3ADJA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
HGLCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords F21M12.9 protein
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 19
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adjA00
2VQEE 1N36E 1J5EE 4OX9E 4B3ME 1YZ9A 1XMQE 1DI2A 2IHR1 3P1XA 4DV4E 2UXBE 1ZBTA 4JI0E 4X8WA 5CFFE 1HNWE 2UUAE 5LMNE 2N3HA 1UILA 2L2MA 2RSMA 3ADGA 5LMUE 4DUZE 4DV3E 1X48A 4X64E 4DV2E 4DV7E 2NA2A 1YYWA 3ADJA 2MDRA 3C4BA 1T4OA 2LUPB 4JI4E 4X62E 2RS7A 1T4LB 1WHQA 2L3JA 4GKJE 3OTOE 1N32E 2JY9A 2LTSA 1J26A 2VQFE 3ADIA 3LLHA 4DV5E 4JYAE 2CPNA 1WHNA 1UHZA 1PKPA 4JV5E 4LF6E 2LBSB 2L2NA 1IBKE 1N34E 2F4VE 1FJGE 4YHHE 2UUBE 4LF4E 3T1YE 4JI3E 2NUFA 2UUCE 1XMOE 1N33E 4K0KE 2UXCE 1RQ0A 2B7VA 4LFAE 1STUA 1EKZA 1QU6A 2NUGA 3T1HE 2LUQA 2HHHE 4OOGC 4DR2E 1YYOA 1XNQE 2B3TB 2L33A 4LFCE 1O0WA 2KHXA 4LF9E 1XNRE 2ZM6E 2EZ6A 4KHPE 4JI8E 4LF7E 4DR7E 4LFBE 2LJHA 4NXNE 2B7TA 1FKAE 4YY3E 4B3SE 2DMYA 4JI1E 2UU9E 4M30A 3HTXA 4M2ZA 4B3TE 3ADLA 1I94E 5IWAE 1IBME 1GQEA 2L2KB 2DIXA 5BR8E 3VYXA 4DR5E 3VYYA 4DR1E 1X47A 4LF8E 1HNZE 2UXDE 4DUYE 4AQYE 4LF5E 2YT4A 4B3RE 4DR4E 4DV6E 2RS6A 4NXME 4DKKA 1HNXE 2L3CA 4DR6E 2DB2A 3J7Yp 4X65E 2NUEA 4X66E 1RC7A 4DR3E 1YYKA 4WFTA 4WYQB 4JI6E 1HR0E 2RTXA 2E5LE 1T4NA 4DV0E 1X49A 2LRSA 4DV1E 1IBLE 3C4TA 2JVAA 2N3GA 4JI5E 4JI2E 2LTRA 4GKKE 4JI7E
chains in the Genus database with same CATH superfamily
2CT1A 1ZR9A 3JU0A 2IHR1 5CFFE 2UUAE 2L92A 3ZOQB 1QNTA 2L2MA 1JK2A 2RSMA 4WSPA 4R2QA 3IWCA 1IQOA 2V87A 2WBTA 2M1SA 2EPAA 2ENHA 3K6QA 1PJTA 2F8BA 2LUPB 2VE7C 2EL5A 2LTSA 3BGHA 2DMIA 4F54A 2LVHA 2J7JA 4F2JC 2LT7A 1N3GA 4BC7A 4DV5E 1G2DC 2L6MA 4JYAE 2EPCA 2EE8A 2EPOA 2L2NA 4O5GA 2LJUA 2EOEA 2EOXA 4Q28A 3KZZA 4YHHE 2NUFA 2YPNA 2UXCE 2B7VA 5KL4A 1SR9A 1EKZA 2I13A 2NUGA 4F9CB 3F6HA 3IWBA 2LUQA 4DR2E 2EL6A 1A1FA 2ENCA 2KHXA 3FIGA 4LFBE 3J7AG 2LJHA 1X5WA 2EN3A 2DMYA 1EH7A 2DLKA 4NZVA 2EMXA 5IV8B 4P7DA 3ADLA 2JR1A 4ZYHA 2V88A 4WPYA 3VYXA 5BR8E 2EPKX 2EJ4A 4DR5E 2EOHA 2EPXA 2V83A 4BCAA 1X47A 1HNZE 2KONA 4LF5E 2R76A 2EN8A 2YTNA 1T39A 4L8NA 2EL4A 4O43A 4BBYA 2YTJA 4ZYGA 2K4VA 5IT9C 4DR6E 4WXDA 1B69A 4X66E 2LO3A 2ELYA 5KL2A 2YTQA 1YYKA 2EPPA 4WYQB 3F6GA 2EOZA 2RTXA 4DMIA 2E5LE 5KL7A 2BBGA 1IBLE 2LV2A 2N3GA 4Q35B 2EOYA 2LTRA 2JOXA 2BB8A 4BMJA 4R2RA 1N36E 2EOMA 2EM9A 2YU5A 5KL5A 2MC5A 1XMQE 1EH8A 4JI0E 4X8WA 4F9AB 3JAMC 4BS9A 3J80C 4R2SA 5LMUE 4DV3E 2EPUA 1PJQA 3KZYA 4X64E 2RQLA 4DV2E 2NA2A 1YPNA 1YYWA 2MDRA 1PJSA 1SFEA 2PRTA 1WHQA 2DRPA 1Z1BA 1IMUA 3LLHA 2M9AA 2VRDA 2DSYA 2EPLX 2YTIA 2EMBA 3TQMA 2I9IA 2EM5A 3OMLA 2HGHA 4LF6E 2LMZA 2EQ1A 1N34E 2WCC3 2F4VE 2MDGA 3LMLA 3J81C 4LF4E 3VHTB 1XMOE 1N33E 2EPNA 1L4SA 5A6BD 1UN6B 1YSAC 1G2FC 3EPHA 1STUA 1LLMC 5AC4A 2L8TA 3EQ1A 2HHHE 4WXCA 1MGTA 1XNQE 2B3TB 2L33A 4LFCE 1O0WA 2GHFA 4JI8E 4LF7E 4DR7E 3BIDA 3HXLA 1FKAE 3EPJA 2ODRD 1TN9A 1PDAA 2UU9E 1X3CA 2EN1A 4M2ZA 4B3TE 2EWLA 1IBME 1GQEA 2L2KB 4WX9A 2YTGA 3VYYA 4R03A 2A25A 4AQYE 4KZSA 5TSEA 4B3RE 2EQ0A 2EMHA 2MKDA 4M9VC 1WXRA 1UBDC 2EOIA 2V86A 1HNXE 2L3CA 2CTDA 2EMKA 2NUEA 2V8QB 2EOFA 2EM3A 3DJWA 5KL3A 4JI6E 2WBSA 3BBGA 2YRMA 2EN2A 4BC9A 3QG5C 2EM8A 4TUGA 1BB8A 4I8OA 2ELZA 2VF1A 1A1JA 1DI2A 3P1XA 4DV4E 2UXBE 1ZBTA 5DNYA 1HNWE 1BBGA 2JXPA 4P78A 5LMNE 2N3HA 2EOSA 3ADGA 2LE2A 3IWDA 1X48A 3MHHC 4BHCA 4DV7E 3ADJA 1MEYC 4R2PA 3C4BA 1A1LA 2EOJA 2ADRA 1X6FA 4JI4E 4X62E 2L3JA 4F9BB 2JY9A 2M7QA 5AE2A 3ADIA 2EOOA 5F3WA 3UK3C 2D9HA 4O4KA 2ODRC 2RPCA 1PKPA 1P47A 4JV5E 2LBSB 1IBKE 1DQ3A 2UUBE 3T1YE 5A6AA 4F6NA 4JI3E 2UUCE 4LFAE 1TF6A 2EMWA 1QU6A 1YFHA 4O24A 5FLXC 1AAYA 3HPZA 5A2QC 3EPLA 2ENAA 2EM7A 3T1HE 2N8XA 4OOGC 1YYOA 5AC5A 2WBUA 2FTXB 2EZ6A 2EN4A 2EPMX 2EORA 4LF9E 5LL6R 1NCSA 3MHSC 4YY3E 4GEQB 4KWYA 4B3SE 2YU8A 2KOUA 4ZYEA 5AASA 5A69A 4L5NC 1YUIA 2YSOA 2YTFA 2DGCA 4R2DA 5IWAE 2Q8UA 2DIXA 2YZTA 4DR1E 4LF8E 2EP3A 2UXDE 4DUYE 1KYQA 2YTDA 2EMYA 2YT4A 2EN6A 2GLIA 2EPRA 3H09A 1X6EA 4HTGA 4DKKA 3THNA 2DB2A 4GZNC 2YTOA 4X65E 2GPIA 4IS1C 2JPAA 1RC7A 4DR3E 4WFTA 3VK6A 2EM0A 2YWQA 4HEIA 1T4NA 4DV0E 1X49A 2EMLA 4DV1E 2EMZA 3C4TA 2JVAA 4M0VA 2K7IA 1KJKA 4JI7E 4FK5C 4NXNE 2VQEE 2EMIA 4RH8A 1J5EE 4OX9E 3C6MA 4B3ME 1YZ9A 1AH5A 2G7HA 2NABA 1UILA 2YTEA 2H36X 4DUZE 1A1IA 4NHRA 2JOBA 2CSHA 3KWRA 1WJPA 2M4IA 1BBOA 4J8ZA 1ZAAC 1T4OA 3JTZA 3MSWA 1JK1A 1A1HA 2RS7A 1T4LB 2R1FA 1TF3A 4GKJE 2EM2A 3OTOE 2JP9A 1N32E 4WSGA 2B9DA 1J26A 2VQFE 4R2CA 5ADZA 2JWOA 3C6KA 3BF2A 2CPNA 1WHNA 1UHZA 2EMCA 2JYAA 4TUIA 3DF6A 2V89A 1ZU1A 2EMGA 1T38A 1FJGE 2EPZA 2E72A 5A6JA 1A1GA 3RMPA 3AV0A 5T6JA 5IXMB 3M99B 2LCEA 4K0KE 2MC6A 3L00A 1RQ0A 2EM6A 2FV4B 4F6MA 2YRHA 2FGGA 3EPKA 2YSPA 4MLVA 4R2EA 2EOQA 4ZYDA 4LTYA 1XNRE 4KHPE 2YRKA 2ZM6E 2YTPA 3AUZA 2B7TA 3HPSA 5KL6A 4RHBB 5AE3A 2MKNA 1ZBQA 1RMDA 4JI1E 2EMAA 4M30A 2V85A 5AE1A 1GZ6A 3HQ1A 4BHBA 1X6HA 1A1KA 3HTXA 3ECRA 1I94E 4N4RB 1F2IG 3THOB 5A6KA 4R8OA 1GTKA 2HJJA 4IJDA 4LU9A 2EN7A 5A6BA 5LLQA 2WZOA 2EQ3A 1EH6A 1WRJA 4DR4E 2E1MA 2EM4A 4DV6E 4X9JA 2RS6A 4NXME 3J7Yp 4R2AA 1HR0E 1YUJA 2HC5A 4MLQA 2LRSA 1IQSA 2EMFA 4JI5E 4JI2E 2DLQA 1DGCA 1NEIA 4GKKE 2RSIA
chains in the Genus database with same CATH topology
2VQEE 4BMJA 1N36E 3JU0A 4TUGA 4I8OA 2MC5A 1J5EE 4OX9E 2VF1A 4B3ME 1XMQE 1YZ9A 1DI2A 2IHR1 3P1XA 4DV4E 2UXBE 1ZBTA 5DNYA 4JI0E 4X8WA 4F9AB 5CFFE 3JAMC 1HNWE 2UUAE 2L92A 5LMNE 4P78A 3ZOQB 4BS9A 2N3HA 3J80C 2G7HA 1UILA 2L2MA 2H36X 2RSMA 3ADGA 4WSPA 5LMUE 3IWCA 4DUZE 2LE2A 4DV3E 3IWDA 1X48A 2V87A 4X64E 4DV2E 2JOBA 4DV7E 2NA2A 1YYWA 3KWRA 3ADJA 2M1SA 2M4IA 2MDRA 3K6QA 3C4BA 4J8ZA 2F8BA 1T4OA 2JOXA 3JTZA 3MSWA 2LUPB 4JI4E 4X62E 2RS7A 1T4LB 1WHQA 2VE7C 2L3JA 4GKJE 4F9BB 3OTOE 2JY9A 1N32E 2LTSA 2M7QA 4F54A 2B9DA 5AE2A 2VQFE 3ADIA 1J26A 3LLHA 5ADZA 4BC7A 5F3WA 2DSYA 4DV5E 2JWOA 2L6MA 4JYAE 2ODRC 2CPNA 1WHNA 1UHZA 3OMLA 4TUIA 1PKPA 4JV5E 4LF6E 2LMZA 2V89A 3DF6A 2LBSB 2L2NA 1IBKE 1N34E 2F4VE 1FJGE 3LMLA 4YHHE 1DQ3A 4Q28A 3J81C 3T1YE 2UUBE 4JI3E 3RMPA 3AV0A 2NUFA 4LF4E 5T6JA 2UUCE 1XMOE 1N33E 4K0KE 2UXCE 2MC6A 1RQ0A 2B7VA 4LFAE 1SR9A 1STUA 1EKZA 1QU6A 5FLXC 2NUGA 4F9CB 3HPZA 2FV4B 5A2QC 2L8TA 3F6HA 2FGGA 3T1HE 3IWBA 2LUQA 2HHHE 4OOGC 4DR2E 1YYOA 1XNQE 2B3TB 2FTXB 2L33A 1O0WA 2KHXA 4LTYA 4LF9E 2ZM6E 3FIGA 4LFCE 1XNRE 4JI8E 4LF7E 4KHPE 4DR7E 4LFBE 5LL6R 2LJHA 4NXNE 3J7AG 3AUZA 2B7TA 3HXLA 4YY3E 4GEQB 3HPSA 1FKAE 4B3SE 2KOUA 5AASA 2DMYA 5AE3A 1ZBQA 2ODRD 4L5NC 4JI1E 2UU9E 4M30A 2V85A 5AE1A 1GZ6A 3HQ1A 3HTXA 4M2ZA 4P7DA 4B3TE 1I94E 3ADLA 2EWLA 5IWAE 2JR1A 2V88A 1IBME 1GQEA 4WPYA 2DIXA 2YZTA 5BR8E 2L2KB 3VYXA 4DR5E 3VYYA 4R03A 2V83A 4BCAA 1X47A 4R8OA 4DR1E 4LF8E 1HNZE 2KONA 2UXDE 4DUYE 4KZSA 4AQYE 4LU9A 4LF5E 2WZOA 2YT4A 4B3RE 4DR4E 2E1MA 3H09A 1WXRA 4DV6E 4L8NA 2V86A 2RS6A 4NXME 4DKKA 1HNXE 4BBYA 2L3CA 2DB2A 2K4VA 3J7Yp 5IT9C 4X65E 4DR6E 2NUEA 4X66E 1RC7A 2V8QB 4DR3E 1YYKA 4WFTA 3DJWA 3VK6A 4WYQB 3F6GA 1HR0E 4JI6E 2RTXA 4DMIA 2E5LE 1T4NA 4DV0E 1X49A 4GKKE 2LRSA 4DV1E 1IBLE 3C4TA 2JVAA 2N3GA 4M0VA 4JI5E 4JI2E 2EZ6A 2LTRA 4BC9A 4JI7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE E;  1N36 E;  1J5E E;  4OX9 E;  4B3M E;  1YZ9 A;  1XMQ E;  1DI2 A;  2IHR 1;  3P1X A;  4DV4 E;  2UXB E;  1ZBT A;  4JI0 E;  4X8W A;  5CFF E;  1HNW E;  2UUA E;  5LMN E;  2N3H A;  1UIL A;  2L2M A;  2RSM A;  3ADG A;  5LMU E;  4DUZ E;  4DV3 E;  1X48 A;  4X64 E;  4DV2 E;  4DV7 E;  2NA2 A;  1YYW A;  3ADJ A;  2MDR A;  3C4B A;  1T4O A;  2LUP B;  4JI4 E;  4X62 E;  2RS7 A;  1T4L B;  1WHQ A;  2L3J A;  4GKJ E;  3OTO E;  1N32 E;  2JY9 A;  2LTS A;  1J26 A;  2VQF E;  3ADI A;  3LLH A;  4DV5 E;  4JYA E;  2CPN A;  1WHN A;  1UHZ A;  1PKP A;  4JV5 E;  4LF6 E;  2LBS B;  2L2N A;  1IBK E;  1N34 E;  2F4V E;  1FJG E;  4YHH E;  2UUB E;  4LF4 E;  3T1Y E;  4JI3 E;  2NUF A;  2UUC E;  1XMO E;  1N33 E;  4K0K E;  2UXC E;  1RQ0 A;  2B7V A;  4LFA E;  1STU A;  1EKZ A;  1QU6 A;  2NUG A;  3T1H E;  2LUQ A;  2HHH E;  4OOG C;  4DR2 E;  1YYO A;  1XNQ E;  2B3T B;  2L33 A;  4LFC E;  1O0W A;  2KHX A;  4LF9 E;  1XNR E;  2ZM6 E;  2EZ6 A;  4KHP E;  4JI8 E;  4LF7 E;  4DR7 E;  4LFB E;  2LJH A;  4NXN E;  2B7T A;  1FKA E;  4YY3 E;  4B3S E;  2DMY A;  4JI1 E;  2UU9 E;  4M30 A;  3HTX A;  4M2Z A;  4B3T E;  3ADL A;  1I94 E;  5IWA E;  1IBM E;  1GQE A;  2L2K B;  2DIX A;  5BR8 E;  3VYX A;  4DR5 E;  3VYY A;  4DR1 E;  1X47 A;  4LF8 E;  1HNZ E;  2UXD E;  4DUY E;  4AQY E;  4LF5 E;  2YT4 A;  4B3R E;  4DR4 E;  4DV6 E;  2RS6 A;  4NXM E;  4DKK A;  1HNX E;  2L3C A;  4DR6 E;  2DB2 A;  3J7Y p;  4X65 E;  2NUE A;  4X66 E;  1RC7 A;  4DR3 E;  1YYK A;  4WFT A;  4WYQ B;  4JI6 E;  1HR0 E;  2RTX A;  2E5L E;  1T4N A;  4DV0 E;  1X49 A;  2LRS A;  4DV1 E;  1IBL E;  3C4T A;  2JVA A;  2N3G A;  4JI5 E;  4JI2 E;  2LTR A;  4GKK E;  4JI7 E; 
#chains in the Genus database with same CATH topology
 2CT1 A;  1ZR9 A;  3JU0 A;  2IHR 1;  5CFF E;  2UUA E;  2L92 A;  3ZOQ B;  1QNT A;  2L2M A;  1JK2 A;  2RSM A;  4WSP A;  4R2Q A;  3IWC A;  1IQO A;  2V87 A;  2WBT A;  2M1S A;  2EPA A;  2ENH A;  3K6Q A;  1PJT A;  2F8B A;  2LUP B;  2VE7 C;  2EL5 A;  2LTS A;  3BGH A;  2DMI A;  4F54 A;  2LVH A;  2J7J A;  4F2J C;  2LT7 A;  1N3G A;  4BC7 A;  4DV5 E;  1G2D C;  2L6M A;  4JYA E;  2EPC A;  2EE8 A;  2EPO A;  2L2N A;  4O5G A;  2LJU A;  2EOE A;  2EOX A;  4Q28 A;  3KZZ A;  4YHH E;  2NUF A;  2YPN A;  2UXC E;  2B7V A;  5KL4 A;  1SR9 A;  1EKZ A;  2I13 A;  2NUG A;  4F9C B;  3F6H A;  3IWB A;  2LUQ A;  4DR2 E;  2EL6 A;  1A1F A;  2ENC A;  2KHX A;  3FIG A;  4LFB E;  3J7A G;  2LJH A;  1X5W A;  2EN3 A;  2DMY A;  1EH7 A;  2DLK A;  4NZV A;  2EMX A;  5IV8 B;  4P7D A;  3ADL A;  2JR1 A;  4ZYH A;  2V88 A;  4WPY A;  3VYX A;  5BR8 E;  2EPK X;  2EJ4 A;  4DR5 E;  2EOH A;  2EPX A;  2V83 A;  4BCA A;  1X47 A;  1HNZ E;  2KON A;  4LF5 E;  2R76 A;  2EN8 A;  2YTN A;  1T39 A;  4L8N A;  2EL4 A;  4O43 A;  4BBY A;  2YTJ A;  4ZYG A;  2K4V A;  5IT9 C;  4DR6 E;  4WXD A;  1B69 A;  4X66 E;  2LO3 A;  2ELY A;  5KL2 A;  2YTQ A;  1YYK A;  2EPP A;  4WYQ B;  3F6G A;  2EOZ A;  2RTX A;  4DMI A;  2E5L E;  5KL7 A;  2BBG A;  1IBL E;  2LV2 A;  2N3G A;  4Q35 B;  2EOY A;  2LTR A;  2JOX A;  2BB8 A;  4BMJ A;  4R2R A;  1N36 E;  2EOM A;  2EM9 A;  2YU5 A;  5KL5 A;  2MC5 A;  1XMQ E;  1EH8 A;  4JI0 E;  4X8W A;  4F9A B;  3JAM C;  4BS9 A;  3J80 C;  4R2S A;  5LMU E;  4DV3 E;  2EPU A;  1PJQ A;  3KZY A;  4X64 E;  2RQL A;  4DV2 E;  2NA2 A;  1YPN A;  1YYW A;  2MDR A;  1PJS A;  1SFE A;  2PRT A;  1WHQ A;  2DRP A;  1Z1B A;  1IMU A;  3LLH A;  2M9A A;  2VRD A;  2DSY A;  2EPL X;  2YTI A;  2EMB A;  3TQM A;  2I9I A;  2EM5 A;  3OML A;  2HGH A;  4LF6 E;  2LMZ A;  2EQ1 A;  1N34 E;  2WCC 3;  2F4V E;  2MDG A;  3LML A;  3J81 C;  4LF4 E;  3VHT B;  1XMO E;  1N33 E;  2EPN A;  1L4S A;  5A6B D;  1UN6 B;  1YSA C;  1G2F C;  3EPH A;  1STU A;  1LLM C;  5AC4 A;  2L8T A;  3EQ1 A;  2HHH E;  4WXC A;  1MGT A;  1XNQ E;  2B3T B;  2L33 A;  4LFC E;  1O0W A;  2GHF A;  4JI8 E;  4LF7 E;  4DR7 E;  3BID A;  3HXL A;  1FKA E;  3EPJ A;  2ODR D;  1TN9 A;  1PDA A;  2UU9 E;  1X3C A;  2EN1 A;  4M2Z A;  4B3T E;  2EWL A;  1IBM E;  1GQE A;  2L2K B;  4WX9 A;  2YTG A;  3VYY A;  4R03 A;  2A25 A;  4AQY E;  4KZS A;  5TSE A;  4B3R E;  2EQ0 A;  2EMH A;  2MKD A;  4M9V C;  1WXR A;  1UBD C;  2EOI A;  2V86 A;  1HNX E;  2L3C A;  2CTD A;  2EMK A;  2NUE A;  2V8Q B;  2EOF A;  2EM3 A;  3DJW A;  5KL3 A;  4JI6 E;  2WBS A;  3BBG A;  2YRM A;  2EN2 A;  4BC9 A;  3QG5 C;  2EM8 A;  4TUG A;  1BB8 A;  4I8O A;  2ELZ A;  2VF1 A;  1A1J A;  1DI2 A;  3P1X A;  4DV4 E;  2UXB E;  1ZBT A;  5DNY A;  1HNW E;  1BBG A;  2JXP A;  4P78 A;  5LMN E;  2N3H A;  2EOS A;  3ADG A;  2LE2 A;  3IWD A;  1X48 A;  3MHH C;  4BHC A;  4DV7 E;  3ADJ A;  1MEY C;  4R2P A;  3C4B A;  1A1L A;  2EOJ A;  2ADR A;  1X6F A;  4JI4 E;  4X62 E;  2L3J A;  4F9B B;  2JY9 A;  2M7Q A;  5AE2 A;  3ADI A;  2EOO A;  5F3W A;  3UK3 C;  2D9H A;  4O4K A;  2ODR C;  2RPC A;  1PKP A;  1P47 A;  4JV5 E;  2LBS B;  1IBK E;  1DQ3 A;  2UUB E;  3T1Y E;  5A6A A;  4F6N A;  4JI3 E;  2UUC E;  4LFA E;  1TF6 A;  2EMW A;  1QU6 A;  1YFH A;  4O24 A;  5FLX C;  1AAY A;  3HPZ A;  5A2Q C;  3EPL A;  2ENA A;  2EM7 A;  3T1H E;  2N8X A;  4OOG C;  1YYO A;  5AC5 A;  2WBU A;  2FTX B;  2EZ6 A;  2EN4 A;  2EPM X;  2EOR A;  4LF9 E;  5LL6 R;  1NCS A;  3MHS C;  4YY3 E;  4GEQ B;  4KWY A;  4B3S E;  2YU8 A;  2KOU A;  4ZYE A;  5AAS A;  5A69 A;  4L5N C;  1YUI A;  2YSO A;  2YTF A;  2DGC A;  4R2D A;  5IWA E;  2Q8U A;  2DIX A;  2YZT A;  4DR1 E;  4LF8 E;  2EP3 A;  2UXD E;  4DUY E;  1KYQ A;  2YTD A;  2EMY A;  2YT4 A;  2EN6 A;  2GLI A;  2EPR A;  3H09 A;  1X6E A;  4HTG A;  4DKK A;  3THN A;  2DB2 A;  4GZN C;  2YTO A;  4X65 E;  2GPI A;  4IS1 C;  2JPA A;  1RC7 A;  4DR3 E;  4WFT A;  3VK6 A;  2EM0 A;  2YWQ A;  4HEI A;  1T4N A;  4DV0 E;  1X49 A;  2EML A;  4DV1 E;  2EMZ A;  3C4T A;  2JVA A;  4M0V A;  2K7I A;  1KJK A;  4JI7 E;  4FK5 C;  4NXN E;  2VQE E;  2EMI A;  4RH8 A;  1J5E E;  4OX9 E;  3C6M A;  4B3M E;  1YZ9 A;  1AH5 A;  2G7H A;  2NAB A;  1UIL A;  2YTE A;  2H36 X;  4DUZ E;  1A1I A;  4NHR A;  2JOB A;  2CSH A;  3KWR A;  1WJP A;  2M4I A;  1BBO A;  4J8Z A;  1ZAA C;  1T4O A;  3JTZ A;  3MSW A;  1JK1 A;  1A1H A;  2RS7 A;  1T4L B;  2R1F A;  1TF3 A;  4GKJ E;  2EM2 A;  3OTO E;  2JP9 A;  1N32 E;  4WSG A;  2B9D A;  1J26 A;  2VQF E;  4R2C A;  5ADZ A;  2JWO A;  3C6K A;  3BF2 A;  2CPN A;  1WHN A;  1UHZ A;  2EMC A;  2JYA A;  4TUI A;  3DF6 A;  2V89 A;  1ZU1 A;  2EMG A;  1T38 A;  1FJG E;  2EPZ A;  2E72 A;  5A6J A;  1A1G A;  3RMP A;  3AV0 A;  5T6J A;  5IXM B;  3M99 B;  2LCE A;  4K0K E;  2MC6 A;  3L00 A;  1RQ0 A;  2EM6 A;  2FV4 B;  4F6M A;  2YRH A;  2FGG A;  3EPK A;  2YSP A;  4MLV A;  4R2E A;  2EOQ A;  4ZYD A;  4LTY A;  1XNR E;  4KHP E;  2YRK A;  2ZM6 E;  2YTP A;  3AUZ A;  2B7T A;  3HPS A;  5KL6 A;  4RHB B;  5AE3 A;  2MKN A;  1ZBQ A;  1RMD A;  4JI1 E;  2EMA A;  4M30 A;  2V85 A;  5AE1 A;  1GZ6 A;  3HQ1 A;  4BHB A;  1X6H A;  1A1K A;  3HTX A;  3ECR A;  1I94 E;  4N4R B;  1F2I G;  3THO B;  5A6K A;  4R8O A;  1GTK A;  2HJJ A;  4IJD A;  4LU9 A;  2EN7 A;  5A6B A;  5LLQ A;  2WZO A;  2EQ3 A;  1EH6 A;  1WRJ A;  4DR4 E;  2E1M A;  2EM4 A;  4DV6 E;  4X9J A;  2RS6 A;  4NXM E;  3J7Y p;  4R2A A;  1HR0 E;  1YUJ A;  2HC5 A;  4MLQ A;  2LRS A;  1IQS A;  2EMF A;  4JI5 E;  4JI2 E;  2DLQ A;  1DGC A;  1NEI A;  4GKK E;  2RSI A; 
#chains in the Genus database with same CATH homology
 2VQE E;  4BMJ A;  1N36 E;  3JU0 A;  4TUG A;  4I8O A;  2MC5 A;  1J5E E;  4OX9 E;  2VF1 A;  4B3M E;  1XMQ E;  1YZ9 A;  1DI2 A;  2IHR 1;  3P1X A;  4DV4 E;  2UXB E;  1ZBT A;  5DNY A;  4JI0 E;  4X8W A;  4F9A B;  5CFF E;  3JAM C;  1HNW E;  2UUA E;  2L92 A;  5LMN E;  4P78 A;  3ZOQ B;  4BS9 A;  2N3H A;  3J80 C;  2G7H A;  1UIL A;  2L2M A;  2H36 X;  2RSM A;  3ADG A;  4WSP A;  5LMU E;  3IWC A;  4DUZ E;  2LE2 A;  4DV3 E;  3IWD A;  1X48 A;  2V87 A;  4X64 E;  4DV2 E;  2JOB A;  4DV7 E;  2NA2 A;  1YYW A;  3KWR A;  3ADJ A;  2M1S A;  2M4I A;  2MDR A;  3K6Q A;  3C4B A;  4J8Z A;  2F8B A;  1T4O A;  2JOX A;  3JTZ A;  3MSW A;  2LUP B;  4JI4 E;  4X62 E;  2RS7 A;  1T4L B;  1WHQ A;  2VE7 C;  2L3J A;  4GKJ E;  4F9B B;  3OTO E;  2JY9 A;  1N32 E;  2LTS A;  2M7Q A;  4F54 A;  2B9D A;  5AE2 A;  2VQF E;  3ADI A;  1J26 A;  3LLH A;  5ADZ A;  4BC7 A;  5F3W A;  2DSY A;  4DV5 E;  2JWO A;  2L6M A;  4JYA E;  2ODR C;  2CPN A;  1WHN A;  1UHZ A;  3OML A;  4TUI A;  1PKP A;  4JV5 E;  4LF6 E;  2LMZ A;  2V89 A;  3DF6 A;  2LBS B;  2L2N A;  1IBK E;  1N34 E;  2F4V E;  1FJG E;  3LML A;  4YHH E;  1DQ3 A;  4Q28 A;  3J81 C;  3T1Y E;  2UUB E;  4JI3 E;  3RMP A;  3AV0 A;  2NUF A;  4LF4 E;  5T6J A;  2UUC E;  1XMO E;  1N33 E;  4K0K E;  2UXC E;  2MC6 A;  1RQ0 A;  2B7V A;  4LFA E;  1SR9 A;  1STU A;  1EKZ A;  1QU6 A;  5FLX C;  2NUG A;  4F9C B;  3HPZ A;  2FV4 B;  5A2Q C;  2L8T A;  3F6H A;  2FGG A;  3T1H E;  3IWB A;  2LUQ A;  2HHH E;  4OOG C;  4DR2 E;  1YYO A;  1XNQ E;  2B3T B;  2FTX B;  2L33 A;  1O0W A;  2KHX A;  4LTY A;  4LF9 E;  2ZM6 E;  3FIG A;  4LFC E;  1XNR E;  4JI8 E;  4LF7 E;  4KHP E;  4DR7 E;  4LFB E;  5LL6 R;  2LJH A;  4NXN E;  3J7A G;  3AUZ A;  2B7T A;  3HXL A;  4YY3 E;  4GEQ B;  3HPS A;  1FKA E;  4B3S E;  2KOU A;  5AAS A;  2DMY A;  5AE3 A;  1ZBQ A;  2ODR D;  4L5N C;  4JI1 E;  2UU9 E;  4M30 A;  2V85 A;  5AE1 A;  1GZ6 A;  3HQ1 A;  3HTX A;  4M2Z A;  4P7D A;  4B3T E;  1I94 E;  3ADL A;  2EWL A;  5IWA E;  2JR1 A;  2V88 A;  1IBM E;  1GQE A;  4WPY A;  2DIX A;  2YZT A;  5BR8 E;  2L2K B;  3VYX A;  4DR5 E;  3VYY A;  4R03 A;  2V83 A;  4BCA A;  1X47 A;  4R8O A;  4DR1 E;  4LF8 E;  1HNZ E;  2KON A;  2UXD E;  4DUY E;  4KZS A;  4AQY E;  4LU9 A;  4LF5 E;  2WZO A;  2YT4 A;  4B3R E;  4DR4 E;  2E1M A;  3H09 A;  1WXR A;  4DV6 E;  4L8N A;  2V86 A;  2RS6 A;  4NXM E;  4DKK A;  1HNX E;  4BBY A;  2L3C A;  2DB2 A;  2K4V A;  3J7Y p;  5IT9 C;  4X65 E;  4DR6 E;  2NUE A;  4X66 E;  1RC7 A;  2V8Q B;  4DR3 E;  1YYK A;  4WFT A;  3DJW A;  3VK6 A;  4WYQ B;  3F6G A;  1HR0 E;  4JI6 E;  2RTX A;  4DMI A;  2E5L E;  1T4N A;  4DV0 E;  1X49 A;  4GKK E;  2LRS A;  4DV1 E;  1IBL E;  3C4T A;  2JVA A;  2N3G A;  4M0V A;  4JI5 E;  4JI2 E;  2EZ6 A;  2LTR A;  4BC9 A;  4JI7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...