3ADJA

Structure of arabidopsis hyl1 and its molecular implications for mirna processing
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
b'HGLCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F21M12.9 protein
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 19
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adjA00
2LTSA 1IBME 4KHPE 4M30A 1WHQA 3VYYA 2LRSA 3ADIA 1STUA 2ZM6E 2DIXA 2L33A 3OTOE 1XNQE 1X49A 2L3CA 2NUEA 4B3RE 4JI7E 4X65E 1UHZA 4DR5E 4OX9E 4M2ZA 2UU9E 4LF6E 2CPNA 2L3JA 2N3GA 2LTRA 4NXME 1ZBTA 2E5LE 4LF7E 4LFAE 3HTXA 4JI8E 4JI5E 4GKJE 1HNWE 1O0WA 1YYOA 1HR0E 3C4BA 4JI6E 4WFTA 3ADJA 4WYQB 1WHNA 1N36E 2NUGA 4DR7E 1QU6A 4LFBE 5LMNE 4JI1E 1UILA 4DV4E 1XNRE 2MDRA 3LLHA 2NA2A 2VQEE 2UUBE 4OOGC 4DV5E 1YZ9A 2B7TA 3C4TA 2L2MA 2UUCE 1FJGE 3J7Yp 1GQEA 4DV7E 2UXDE 2NUFA 4NXNE 1PKPA 1FKAE 2F4VE 1J5EE 2UXCE 4X64E 4DR1E 3VYXA 4DV2E 4X66E 2N3HA 2B7VA 2HHHE 4JI3E 2RS6A 4LFCE 4X8WA 1T4NA 4DR3E 4B3SE 3ADLA 4GKKE 2LBSB 2UUAE 4X62E 1XMQE 1HNZE 1DI2A 1J26A 5CFFE 5IWAE 1N33E 1I94E 4LF5E 4DV1E 4JYAE 4JI4E 3ADGA 1RC7A 4JI2E 4LF8E 1IBLE 2LUPB 4B3ME 4LF9E 2LJHA 4JV5E 1YYKA 5BR8E 4DR2E 4JI0E 2VQFE 2RTXA 2JVAA 4DV0E 1HNXE 4B3TE 4DUZE 2UXBE 1YYWA 2L2KB 4LF4E 2DB2A 2LUQA 4K0KE 1XMOE 4YY3E 1N34E 1EKZA 2KHXA 1X48A 4DUYE 2YT4A 5LMUE 2DMYA 4YHHE 1IBKE 2RS7A 1X47A 1N32E 2L2NA 1T4OA 4DR6E 3T1HE 2IHR1 3T1YE 2EZ6A 2JY9A 4DV3E 1RQ0A 2B3TB 4DV6E 1T4LB 4AQYE 4DKKA 4DR4E 2RSMA 3P1XA
chains in the Genus database with same CATH superfamily
2MKNA 1IBME 1ZAAC 4ZYEA 3TQMA 2MC5A 5KL2A 2LE2A 1STUA 2RPCA 1YFHA 5ADZA 5AC4A 2EN6A 3OTOE 2NUEA 4B3RE 3K6QA 4OX9E 4M2ZA 1X6EA 4LF6E 4R2CA 2CPNA 2KOUA 2MKDA 2N3GA 2L3JA 1T38A 1ZBTA 4BMJA 2JYAA 4GEQB 5IV8B 4JI8E 4JI5E 5A69A 2HGHA 1TN9A 2EOZA 1X3CA 4WFTA 3MSWA 1IQSA 2EN8A 4HTGA 2EM8A 2ENHA 4DV4E 2MDRA 1PDAA 2RSIA 2J7JA 2VQEE 4M0VA 1YSAC 2EQ3A 2B7TA 2YTIA 2L2MA 2YTQA 1FJGE 3RMPA 3HXLA 4M9VC 4BS9A 2DSYA 1FKAE 1IMUA 4X64E 4DR1E 2MC6A 1BB8A 4X66E 3J7AG 2FV4B 2YTOA 2B7VA 2EMWA 4J8ZA 5TSEA 2DRPA 1ZR9A 1DI2A 2CSHA 1XMQE 5IWAE 4TUGA 2EORA 4LF5E 4DV1E 5F3WA 3ADGA 4JI2E 2WBTA 2LJHA 4JV5E 1A1LA 5IXMB 2Q8UA 3KZZA 1YYKA 5BR8E 4KZSA 4JI0E 2EPRA 2V8QB 2RTXA 4DV0E 4IS1C 2HC5A 5AASA 1HNXE 2EMGA 1B69A 1YUIA 4B3TE 2V83A 1A1FA 1T39A 2DLQA 1MGTA 2EPUA 2HJJA 5A6KA 1XMOE 2YPNA 1EKZA 2FGGA 1IBKE 2FTXB 3T1HE 2BBGA 2CTDA 5A6BD 5KL6A 4L5NC 1T4LB 4KWYA 3H09A 4AQYE 4DR4E 2F8BA 2M7QA 1EH7A 2R76A 2LTSA 2YTFA 4M30A 2LVHA 3VHTB 3VYYA 2V89A 5FLXC 1QNTA 1SFEA 1ZU1A 2EM9A 1XNQE 5AE1A 2JR1A 1BBOA 2EOEA 2VE7C 4R2RA 4MLVA 4R2AA 4NXME 3L00A 2BB8A 3MHSC 1KYQA 3BF2A 2EPNA 1EH8A 2ADRA 4LTYA 1HNWE 1NEIA 1O0WA 2VRDA 2NUGA 3ADJA 2YWQA 1UILA 2M4IA 1EH6A 2NA2A 1DGCA 3EQ1A 1YZ9A 5T6JA 2JWOA 2EPPA 2UUCE 2EM6A 2YTJA 1LLMC 3J7Yp 2YSOA 1X5WA 4BC7A 2EE8A 1P47A 2UXCE 2K7IA 3VYXA 2EPCA 2EL4A 2LV2A 2RQLA 5AE2A 1WRJA 1JK2A 2YZTA 2HHHE 2JP9A 2RS6A 4DR3E 1UBDC 2M1SA 3J81C 1HNZE 2JOBA 2V86A 5CFFE 1N33E 1I94E 5AE3A 4JYAE 4JI4E 4DMIA 1ZBQA 4R03A 2EOQA 4NZVA 4WPYA 1G2DC 4R2QA 2EM4A 1A1JA 3BGHA 5KL7A 2H36X 5IT9C 2VQFE 2EPOA 3F6HA 3HPZA 4O43A 2WBSA 3EPJA 2JVAA 4P7DA 2EOHA 2UXBE 2L2KB 3ECRA 2YU8A 2EMKA 2EPMX 4K0KE 2LO3A 3IWCA 2YT4A 2EPAA 3JTZA 4LU9A 2K4VA 2DMYA 4WXCA 1RMDA 1N32E 4DR6E 2LMZA 2CT1A 2JY9A 3J80C 2LT7A 2ELYA 4BHCA 4GZNC 1A1KA 4DKKA 3KWRA 2RSMA 3P1XA 5KL4A 4I8OA 1WHQA 2ODRC 2EMIA 2EMLA 2I9IA 2LRSA 4ZYDA 3ADIA 2ZM6E 2DIXA 4WSPA 2L33A 2YTDA 2EM2A 1A1IA 2L3CA 3HPSA 2B9DA 4X65E 2EL5A 2EMZA 1PJTA 4ZYGA 2EM5A 2EL6A 2ENAA 4WX9A 2LTRA 2WZOA 5KL5A 1IQOA 4WXDA 2EN7A 2YTGA 1AAYA 1UN6B 3HTXA 2ENCA 4GKJE 1HR0E 4JI6E 4TUIA 4WYQB 2EOFA 1N36E 1QU6A 1YPNA 1XNRE 2GLIA 2G7HA 2EPLX 2WBUA 5AC5A 2YSPA 4R8OA 2UUBE 3AV0A 4OOGC 3OMLA 2ELZA 3C4TA 1L4SA 2V88A 1GQEA 2EM3A 2NUFA 5LL6R 4F9BB 1YUJA 2NABA 1J5EE 2I13A 4DV2E 2N3HA 4F6NA 4JI3E 4X8WA 1T4NA 4B3SE 3ADLA 2KONA 4GKKE 2UUAE 4X62E 2ODRD 3HQ1A 1F2IG 3IWDA 1TF6A 1RC7A 2YRMA 3F6GA 4O5GA 4R2DA 1IBLE 2LUPB 4B3ME 4Q35B 5A2QC 2DLKA 1GZ6A 4BC9A 4DR2E 4BBYA 4RHBB 2L8TA 4FK5C 3UK3C 2D9HA 4F2JC 3M99B 3FIGA 2L92A 1NCSA 4NHRA 4DUZE 1YYWA 1N3GA 1WJPA 2EOMA 2JOXA 4LF4E 2EWLA 2YU5A 4MLQA 1N34E 4YY3E 2KHXA 3DJWA 4R2PA 3EPHA 5LMUE 2RS7A 2PRTA 2DGCA 1X47A 2L2NA 1T4OA 2YRHA 2EN4A 2IHR1 2EZ6A 2GPIA 4DV3E 1RQ0A 4Q28A 2B3TB 4DV6E 3DF6A 1PJSA 1BBGA 2LCEA 2EPKX 4HEIA 3EPLA 2EM0A 2L6MA 1MEYC 2YRKA 3KZYA 4X9JA 2GHFA 2EN3A 4KHPE 3JAMC 4R2EA 2V87A 4WSGA 2EOYA 1SR9A 2EMBA 4O4KA 4P78A 3LMLA 1X49A 3THNA 2YTPA 4JI7E 4R2SA 1UHZA 4DR5E 1GTKA 2UU9E 2EPZA 2EMCA 4L8NA 4BCAA 2E5LE 4LF7E 2EMHA 4LFAE 2JXPA 2YTNA 4N4RB 1YYOA 4ZYHA 2N8XA 3C4BA 1WHNA 1A1HA 4DR7E 3EPKA 4LFBE 2EOXA 5LMNE 4JI1E 3BBGA 2EJ4A 3C6MA 3LLHA 3VK6A 5A6JA 5KL3A 3THOB 2EOIA 4F9AB 1G2FC 2JPAA 2VF1A 4DV5E 2MDGA 3MHHC 4DV7E 2UXDE 4F54A 2LJUA 2EOOA 4NXNE 1PKPA 2EN1A 2F4VE 1KJKA 4F9CB 4O24A 5A6AA 2EQ0A 2EMFA 4LFCE 2A25A 2V85A 2LBSB 1J26A 2E72A 4LF8E 2EOSA 3IWBA 5LLQA 4LF9E 2EPXA 1A1GA 1TF3A 2E1MA 3ZOQB 2EOJA 2DMIA 2EMXA 2M9AA 2EN2A 1X6HA 2R1FA 2WCC3 3JU0A 2EQ1A 3AUZA 1WXRA 1Z1BA 3BIDA 2DB2A 2EMAA 1AH5A 3C6KA 5A6BA 3QG5C 1X48A 1X6FA 2EM7A 2EMYA 4DUYE 1JK1A 4YHHE 1DQ3A 5DNYA 2EP3A 4F6MA 3T1YE 4BHBA 2YTEA 1PJQA 4RH8A 4IJDA 2LUQA
chains in the Genus database with same CATH topology
2M7QA 2LTSA 2L6MA 1IBME 4I8OA 4KHPE 4M30A 1WHQA 2ODRC 2MC5A 3JAMC 3VYYA 2V89A 2LRSA 2LE2A 3ADIA 1STUA 2V87A 2DIXA 4WSPA 5FLXC 2ZM6E 2L33A 5ADZA 1SR9A 4P78A 3LMLA 3OTOE 1XNQE 1X49A 2L3CA 2NUEA 4B3RE 5AE1A 3HPSA 2B9DA 2JR1A 1UHZA 4JI7E 3K6QA 4X65E 4DR5E 2VE7C 4M2ZA 4OX9E 2UU9E 4LF6E 2RSMA 2CPNA 2KOUA 2N3GA 2L3JA 2LTRA 4L8NA 1ZBTA 4BCAA 4BMJA 4NXME 2WZOA 2E5LE 4LF7E 4LFAE 4GEQB 4LTYA 3HTXA 4JI8E 4JI5E 4GKJE 1HNWE 1O0WA 1YYOA 1HR0E 3C4BA 4TUIA 4WFTA 3ADJA 4WYQB 1WHNA 3MSWA 1N36E 4JI6E 2NUGA 1QU6A 4DR7E 5LMNE 4JI1E 4LFBE 1UILA 2M4IA 4DV4E 1XNRE 2MDRA 2G7HA 3LLHA 2NA2A 3VK6A 2VQEE 4M0VA 4F9AB 2VF1A 4R8OA 3AV0A 2UUBE 4OOGC 4DV5E 1YZ9A 3OMLA 2B7TA 5T6JA 2JWOA 3C4TA 2L2MA 2UUCE 1FJGE 2V88A 3RMPA 3HXLA 3J7Yp 1GQEA 4DV7E 2UXDE 4F54A 2NUFA 4NXNE 4BS9A 2DSYA 1PKPA 4BC7A 5LL6R 4F9BB 1FKAE 4DR4E 2F4VE 1J5EE 2UXCE 4X64E 4DR1E 4F9CB 3VYXA 2MC6A 4DV2E 5AE2A 2N3HA 4X66E 2FV4B 3J7AG 2YZTA 2B7VA 4J8ZA 2HHHE 4JI3E 2RS6A 4LFCE 4X8WA 1T4NA 4DR3E 4B3SE 3ADLA 2KONA 4GKKE 2M1SA 2V85A 3J81C 2LBSB 2UUAE 4X62E 1XMQE 1HNZE 2JOBA 1DI2A 2ODRD 1J26A 2V86A 5CFFE 5IWAE 3HQ1A 4TUGA 1I94E 4LF5E 1N33E 5AE3A 4DV1E 5F3WA 3IWDA 3ADGA 4DMIA 4JI4E 1RC7A 4JI2E 4LF8E 3F6GA 1ZBQA 1IBLE 3IWBA 4R03A 4WPYA 2LUPB 4B3ME 4LF9E 2LJHA 2E1MA 4JV5E 3ZOQB 5A2QC 1YYKA 1GZ6A 2H36X 5BR8E 4KZSA 4BC9A 4DR2E 4JI0E 4BBYA 5IT9C 2V8QB 2VQFE 3HPZA 3F6HA 2L8TA 2RTXA 2JVAA 4DV0E 5AASA 3JU0A 1HNXE 4P7DA 3FIGA 4B3TE 2L92A 2V83A 3AUZA 1WXRA 4DUZE 2UXBE 1YYWA 2L2KB 4LF4E 2DB2A 2JOXA 2EWLA 4K0KE 1XMOE 3IWCA 4YY3E 1N34E 1EKZA 2KHXA 1X48A 3DJWA 4DUYE 2YT4A 2FGGA 5LMUE 3JTZA 4LU9A 2K4VA 2DMYA 1DQ3A 5DNYA 4YHHE 2RS7A 1IBKE 1X47A 1N32E 2L2NA 2LMZA 1T4OA 2FTXB 4DR6E 3T1HE 4JYAE 2IHR1 3T1YE 2EZ6A 2JY9A 4DV3E 1RQ0A 4Q28A 3J80C 2B3TB 4L5NC 4DV6E 1T4LB 3DF6A 3H09A 4AQYE 4DKKA 3KWRA 2LUQA 2F8BA 3P1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTS A;  1IBM E;  4KHP E;  4M30 A;  1WHQ A;  3VYY A;  2LRS A;  3ADI A;  1STU A;  2ZM6 E;  2DIX A;  2L33 A;  3OTO E;  1XNQ E;  1X49 A;  2L3C A;  2NUE A;  4B3R E;  4JI7 E;  4X65 E;  1UHZ A;  4DR5 E;  4OX9 E;  4M2Z A;  2UU9 E;  4LF6 E;  2CPN A;  2L3J A;  2N3G A;  2LTR A;  4NXM E;  1ZBT A;  2E5L E;  4LF7 E;  4LFA E;  3HTX A;  4JI8 E;  4JI5 E;  4GKJ E;  1HNW E;  1O0W A;  1YYO A;  1HR0 E;  3C4B A;  4JI6 E;  4WFT A;  3ADJ A;  4WYQ B;  1WHN A;  1N36 E;  2NUG A;  4DR7 E;  1QU6 A;  4LFB E;  5LMN E;  4JI1 E;  1UIL A;  4DV4 E;  1XNR E;  2MDR A;  3LLH A;  2NA2 A;  2VQE E;  2UUB E;  4OOG C;  4DV5 E;  1YZ9 A;  2B7T A;  3C4T A;  2L2M A;  2UUC E;  1FJG E;  3J7Y p;  1GQE A;  4DV7 E;  2UXD E;  2NUF A;  4NXN E;  1PKP A;  1FKA E;  2F4V E;  1J5E E;  2UXC E;  4X64 E;  4DR1 E;  3VYX A;  4DV2 E;  4X66 E;  2N3H A;  2B7V A;  2HHH E;  4JI3 E;  2RS6 A;  4LFC E;  4X8W A;  1T4N A;  4DR3 E;  4B3S E;  3ADL A;  4GKK E;  2LBS B;  2UUA E;  4X62 E;  1XMQ E;  1HNZ E;  1DI2 A;  1J26 A;  5CFF E;  5IWA E;  1N33 E;  1I94 E;  4LF5 E;  4DV1 E;  4JYA E;  4JI4 E;  3ADG A;  1RC7 A;  4JI2 E;  4LF8 E;  1IBL E;  2LUP B;  4B3M E;  4LF9 E;  2LJH A;  4JV5 E;  1YYK A;  5BR8 E;  4DR2 E;  4JI0 E;  2VQF E;  2RTX A;  2JVA A;  4DV0 E;  1HNX E;  4B3T E;  4DUZ E;  2UXB E;  1YYW A;  2L2K B;  4LF4 E;  2DB2 A;  2LUQ A;  4K0K E;  1XMO E;  4YY3 E;  1N34 E;  1EKZ A;  2KHX A;  1X48 A;  4DUY E;  2YT4 A;  5LMU E;  2DMY A;  4YHH E;  1IBK E;  2RS7 A;  1X47 A;  1N32 E;  2L2N A;  1T4O A;  4DR6 E;  3T1H E;  2IHR 1;  3T1Y E;  2EZ6 A;  2JY9 A;  4DV3 E;  1RQ0 A;  2B3T B;  4DV6 E;  1T4L B;  4AQY E;  4DKK A;  4DR4 E;  2RSM A;  3P1X A; 
#chains in the Genus database with same CATH topology
 2MKN A;  1IBM E;  1ZAA C;  4ZYE A;  3TQM A;  2MC5 A;  5KL2 A;  2LE2 A;  1STU A;  2RPC A;  1YFH A;  5ADZ A;  5AC4 A;  2EN6 A;  3OTO E;  2NUE A;  4B3R E;  3K6Q A;  4OX9 E;  4M2Z A;  1X6E A;  4LF6 E;  4R2C A;  2CPN A;  2KOU A;  2MKD A;  2N3G A;  2L3J A;  1T38 A;  1ZBT A;  4BMJ A;  2JYA A;  4GEQ B;  5IV8 B;  4JI8 E;  4JI5 E;  5A69 A;  2HGH A;  1TN9 A;  2EOZ A;  1X3C A;  4WFT A;  3MSW A;  1IQS A;  2EN8 A;  4HTG A;  2EM8 A;  2ENH A;  4DV4 E;  2MDR A;  1PDA A;  2RSI A;  2J7J A;  2VQE E;  4M0V A;  1YSA C;  2EQ3 A;  2B7T A;  2YTI A;  2L2M A;  2YTQ A;  1FJG E;  3RMP A;  3HXL A;  4M9V C;  4BS9 A;  2DSY A;  1FKA E;  1IMU A;  4X64 E;  4DR1 E;  2MC6 A;  1BB8 A;  4X66 E;  3J7A G;  2FV4 B;  2YTO A;  2B7V A;  2EMW A;  4J8Z A;  5TSE A;  2DRP A;  1ZR9 A;  1DI2 A;  2CSH A;  1XMQ E;  5IWA E;  4TUG A;  2EOR A;  4LF5 E;  4DV1 E;  5F3W A;  3ADG A;  4JI2 E;  2WBT A;  2LJH A;  4JV5 E;  1A1L A;  5IXM B;  2Q8U A;  3KZZ A;  1YYK A;  5BR8 E;  4KZS A;  4JI0 E;  2EPR A;  2V8Q B;  2RTX A;  4DV0 E;  4IS1 C;  2HC5 A;  5AAS A;  1HNX E;  2EMG A;  1B69 A;  1YUI A;  4B3T E;  2V83 A;  1A1F A;  1T39 A;  2DLQ A;  1MGT A;  2EPU A;  2HJJ A;  5A6K A;  1XMO E;  2YPN A;  1EKZ A;  2FGG A;  1IBK E;  2FTX B;  3T1H E;  2BBG A;  2CTD A;  5A6B D;  5KL6 A;  4L5N C;  1T4L B;  4KWY A;  3H09 A;  4AQY E;  4DR4 E;  2F8B A;  2M7Q A;  1EH7 A;  2R76 A;  2LTS A;  2YTF A;  4M30 A;  2LVH A;  3VHT B;  3VYY A;  2V89 A;  5FLX C;  1QNT A;  1SFE A;  1ZU1 A;  2EM9 A;  1XNQ E;  5AE1 A;  2JR1 A;  1BBO A;  2EOE A;  2VE7 C;  4R2R A;  4MLV A;  4R2A A;  4NXM E;  3L00 A;  2BB8 A;  3MHS C;  1KYQ A;  3BF2 A;  2EPN A;  1EH8 A;  2ADR A;  4LTY A;  1HNW E;  1NEI A;  1O0W A;  2VRD A;  2NUG A;  3ADJ A;  2YWQ A;  1UIL A;  2M4I A;  1EH6 A;  2NA2 A;  1DGC A;  3EQ1 A;  1YZ9 A;  5T6J A;  2JWO A;  2EPP A;  2UUC E;  2EM6 A;  2YTJ A;  1LLM C;  3J7Y p;  2YSO A;  1X5W A;  4BC7 A;  2EE8 A;  1P47 A;  2UXC E;  2K7I A;  3VYX A;  2EPC A;  2EL4 A;  2LV2 A;  2RQL A;  5AE2 A;  1WRJ A;  1JK2 A;  2YZT A;  2HHH E;  2JP9 A;  2RS6 A;  4DR3 E;  1UBD C;  2M1S A;  3J81 C;  1HNZ E;  2JOB A;  2V86 A;  5CFF E;  1N33 E;  1I94 E;  5AE3 A;  4JYA E;  4JI4 E;  4DMI A;  1ZBQ A;  4R03 A;  2EOQ A;  4NZV A;  4WPY A;  1G2D C;  4R2Q A;  2EM4 A;  1A1J A;  3BGH A;  5KL7 A;  2H36 X;  5IT9 C;  2VQF E;  2EPO A;  3F6H A;  3HPZ A;  4O43 A;  2WBS A;  3EPJ A;  2JVA A;  4P7D A;  2EOH A;  2UXB E;  2L2K B;  3ECR A;  2YU8 A;  2EMK A;  2EPM X;  4K0K E;  2LO3 A;  3IWC A;  2YT4 A;  2EPA A;  3JTZ A;  4LU9 A;  2K4V A;  2DMY A;  4WXC A;  1RMD A;  1N32 E;  4DR6 E;  2LMZ A;  2CT1 A;  2JY9 A;  3J80 C;  2LT7 A;  2ELY A;  4BHC A;  4GZN C;  1A1K A;  4DKK A;  3KWR A;  2RSM A;  3P1X A;  5KL4 A;  4I8O A;  1WHQ A;  2ODR C;  2EMI A;  2EML A;  2I9I A;  2LRS A;  4ZYD A;  3ADI A;  2ZM6 E;  2DIX A;  4WSP A;  2L33 A;  2YTD A;  2EM2 A;  1A1I A;  2L3C A;  3HPS A;  2B9D A;  4X65 E;  2EL5 A;  2EMZ A;  1PJT A;  4ZYG A;  2EM5 A;  2EL6 A;  2ENA A;  4WX9 A;  2LTR A;  2WZO A;  5KL5 A;  1IQO A;  4WXD A;  2EN7 A;  2YTG A;  1AAY A;  1UN6 B;  3HTX A;  2ENC A;  4GKJ E;  1HR0 E;  4JI6 E;  4TUI A;  4WYQ B;  2EOF A;  1N36 E;  1QU6 A;  1YPN A;  1XNR E;  2GLI A;  2G7H A;  2EPL X;  2WBU A;  5AC5 A;  2YSP A;  4R8O A;  2UUB E;  3AV0 A;  4OOG C;  3OML A;  2ELZ A;  3C4T A;  1L4S A;  2V88 A;  1GQE A;  2EM3 A;  2NUF A;  5LL6 R;  4F9B B;  1YUJ A;  2NAB A;  1J5E E;  2I13 A;  4DV2 E;  2N3H A;  4F6N A;  4JI3 E;  4X8W A;  1T4N A;  4B3S E;  3ADL A;  2KON A;  4GKK E;  2UUA E;  4X62 E;  2ODR D;  3HQ1 A;  1F2I G;  3IWD A;  1TF6 A;  1RC7 A;  2YRM A;  3F6G A;  4O5G A;  4R2D A;  1IBL E;  2LUP B;  4B3M E;  4Q35 B;  5A2Q C;  2DLK A;  1GZ6 A;  4BC9 A;  4DR2 E;  4BBY A;  4RHB B;  2L8T A;  4FK5 C;  3UK3 C;  2D9H A;  4F2J C;  3M99 B;  3FIG A;  2L92 A;  1NCS A;  4NHR A;  4DUZ E;  1YYW A;  1N3G A;  1WJP A;  2EOM A;  2JOX A;  4LF4 E;  2EWL A;  2YU5 A;  4MLQ A;  1N34 E;  4YY3 E;  2KHX A;  3DJW A;  4R2P A;  3EPH A;  5LMU E;  2RS7 A;  2PRT A;  2DGC A;  1X47 A;  2L2N A;  1T4O A;  2YRH A;  2EN4 A;  2IHR 1;  2EZ6 A;  2GPI A;  4DV3 E;  1RQ0 A;  4Q28 A;  2B3T B;  4DV6 E;  3DF6 A;  1PJS A;  1BBG A;  2LCE A;  2EPK X;  4HEI A;  3EPL A;  2EM0 A;  2L6M A;  1MEY C;  2YRK A;  3KZY A;  4X9J A;  2GHF A;  2EN3 A;  4KHP E;  3JAM C;  4R2E A;  2V87 A;  4WSG A;  2EOY A;  1SR9 A;  2EMB A;  4O4K A;  4P78 A;  3LML A;  1X49 A;  3THN A;  2YTP A;  4JI7 E;  4R2S A;  1UHZ A;  4DR5 E;  1GTK A;  2UU9 E;  2EPZ A;  2EMC A;  4L8N A;  4BCA A;  2E5L E;  4LF7 E;  2EMH A;  4LFA E;  2JXP A;  2YTN A;  4N4R B;  1YYO A;  4ZYH A;  2N8X A;  3C4B A;  1WHN A;  1A1H A;  4DR7 E;  3EPK A;  4LFB E;  2EOX A;  5LMN E;  4JI1 E;  3BBG A;  2EJ4 A;  3C6M A;  3LLH A;  3VK6 A;  5A6J A;  5KL3 A;  3THO B;  2EOI A;  4F9A B;  1G2F C;  2JPA A;  2VF1 A;  4DV5 E;  2MDG A;  3MHH C;  4DV7 E;  2UXD E;  4F54 A;  2LJU A;  2EOO A;  4NXN E;  1PKP A;  2EN1 A;  2F4V E;  1KJK A;  4F9C B;  4O24 A;  5A6A A;  2EQ0 A;  2EMF A;  4LFC E;  2A25 A;  2V85 A;  2LBS B;  1J26 A;  2E72 A;  4LF8 E;  2EOS A;  3IWB A;  5LLQ A;  4LF9 E;  2EPX A;  1A1G A;  1TF3 A;  2E1M A;  3ZOQ B;  2EOJ A;  2DMI A;  2EMX A;  2M9A A;  2EN2 A;  1X6H A;  2R1F A;  2WCC 3;  3JU0 A;  2EQ1 A;  3AUZ A;  1WXR A;  1Z1B A;  3BID A;  2DB2 A;  2EMA A;  1AH5 A;  3C6K A;  5A6B A;  3QG5 C;  1X48 A;  1X6F A;  2EM7 A;  2EMY A;  4DUY E;  1JK1 A;  4YHH E;  1DQ3 A;  5DNY A;  2EP3 A;  4F6M A;  3T1Y E;  4BHB A;  2YTE A;  1PJQ A;  4RH8 A;  4IJD A;  2LUQ A; 
#chains in the Genus database with same CATH homology
 2M7Q A;  2LTS A;  2L6M A;  1IBM E;  4I8O A;  4KHP E;  4M30 A;  1WHQ A;  2ODR C;  2MC5 A;  3JAM C;  3VYY A;  2V89 A;  2LRS A;  2LE2 A;  3ADI A;  1STU A;  2V87 A;  2DIX A;  4WSP A;  5FLX C;  2ZM6 E;  2L33 A;  5ADZ A;  1SR9 A;  4P78 A;  3LML A;  3OTO E;  1XNQ E;  1X49 A;  2L3C A;  2NUE A;  4B3R E;  5AE1 A;  3HPS A;  2B9D A;  2JR1 A;  1UHZ A;  4JI7 E;  3K6Q A;  4X65 E;  4DR5 E;  2VE7 C;  4M2Z A;  4OX9 E;  2UU9 E;  4LF6 E;  2RSM A;  2CPN A;  2KOU A;  2N3G A;  2L3J A;  2LTR A;  4L8N A;  1ZBT A;  4BCA A;  4BMJ A;  4NXM E;  2WZO A;  2E5L E;  4LF7 E;  4LFA E;  4GEQ B;  4LTY A;  3HTX A;  4JI8 E;  4JI5 E;  4GKJ E;  1HNW E;  1O0W A;  1YYO A;  1HR0 E;  3C4B A;  4TUI A;  4WFT A;  3ADJ A;  4WYQ B;  1WHN A;  3MSW A;  1N36 E;  4JI6 E;  2NUG A;  1QU6 A;  4DR7 E;  5LMN E;  4JI1 E;  4LFB E;  1UIL A;  2M4I A;  4DV4 E;  1XNR E;  2MDR A;  2G7H A;  3LLH A;  2NA2 A;  3VK6 A;  2VQE E;  4M0V A;  4F9A B;  2VF1 A;  4R8O A;  3AV0 A;  2UUB E;  4OOG C;  4DV5 E;  1YZ9 A;  3OML A;  2B7T A;  5T6J A;  2JWO A;  3C4T A;  2L2M A;  2UUC E;  1FJG E;  2V88 A;  3RMP A;  3HXL A;  3J7Y p;  1GQE A;  4DV7 E;  2UXD E;  4F54 A;  2NUF A;  4NXN E;  4BS9 A;  2DSY A;  1PKP A;  4BC7 A;  5LL6 R;  4F9B B;  1FKA E;  4DR4 E;  2F4V E;  1J5E E;  2UXC E;  4X64 E;  4DR1 E;  4F9C B;  3VYX A;  2MC6 A;  4DV2 E;  5AE2 A;  2N3H A;  4X66 E;  2FV4 B;  3J7A G;  2YZT A;  2B7V A;  4J8Z A;  2HHH E;  4JI3 E;  2RS6 A;  4LFC E;  4X8W A;  1T4N A;  4DR3 E;  4B3S E;  3ADL A;  2KON A;  4GKK E;  2M1S A;  2V85 A;  3J81 C;  2LBS B;  2UUA E;  4X62 E;  1XMQ E;  1HNZ E;  2JOB A;  1DI2 A;  2ODR D;  1J26 A;  2V86 A;  5CFF E;  5IWA E;  3HQ1 A;  4TUG A;  1I94 E;  4LF5 E;  1N33 E;  5AE3 A;  4DV1 E;  5F3W A;  3IWD A;  3ADG A;  4DMI A;  4JI4 E;  1RC7 A;  4JI2 E;  4LF8 E;  3F6G A;  1ZBQ A;  1IBL E;  3IWB A;  4R03 A;  4WPY A;  2LUP B;  4B3M E;  4LF9 E;  2LJH A;  2E1M A;  4JV5 E;  3ZOQ B;  5A2Q C;  1YYK A;  1GZ6 A;  2H36 X;  5BR8 E;  4KZS A;  4BC9 A;  4DR2 E;  4JI0 E;  4BBY A;  5IT9 C;  2V8Q B;  2VQF E;  3HPZ A;  3F6H A;  2L8T A;  2RTX A;  2JVA A;  4DV0 E;  5AAS A;  3JU0 A;  1HNX E;  4P7D A;  3FIG A;  4B3T E;  2L92 A;  2V83 A;  3AUZ A;  1WXR A;  4DUZ E;  2UXB E;  1YYW A;  2L2K B;  4LF4 E;  2DB2 A;  2JOX A;  2EWL A;  4K0K E;  1XMO E;  3IWC A;  4YY3 E;  1N34 E;  1EKZ A;  2KHX A;  1X48 A;  3DJW A;  4DUY E;  2YT4 A;  2FGG A;  5LMU E;  3JTZ A;  4LU9 A;  2K4V A;  2DMY A;  1DQ3 A;  5DNY A;  4YHH E;  2RS7 A;  1IBK E;  1X47 A;  1N32 E;  2L2N A;  2LMZ A;  1T4O A;  2FTX B;  4DR6 E;  3T1H E;  4JYA E;  2IHR 1;  3T1Y E;  2EZ6 A;  2JY9 A;  4DV3 E;  1RQ0 A;  4Q28 A;  3J80 C;  2B3T B;  4L5N C;  4DV6 E;  1T4L B;  3DF6 A;  3H09 A;  4AQY E;  4DKK A;  3KWR A;  2LUQ A;  2F8B A;  3P1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...