTXB 3OMLA 2ADRA 3QG5C 5KL7A 1IQSA 2MC5A 1A1IA 4P7DA 1YSAC 2F8BA 4R2EA 4R2SA 2D9HA 2UU9E 4WSGA 2EJ4A 1X5WA 2ODRD 1BBOA 1EKZA 2DGCA 1AAYA 5A6KA 2HGHA 4NXNE 1X49A 2EMXA 2CPNA 1Z1BA 2JYAA 4WXCA 4N4RB 4O4KA 4F2JC 1JK2A 4BC9A 1PKPA 2WZOA 2EL4A 4WPYA 4JI6E 4DR1E 2G7HA 3H09A 2EM5A 4LU9A 3LLHA 1X6FA 2UUAE 1G2FC 2YZTA 2RS7A 2RPCA 2EOYA 4M0VA 2EN6A 4WXDA 4WX9A 4L8NA 2EZ6A 2A25A 2YTJA 2B9DA 2YTEA 1EH6A 2EPZA 1JK1A 2EM7A 5IXMB 5KL4A 1BB8A 2EPRA 3J81C 2GLIA 2YWQA 4Q35B 2HC5A 1WXRA 4BHBA 4X66E 2RQLA 3HPZA 2F4VE 2V86A 2M9AA 2L2NA 2DLQA 3IWBA 2EOMA 4LFAE 2JPAA 2NA2A 1KJKA 4JI7E 4F6NA 4WSPA 2VQFE 4TUGA 1UILA 4JI0E 4JYAE 1L4SA 4X8WA 2LE2A 2ENAA 2EPOA 4IJDA 1I94E 4RHBB 5A6BD 2EWLA 2EM8A 2EMWA 5KL2A 2L2KB 1IMUA 3JAMC 1N34E 4IS1C 1YYOA 1STUA 1NCSA 4LTYA 1RQ0A 2EN8A 2HJJA 2BB8A 4BCAA 4B3ME 4R8OA 1QU6A 5A69A 2LRSA 1YFHA 2GHFA 3T1YE 4DKKA 5KL3A 2FGGA 1X48A 2LTSA 1PDAA 2B7VA 2EPMX 2LT7A 2MDRA 1HNWE 3VK6A 1A1KA 4J8ZA 3J80C 1FJGE 1WHQA 2ELZA 5AC4A 5F3WA 3BGHA 3C4TA 2EOSA 3P1XA 4R2QA 2EM4A 2EOFA 2YPNA 2E1MA 3ADIA 3JU0A 2YTDA 5A6JA 3BF2A 1N33E 4DV4E 4O5GA 3C6MA 4DUYE 3KZYA 1O0WA 1T4LB 2ZM6E 2EMBA 1MGTA 2ELYA 2EPLX 5LMNE 2R76A 4R2AA 4DV0E 2EPUA 2JWOA 4ZYGA 2DLKA 5A6BA 2L8TA 2EM2A 2V88A 4HEIA 2KONA 4X9JA 2V89A 2L33A 2DSYA 2JXPA 1BBGA 2EN2A 2EOOA 1WRJA 2WCC3 3ADGA 4JI5E 2LCEA 1DI2A 3M99B 1YUIA 2YTFA 3MHHC 2JY9A 4F9BB 4M30A 2CTDA 4TUIA 2EMKA 2EN1A 1ZU1A 2EM9A 3VHTB 1PJTA 4Q28A 2EMIA 5IV8B 5DNYA 4DV2E 4O24A 1P47A 3HQ1A 1A1LA 1AH5A 2JR1A 4LF6E 2V85A 3EPHA 2E72A 3ZOQB 2JOXA 2EMYA 2WBSA 4NXME 1GZ6A 2KHXA 3ADJA 4LFBE 2YTGA 4BMJA 4X62E 2EOJA 1XMOE 2EQ3A 4ZYHA 4DR7E 2EOHA 4DV6E 5IT9C 1X6HA 4M2ZA 2RS6A 3BIDA 2EPCA 4DV5E 2LBSB 4LF4E 1XNQE 2NUGA 2EOQA 2DB2A 1IBKE 1PJQA 2EL5A 2EMFA 5ADZA 2EPAA 4ZYDA 4GKJE 4B3TE 2L6MA 4R03A 4JV5E 2NUEA 5FLXC 4F9CB 3L00A 2LMZA 5KL6A 1UHZA 1GTKA 1UN6B 3ECRA 2RTXA 2WBUA 2VRDA 1IBLE 4BBYA 1T38A 2B7TA 2YSOA 2LUPB 4WYQB 5CFFE 4P78A 2ENCA 5A2QC 5LLQA 2EM0A 2EOIA 1EH8A 2J7JA 2M4IA 3BBGA 1HR0E 1WHNA 2N8XA 4X64E 1YYWA 2UXDE 5IWAE 1LLMC 3EQ1A 1IBME 4LF9E 4MLQA 2EN7A 2EP3A 1DQ3A 4HTGA 1SR9A 3J7AG 2YSPA 1J5EE 2K7IA 1HNXE 2EMCA 2WBTA 1T39A 2L3JA 1B69A 1T4NA 2VE7C 2YTIA 4JI1E 3ADLA 4LF8E 3C4BA 1F2IG 2UXBE 1YYKA 2LTRA 2CT1A 4DR5E 2MC6A 4DR4E 4DR2E 2EMGA 4JI2E 5LMUE 2EORA 4YHHE 3T1HE 4F6MA 1XNRE 3VYXA 3DF6A 2LUQA 1TF3A 1RC7A 2JVAA 1ZAAC 4WFTA 2CSHA 2EE8A 1NEIA 3THNA 2E5LE 2YRKA 2YRMA 2MKDA 2UUBE 4OX9E 2RSMA 4KWYA 4L5NC 1RMDA 3HTXA 2YU8A 2N3HA 1YZ9A 2YTNA 4R2CA 4YY3E 1SFEA 2DIXA 3LMLA 2YU5A 2EN4A 1HNZE 2EMAA
chains in the Genus database with same CATH topology
1FKAE 4TUGA 1UILA 3HXLA 2LBSB 4JI0E 4X8WA 2LJHA 4JYAE 1J26A 2LE2A 3F6HA 3K6QA 5T6JA 4F9AB 4LF4E 2IHR1 1I94E 1XNQE 2NUGA 2VQEE 4DR6E 1T4OA 2EWLA 3OTOE 1N36E 2KOUA 2ODRC 2L2MA 2L2KB 2DB2A 2L3CA 3VYYA 5AE2A 1IBKE 4F54A 2JOBA 3JAMC 1N34E 5ADZA 1YYOA 4K0KE 1STUA 5AE1A 3HPSA 4DUZE 4LTYA 4GKJE 1RQ0A 2M1SA 3F6GA 5AE3A 4B3TE 3IWDA 2L6MA 4R03A 4OOGC 3RMPA 4JV5E 2NUEA 5FLXC 2FTXB 4BCAA 3OMLA 4DV3E 4B3ME 4F9CB 4R8OA 1QU6A 4GKKE 2LMZA 2LRSA 2MC5A 1UHZA 3T1YE 4P7DA 4DKKA 2FGGA 1X48A 2LTSA 4DV1E 2RTXA 2F8BA 2B7VA 3JTZA 1IBLE 4BBYA 2UU9E 2MDRA 4LF5E 1HNWE 2B7TA 3VK6A 2LUPB 2M7QA 3MSWA 4J8ZA 4WYQB 3J80C 5CFFE 1FJGE 4X65E 4P78A 2ODRD 1WHQA 1HNZE 4JI3E 3DJWA 5F3WA 2V83A 5A2QC 1EKZA 4I8OA 3C4TA 3P1XA 3J7Yp 3AV0A 4NXNE 1X49A 2E1MA 3JU0A 3ADIA 2M4IA 1HR0E 3KWRA 1N33E 2HHHE 4DV4E 1WHNA 2CPNA 4DUYE 4X64E 1YYWA 2UXDE 5IWAE 1O0WA 4LFCE 1T4LB 2ZM6E 4KHPE 1IBME 4LF9E 5LMNE 4DMIA 2DMYA 2V87A 4DV0E 2L92A 1DQ3A 2B3TB 2JWOA 4BC9A 1PKPA 2K4VA 1SR9A 1X47A 2WZOA 4WPYA 2L8TA 4JI6E 4DR1E 3J7AG 2G7HA 3H09A 4DV7E 2N3GA 2V88A 2KONA 4LU9A 1J5EE 3LLHA 4AQYE 2V89A 4BC7A 2L33A 2DSYA 2UUAE 5LL6R 1HNXE 2YZTA 2VF1A 3FIGA 3ADGA 4JI5E 1N32E 2L3JA 1DI2A 1T4NA 2VE7C 4JI1E 3ADLA 2UXCE 2H36X 2RS7A 2FV4B 4LF8E 2JY9A 4F9BB 5AASA 4M30A 3C4BA 4TUIA 2UXBE 1YYKA 4M0VA 2NUFA 2LTRA 4DR5E 4L8NA 2MC6A 4DR4E 2EZ6A 4Q28A 4DR2E 4LF7E 4JI2E 2YT4A 5LMUE 3IWCA 2B9DA 5DNYA 4YHHE 4DV2E 3T1HE 1GQEA 3HQ1A 1XNRE 3VYXA 5BR8E 4JI4E 2JR1A 3DF6A 4GEQB 2V85A 3J81C 4LF6E 2LUQA 3ZOQB 1RC7A 2JOXA 2JVAA 4WFTA 1ZBQA 1WXRA 4X66E 3HPZA 2E5LE 2F4VE 4KZSA 2UUBE 1ZBTA 4OX9E 2V86A 4NXME 2RSMA 4L5NC 2L2NA 3IWBA 1GZ6A 2KHXA 1XMQE 2UUCE 3ADJA 4LFAE 3HTXA 2N3HA 4LFBE 4BMJA 4X62E 1YZ9A 2NA2A 2V8QB 4JI7E 1XMOE 4DR7E 4DR3E 4YY3E 4DV6E 4WSPA 2DIXA 4B3SE 5IT9C 3LMLA 4M2ZA 4BS9A 3AUZA 2VQFE 4B3RE 2RS6A 4JI8E 4DV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKA E;  1UIL A;  2LBS B;  4JI0 E;  4JYA E;  4X8W A;  2LJH A;  1J26 A;  4LF4 E;  2IHR 1;  1I94 E;  1XNQ E;  2NUG A;  2VQE E;  4DR6 E;  1T4O A;  3OTO E;  1N36 E;  2L2M A;  2L2K B;  2DB2 A;  2L3C A;  3VYY A;  1IBK E;  1N34 E;  1YYO A;  4K0K E;  1STU A;  4DUZ E;  4GKJ E;  1RQ0 A;  4B3T E;  4JV5 E;  4OOG C;  2NUE A;  4DV3 E;  4B3M E;  1QU6 A;  4GKK E;  2LRS A;  1UHZ A;  3T1Y E;  4DKK A;  1X48 A;  2LTS A;  4DV1 E;  2RTX A;  2B7V A;  1IBL E;  2UU9 E;  2MDR A;  4LF5 E;  1HNW E;  2B7T A;  2LUP B;  4WYQ B;  1FJG E;  5CFF E;  4X65 E;  1HNZ E;  1WHQ A;  4JI3 E;  1EKZ A;  3C4T A;  3P1X A;  3J7Y p;  4NXN E;  1X49 A;  3ADI A;  1HR0 E;  1N33 E;  2HHH E;  4DV4 E;  1WHN A;  2CPN A;  4DUY E;  4X64 E;  1YYW A;  2UXD E;  5IWA E;  1O0W A;  4LFC E;  1T4L B;  2ZM6 E;  4KHP E;  1IBM E;  4LF9 E;  5LMN E;  2DMY A;  4DV0 E;  2B3T B;  1PKP A;  4JI6 E;  1X47 A;  4DR1 E;  4DV7 E;  2N3G A;  1J5E E;  3LLH A;  4AQY E;  2L33 A;  2UUA E;  1HNX E;  3ADG A;  4JI5 E;  1N32 E;  2L3J A;  1DI2 A;  1T4N A;  4JI1 E;  3ADL A;  2UXC E;  2RS7 A;  4LF8 E;  2JY9 A;  4M30 A;  3C4B A;  2UXB E;  1YYK A;  2NUF A;  2LTR A;  4DR5 E;  4DR4 E;  2EZ6 A;  4DR2 E;  4LF7 E;  4JI2 E;  2YT4 A;  5LMU E;  4YHH E;  4DV2 E;  3T1H E;  1GQE A;  1XNR E;  3VYX A;  5BR8 E;  4JI4 E;  4LF6 E;  2LUQ A;  1RC7 A;  2JVA A;  4WFT A;  4X66 E;  2E5L E;  2F4V E;  2UUB E;  1ZBT A;  4OX9 E;  4NXM E;  2RSM A;  2L2N A;  1XMQ E;  2UUC E;  2KHX A;  3HTX A;  4LFA E;  3ADJ A;  4LFB E;  2N3H A;  4X62 E;  1YZ9 A;  2NA2 A;  4JI7 E;  1XMO E;  4DR7 E;  4DR3 E;  4YY3 E;  4DV6 E;  2DIX A;  4B3S E;  4M2Z A;  2VQF E;  4B3R E;  2RS6 A;  4JI8 E;  4DV5 E; 
#chains in the Genus database with same CATH topology
 1FKA E;  3THO B;  1J26 A;  2PRT A;  2LJH A;  3F6H A;  3K6Q A;  5T6J A;  4F9A B;  1A1F A;  1A1J A;  2VQE E;  1T4O A;  1N36 E;  2EOE A;  2ENH A;  2ODR C;  3C6K A;  3VYY A;  2L3C A;  4F54 A;  1YUJ A;  4K0K E;  2EQ1 A;  5AE1 A;  3HPS A;  2LJU A;  4DUZ E;  2M1S A;  3IWD A;  4OOG C;  1TF6 A;  4DV3 E;  5A6A A;  1X6E A;  4GKK E;  2DRP A;  2EM3 A;  4DV1 E;  3JTZ A;  3TQM A;  4LF5 E;  4RH8 A;  2M7Q A;  3MSW A;  2YTQ A;  4X65 E;  4JI3 E;  3DJW A;  1UBD C;  2V83 A;  2GPI A;  4I8O A;  4NZV A;  4GZN C;  1IQO A;  3J7Y p;  3AV0 A;  4FK5 C;  1MEY C;  2BBG A;  3KWR A;  2HHH E;  1KYQ A;  5KL5 A;  4LFC E;  3KZZ A;  4KHP E;  2LO3 A;  4DMI A;  2DMY A;  2V87 A;  5TSE A;  2L92 A;  2B3T B;  2K4V A;  1X47 A;  4DV7 E;  2N3G A;  2EPK X;  4AQY E;  4BC7 A;  1QNT A;  1PJS A;  1TN9 A;  2VF1 A;  3FIG A;  1A1G A;  3MHS C;  1N32 E;  2YTO A;  2UXC E;  3EPJ A;  2H36 X;  2FV4 B;  2EMH A;  5AAS A;  2R1F A;  2NUF A;  1X3C A;  2LVH A;  4BHC A;  2RSI A;  4LF7 E;  2JP9 A;  2YT4 A;  3IWC A;  2EN3 A;  4MLV A;  2I9I A;  1GQE A;  3UK3 C;  5BR8 E;  4JI4 E;  4GEQ B;  1G2D C;  2DMI A;  2EMZ A;  1ZBQ A;  2EL6 A;  3EPK A;  4KZS A;  1ZBT A;  2EM6 A;  2Q8U A;  1XMQ E;  2UUC E;  2YTP A;  2V8Q B;  2EOZ A;  4DR3 E;  2MDG A;  1ZR9 A;  4B3S E;  1N3G A;  5AC5 A;  1YPN A;  3AUZ A;  4BS9 A;  2EML A;  4R2R A;  4ZYE A;  5LL6 R;  4B3R E;  1DGC A;  4JI8 E;  2I13 A;  3HXL A;  2YRH A;  2EPP A;  4M9V C;  2EOX A;  2NAB A;  2IHR 1;  4DR6 E;  3OTO E;  3EPL A;  2EPX A;  4R2P A;  2KOU A;  2L2M A;  1EH7 A;  2EPN A;  4NHR A;  1WJP A;  5AE2 A;  2JOB A;  2EQ0 A;  4R2D A;  1A1H A;  3F6G A;  5AE3 A;  2MKN A;  2LV2 A;  3RMP A;  4O43 A;  2FTX B;  3OML A;  2ADR A;  3QG5 C;  5KL7 A;  1IQS A;  2MC5 A;  1A1I A;  4P7D A;  1YSA C;  2F8B A;  4R2E A;  4R2S A;  2D9H A;  2UU9 E;  4WSG A;  2EJ4 A;  1X5W A;  2ODR D;  1BBO A;  1EKZ A;  2DGC A;  1AAY A;  5A6K A;  2HGH A;  4NXN E;  1X49 A;  2EMX A;  2CPN A;  1Z1B A;  2JYA A;  4WXC A;  4N4R B;  4O4K A;  4F2J C;  1JK2 A;  4BC9 A;  1PKP A;  2WZO A;  2EL4 A;  4WPY A;  4JI6 E;  4DR1 E;  2G7H A;  3H09 A;  2EM5 A;  4LU9 A;  3LLH A;  1X6F A;  2UUA E;  1G2F C;  2YZT A;  2RS7 A;  2RPC A;  2EOY A;  4M0V A;  2EN6 A;  4WXD A;  4WX9 A;  4L8N A;  2EZ6 A;  2A25 A;  2YTJ A;  2B9D A;  2YTE A;  1EH6 A;  2EPZ A;  1JK1 A;  2EM7 A;  5IXM B;  5KL4 A;  1BB8 A;  2EPR A;  3J81 C;  2GLI A;  2YWQ A;  4Q35 B;  2HC5 A;  1WXR A;  4BHB A;  4X66 E;  2RQL A;  3HPZ A;  2F4V E;  2V86 A;  2M9A A;  2L2N A;  2DLQ A;  3IWB A;  2EOM A;  4LFA E;  2JPA A;  2NA2 A;  1KJK A;  4JI7 E;  4F6N A;  4WSP A;  2VQF E;  4TUG A;  1UIL A;  4JI0 E;  4JYA E;  1L4S A;  4X8W A;  2LE2 A;  2ENA A;  2EPO A;  4IJD A;  1I94 E;  4RHB B;  5A6B D;  2EWL A;  2EM8 A;  2EMW A;  5KL2 A;  2L2K B;  1IMU A;  3JAM C;  1N34 E;  4IS1 C;  1YYO A;  1STU A;  1NCS A;  4LTY A;  1RQ0 A;  2EN8 A;  2HJJ A;  2BB8 A;  4BCA A;  4B3M E;  4R8O A;  1QU6 A;  5A69 A;  2LRS A;  1YFH A;  2GHF A;  3T1Y E;  4DKK A;  5KL3 A;  2FGG A;  1X48 A;  2LTS A;  1PDA A;  2B7V A;  2EPM X;  2LT7 A;  2MDR A;  1HNW E;  3VK6 A;  1A1K A;  4J8Z A;  3J80 C;  1FJG E;  1WHQ A;  2ELZ A;  5AC4 A;  5F3W A;  3BGH A;  3C4T A;  2EOS A;  3P1X A;  4R2Q A;  2EM4 A;  2EOF A;  2YPN A;  2E1M A;  3ADI A;  3JU0 A;  2YTD A;  5A6J A;  3BF2 A;  1N33 E;  4DV4 E;  4O5G A;  3C6M A;  4DUY E;  3KZY A;  1O0W A;  1T4L B;  2ZM6 E;  2EMB A;  1MGT A;  2ELY A;  2EPL X;  5LMN E;  2R76 A;  4R2A A;  4DV0 E;  2EPU A;  2JWO A;  4ZYG A;  2DLK A;  5A6B A;  2L8T A;  2EM2 A;  2V88 A;  4HEI A;  2KON A;  4X9J A;  2V89 A;  2L33 A;  2DSY A;  2JXP A;  1BBG A;  2EN2 A;  2EOO A;  1WRJ A;  2WCC 3;  3ADG A;  4JI5 E;  2LCE A;  1DI2 A;  3M99 B;  1YUI A;  2YTF A;  3MHH C;  2JY9 A;  4F9B B;  4M30 A;  2CTD A;  4TUI A;  2EMK A;  2EN1 A;  1ZU1 A;  2EM9 A;  3VHT B;  1PJT A;  4Q28 A;  2EMI A;  5IV8 B;  5DNY A;  4DV2 E;  4O24 A;  1P47 A;  3HQ1 A;  1A1L A;  1AH5 A;  2JR1 A;  4LF6 E;  2V85 A;  3EPH A;  2E72 A;  3ZOQ B;  2JOX A;  2EMY A;  2WBS A;  4NXM E;  1GZ6 A;  2KHX A;  3ADJ A;  4LFB E;  2YTG A;  4BMJ A;  4X62 E;  2EOJ A;  1XMO E;  2EQ3 A;  4ZYH A;  4DR7 E;  2EOH A;  4DV6 E;  5IT9 C;  1X6H A;  4M2Z A;  2RS6 A;  3BID A;  2EPC A;  4DV5 E;  2LBS B;  4LF4 E;  1XNQ E;  2NUG A;  2EOQ A;  2DB2 A;  1IBK E;  1PJQ A;  2EL5 A;  2EMF A;  5ADZ A;  2EPA A;  4ZYD A;  4GKJ E;  4B3T E;  2L6M A;  4R03 A;  4JV5 E;  2NUE A;  5FLX C;  4F9C B;  3L00 A;  2LMZ A;  5KL6 A;  1UHZ A;  1GTK A;  1UN6 B;  3ECR A;  2RTX A;  2WBU A;  2VRD A;  1IBL E;  4BBY A;  1T38 A;  2B7T A;  2YSO A;  2LUP B;  4WYQ B;  5CFF E;  4P78 A;  2ENC A;  5A2Q C;  5LLQ A;  2EM0 A;  2EOI A;  1EH8 A;  2J7J A;  2M4I A;  3BBG A;  1HR0 E;  1WHN A;  2N8X A;  4X64 E;  1YYW A;  2UXD E;  5IWA E;  1LLM C;  3EQ1 A;  1IBM E;  4LF9 E;  4MLQ A;  2EN7 A;  2EP3 A;  1DQ3 A;  4HTG A;  1SR9 A;  3J7A G;  2YSP A;  1J5E E;  2K7I A;  1HNX E;  2EMC A;  2WBT A;  1T39 A;  2L3J A;  1B69 A;  1T4N A;  2VE7 C;  2YTI A;  4JI1 E;  3ADL A;  4LF8 E;  3C4B A;  1F2I G;  2UXB E;  1YYK A;  2LTR A;  2CT1 A;  4DR5 E;  2MC6 A;  4DR4 E;  4DR2 E;  2EMG A;  4JI2 E;  5LMU E;  2EOR A;  4YHH E;  3T1H E;  4F6M A;  1XNR E;  3VYX A;  3DF6 A;  2LUQ A;  1TF3 A;  1RC7 A;  2JVA A;  1ZAA C;  4WFT A;  2CSH A;  2EE8 A;  1NEI A;  3THN A;  2E5L E;  2YRK A;  2YRM A;  2MKD A;  2UUB E;  4OX9 E;  2RSM A;  4KWY A;  4L5N C;  1RMD A;  3HTX A;  2YU8 A;  2N3H A;  1YZ9 A;  2YTN A;  4R2C A;  4YY3 E;  1SFE A;  2DIX A;  3LML A;  2YU5 A;  2EN4 A;  1HNZ E;  2EMA A; 
#chains in the Genus database with same CATH homology
 1FKA E;  4TUG A;  1UIL A;  3HXL A;  2LBS B;  4JI0 E;  4X8W A;  2LJH A;  4JYA E;  1J26 A;  2LE2 A;  3F6H A;  3K6Q A;  5T6J A;  4F9A B;  4LF4 E;  2IHR 1;  1I94 E;  1XNQ E;  2NUG A;  2VQE E;  4DR6 E;  1T4O A;  2EWL A;  3OTO E;  1N36 E;  2KOU A;  2ODR C;  2L2M A;  2L2K B;  2DB2 A;  2L3C A;  3VYY A;  5AE2 A;  1IBK E;  4F54 A;  2JOB A;  3JAM C;  1N34 E;  5ADZ A;  1YYO A;  4K0K E;  1STU A;  5AE1 A;  3HPS A;  4DUZ E;  4LTY A;  4GKJ E;  1RQ0 A;  2M1S A;  3F6G A;  5AE3 A;  4B3T E;  3IWD A;  2L6M A;  4R03 A;  4OOG C;  3RMP A;  4JV5 E;  2NUE A;  5FLX C;  2FTX B;  4BCA A;  3OML A;  4DV3 E;  4B3M E;  4F9C B;  4R8O A;  1QU6 A;  4GKK E;  2LMZ A;  2LRS A;  2MC5 A;  1UHZ A;  3T1Y E;  4P7D A;  4DKK A;  2FGG A;  1X48 A;  2LTS A;  4DV1 E;  2RTX A;  2F8B A;  2B7V A;  3JTZ A;  1IBL E;  4BBY A;  2UU9 E;  2MDR A;  4LF5 E;  1HNW E;  2B7T A;  3VK6 A;  2LUP B;  2M7Q A;  3MSW A;  4J8Z A;  4WYQ B;  3J80 C;  5CFF E;  1FJG E;  4X65 E;  4P78 A;  2ODR D;  1WHQ A;  1HNZ E;  4JI3 E;  3DJW A;  5F3W A;  2V83 A;  5A2Q C;  1EKZ A;  4I8O A;  3C4T A;  3P1X A;  3J7Y p;  3AV0 A;  4NXN E;  1X49 A;  2E1M A;  3JU0 A;  3ADI A;  2M4I A;  1HR0 E;  3KWR A;  1N33 E;  2HHH E;  4DV4 E;  1WHN A;  2CPN A;  4DUY E;  4X64 E;  1YYW A;  2UXD E;  5IWA E;  1O0W A;  4LFC E;  1T4L B;  2ZM6 E;  4KHP E;  1IBM E;  4LF9 E;  5LMN E;  4DMI A;  2DMY A;  2V87 A;  4DV0 E;  2L92 A;  1DQ3 A;  2B3T B;  2JWO A;  4BC9 A;  1PKP A;  2K4V A;  1SR9 A;  1X47 A;  2WZO A;  4WPY A;  2L8T A;  4JI6 E;  4DR1 E;  3J7A G;  2G7H A;  3H09 A;  4DV7 E;  2N3G A;  2V88 A;  2KON A;  4LU9 A;  1J5E E;  3LLH A;  4AQY E;  2V89 A;  4BC7 A;  2L33 A;  2DSY A;  2UUA E;  5LL6 R;  1HNX E;  2YZT A;  2VF1 A;  3FIG A;  3ADG A;  4JI5 E;  1N32 E;  2L3J A;  1DI2 A;  1T4N A;  2VE7 C;  4JI1 E;  3ADL A;  2UXC E;  2H36 X;  2RS7 A;  2FV4 B;  4LF8 E;  2JY9 A;  4F9B B;  5AAS A;  4M30 A;  3C4B A;  4TUI A;  2UXB E;  1YYK A;  4M0V A;  2NUF A;  2LTR A;  4DR5 E;  4L8N A;  2MC6 A;  4DR4 E;  2EZ6 A;  4Q28 A;  4DR2 E;  4LF7 E;  4JI2 E;  2YT4 A;  5LMU E;  3IWC A;  2B9D A;  5DNY A;  4YHH E;  4DV2 E;  3T1H E;  1GQE A;  3HQ1 A;  1XNR E;  3VYX A;  5BR8 E;  4JI4 E;  2JR1 A;  3DF6 A;  4GEQ B;  2V85 A;  3J81 C;  4LF6 E;  2LUQ A;  3ZOQ B;  1RC7 A;  2JOX A;  2JVA A;  4WFT A;  1ZBQ A;  1WXR A;  4X66 E;  3HPZ A;  2E5L E;  2F4V E;  4KZS A;  2UUB E;  1ZBT A;  4OX9 E;  2V86 A;  4NXM E;  2RSM A;  4L5N C;  2L2N A;  3IWB A;  1GZ6 A;  2KHX A;  1XMQ E;  2UUC E;  3ADJ A;  4LFA E;  3HTX A;  2N3H A;  4LFB E;  4BMJ A;  4X62 E;  1YZ9 A;  2NA2 A;  2V8Q B;  4JI7 E;  1XMO E;  4DR7 E;  4DR3 E;  4YY3 E;  4DV6 E;  4WSP A;  2DIX A;  4B3S E;  5IT9 C;  3LML A;  4M2Z A;  4BS9 A;  3AUZ A;  2VQF E;  4B3R E;  2RS6 A;  4JI8 E;  4DV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...