4R03A

Crystal structure of a duf3836 family protein (bdi_3222) from parabacteroides distasonis atcc 8503 at 1.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
109
Chain Sequence
GKDYLYDTKEENGKIISKVVFLQENGLLNKQVRYEFQYNENGKVSEKKAFRWDRTNDEWVPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLNVQNMIIPSTNYEEIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BDI_3222) from Parabacteroides distasonis ATCC 8503 at 1.50 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Structural genomics, unknown function
total genus 19
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4r03A00
3MSWA 4R8OA 4R03A
chains in the Genus database with same CATH superfamily
2MDRA 4DR3E 3JAMC 4DMIA 1X6FA 1A1KA 2EOZA 4DKKA 1UBDC 5A69A 1DGCA 3KZZA 4DV2E 1JK1A 4F54A 4JI6E 2UXCE 2E72A 4F9AB 2M7QA 3F6GA 2ENAA 1A1GA 1HNZE 4WSGA 2YTDA 1RQ0A 2EPXA 2GHFA 1RMDA 1QU6A 2EOIA 2YTFA 5ADZA 4IJDA 1WRJA 1A1JA 1TF6A 1WXRA 1IQSA 2DMYA 2DIXA 4F6NA 3K6QA 2EMHA 1UILA 1X49A 2F8BA 2RS6A 1MEYC 1YYKA 5A2QC 4DV1E 4DV6E 3HQ1A 2EM8A 1N32E 2EORA 2ODRC 3KWRA 1GZ6A 2EOSA 1ZAAC 4RHBB 2ELZA 3M99B 4X62E 2N8XA 1X48A 2EM4A 2EPLX 3T1HE 1T4NA 3ECRA 4IS1C 2EOOA 1TN9A 4GKJE 2RSIA 2E5LE 4BHCA 3HXLA 3J80C 1FJGE 5IXMB 1N36E 2B9DA 2YSPA 2Q8UA 1IBKE 2JXPA 4NZVA 2EOFA 4X9JA 5IWAE 1XMQE 1MGTA 4BHBA 2E1MA 2DRPA 3EPKA 2V87A 1UN6B 1BBOA 4JV5E 2LTRA 4WPYA 2NUEA 3C4TA 4JI5E 4NHRA 1BBGA 1J5EE 2I13A 4BC9A 2R76A 4BBYA 4X64E 2EOMA 3EPJA 2KONA 4J8ZA 4NXNE 2EOEA 1TF3A 2YTQA 4DR5E 3HPZA 4R2SA 4X65E 1GQEA 4LFCE 1SFEA 4LF6E 2LTSA 2L2MA 5IT9C 1WHQA 2LVHA 2YU5A 1P47A 2WZOA 2M4IA 2EPOA 4P78A 4DR4E 4BCAA 1ZU1A 2EQ3A 1X47A 2EMIA 4BMJA 2EM0A 3OMLA 3IWCA 3HTXA 2EMGA 3P1XA 2NUFA 2V85A 4O5GA 1EH8A 3J81C 4JYAE 1G2FC 1PDAA 4R2EA 5AASA 4DUZE 2RTXA 4LTYA 4FK5C 2HHHE 2EL4A 5A6AA 4K0KE 2LE2A 1XNQE 4AQYE 2M1SA 1AH5A 4F9BB 1XMOE 3JTZA 2EOQA 2ADRA 2ZM6E 4WXDA 2PRTA 2UUCE 4R2QA 2K7IA 4OOGC 5A6KA 2FV4B 3BGHA 4GKKE 2FTXB 3BBGA 1PKPA 3MSWA 4F6MA 3OTOE 2EN6A 5LMUE 5AE1A 2RQLA 4R8OA 2UU9E 2BBGA 2DSYA 4R2CA 4ZYGA 2EMYA 4JI3E 2LCEA 2EPRA 2UXDE 4M2ZA 1YYWA 3F6HA 2LJHA 4Q35B 2EMXA 2EPCA 2EMZA 3AUZA 2EMLA 4O4KA 1L4SA 4KHPE 2B7TA 4O24A 2V83A 4B3TE 4RH8A 2YRHA 2FGGA 3IWDA 3DJWA 2N3HA 3VHTB 1AAYA 2YWQA 3THOB 2KOUA 1EH7A 3IWBA 5KL2A 2EMFA 4OX9E 2YTPA 5KL4A 2UUAE 4B3RE 4DV0E 4Q28A 2DLQA 2JY9A 4R2AA 2B7VA 1KJKA 5DNYA 1F2IG 4LF5E 4WSPA 3ADJA 1A1HA 5CFFE 1I94E 3VYYA 2EM9A 1PJSA 1QNTA 1WHNA 4YY3E 1PJQA 2YTOA 1ZR9A 5KL3A 2YTJA 2EPMX 2EPAA 2YTEA 2JPAA 1ZBTA 4DR1E 3FIGA 2HJJA 4WX9A 2YSOA 1XNRE 4P7DA 2EM7A 3H09A 2MKNA 2JYAA 5LL6R 1JK2A 2YTGA 2EN4A 2EL6A 2EQ1A 4M30A 4DV7E 4JI8E 4F2JC 3L00A 1X6HA 2UUBE 2YRKA 2GPIA 3QG5C 2LUPB 1NEIA 1YZ9A 2B3TB 4HTGA 2DMIA 3JU0A 4JI0E 2K4VA 2DGCA 4DR2E 2EMKA 1HNXE 2DLKA 5F3WA 2HGHA 5TSEA 2L2KB 4B3ME 4KWYA 2CT1A 2J7JA 2ELYA 1ZBQA 2JR1A 2EOHA 3KZYA 4WYQB 3J7Yp 3DF6A 1J26A 4M0VA 3TQMA 5LLQA 1BB8A 2CTDA 4LU9A 2LMZA 2LRSA 3ADIA 4GZNC 1YSAC 5AE3A 1A1LA 4KZSA 3LLHA 5KL7A 2RS7A 4JI4E 2YTNA 2RSMA 5A6BA 5IV8B 3HPSA 2NABA 2LV2A 2JOBA 2EM3A 4LF7E 2EMBA 2L8TA 4BC7A 4TUGA 4DV3E 4ZYHA 2GLIA 4I8OA 2JP9A 2A25A 2LUQA 1B69A 4JI7E 1X5WA 4ZYEA 5A6BD 3BIDA 2L3CA 2VQFE 4R2PA 2NUGA 5AC5A 3MHSC 2L3JA 1X6EA 4DR7E 2EN3A 1IBME 2ENHA 2EOJA 2LT7A 1NCSA 2ODRD 2VF1A 1STUA 2EN1A 4WXCA 3C4BA 3ZOQB 2M9AA 3VK6A 2NA2A 3LMLA 2EPPA 4MLQA 2WBUA 1IBLE 1YUJA 2WBTA 2MC5A 1Z1BA 2EP3A 1IQOA 4WFTA 2EWLA 4DUYE 2F4VE 1UHZA 2V86A 2JVAA 5BR8E 4F9CB 1A1IA 2EMCA 3C6KA 4BS9A 3BF2A 4LFAE 2EM2A 2LBSB 4L5NC 4R2DA 4GEQB 2EZ6A 2EOXA 1IMUA 3MHHC 3EPLA 4M9VC 4NXME 2EE8A 1LLMC 2JOXA 1RC7A 5FLXC 2HC5A 1KYQA 2EMWA 2EMAA 4R03A 2YZTA 2EPUA 2EM6A 3AV0A 2MDGA 4L8NA 4N4RB 3T1YE 2EPKX 1T38A 3J7AG 1YUIA 1T39A 4O43A 2KHXA 1A1FA 5AC4A 4LF4E 1O0WA 1YPNA 2VRDA 5AE2A 4YHHE 2CSHA 2V8QB 2YTIA 5LMNE 2L6MA 4JI1E 3VYXA 3RMPA 2IHR1 2UXBE 3UK3C 1HR0E 4DV5E 2EN2A 4DV4E 3ADLA 3THNA 2N3GA 2MC6A 2MKDA 1YFHA 4DR6E 2I9IA 2V88A 2ENCA 5A6JA 1N34E 1G2DC 2WBSA 2YU8A 2EN7A 2YRMA 1N3GA 2EM5A 1PJTA 1EKZA 2V89A 1X3CA 2EQ0A 4R2RA 4LFBE 4LF8E 4X8WA 2CPNA 1SR9A 3C6MA 2R1FA 2YPNA 4JI2E 5T6JA 2G7HA 2BB8A 2VE7C 2YT4A 4MLVA 2DB2A 3ADGA 1GTKA 4LF9E 2D9HA 2EPNA 1YYOA 2EPZA 1FKAE 2L2NA 3EQ1A 5KL5A 3EPHA 5KL6A 2H36X 2LO3A 1T4LB 1T4OA 2VQEE 2WCC3 2LJUA 2EJ4A 1HNWE 4X66E 2RPCA 1N33E 1WJPA 1DI2A 4ZYDA 2EN8A 4B3SE 2L92A 2EOYA 2EL5A 1EH6A 4HEIA 2L33A 1DQ3A 2JWOA 4TUIA
chains in the Genus database with same CATH topology
1X47A 2MDRA 4P7DA 3H09A 4BMJA 3JAMC 4DR3E 3OMLA 3IWCA 5LL6R 4DMIA 3HTXA 3P1XA 4R03A 2YZTA 4M30A 4DKKA 4JI8E 4DV7E 2NUFA 2V85A 2UUBE 3AV0A 3J81C 4L8NA 4JYAE 2LUPB 1YZ9A 4DV2E 2B3TB 3T1YE 4F54A 3JU0A 4DUZE 5AASA 3ADIA 4JI6E 4JI0E 2K4VA 2RTXA 4LTYA 3J7AG 2UXCE 2HHHE 4DR2E 4K0KE 1HNXE 4F9AB 2LE2A 2KHXA 5F3WA 1XNQE 2L2KB 4B3ME 4LF4E 2M7QA 4AQYE 2M1SA 1O0WA 3F6GA 1HNZE 4F9BB 5AE2A 1RQ0A 1QU6A 4YHHE 1XMOE 1ZBQA 5ADZA 3JTZA 2JR1A 2V8QB 1WXRA 4WYQB 2ZM6E 5LMNE 3J7Yp 3DF6A 2DMYA 2L6MA 4JI1E 4M0VA 2UUCE 1J26A 4OOGC 2FV4B 2DIXA 4LU9A 4GKKE 2FTXB 3VYXA 2LMZA 3K6QA 1YYKA 1PKPA 2LRSA 3MSWA 3RMPA 1UILA 1X49A 2F8BA 2RS6A 2IHR1 3OTOE 4TUIA 5A2QC 4DV1E 5LMUE 3HQ1A 4DV6E 5AE3A 1N32E 4KZSA 1HR0E 3LLHA 5AE1A 4DV5E 2RS7A 2ODRC 3KWRA 1GZ6A 4JI4E 4DV4E 4R8OA 2RSMA 4X62E 2UU9E 3HPSA 3ADLA 1X48A 2DSYA 2JOBA 2N3GA 3T1HE 1T4NA 2MC6A 4LF7E 4JI3E 4GKJE 2UXDE 2E5LE 4M2ZA 1YYWA 2L8TA 3F6HA 4BC7A 3HXLA 3J80C 2V88A 4TUGA 2LJHA 4DV3E 1FJGE 1N36E 4I8OA 1N34E 2B9DA 2LUQA 4JI7E 3AUZA 1IBKE 4KHPE 1EKZA 2V89A 2B7TA 2V83A 1RC7A 5IWAE 2L3CA 2VQFE 1XMQE 2E1MA 2NUGA 4B3TE 2V87A 3IWDA 2FGGA 2L3JA 3DJWA 4JV5E 2LTRA 4WPYA 2N3HA 4DR7E 2NUEA 4LFBE 3C4TA 1IBME 4JI5E 4LF8E 4X8WA 2CPNA 1J5EE 1SR9A 2KOUA 4JI2E 4BC9A 2ODRD 4BBYA 2VF1A 5T6JA 1STUA 2G7HA 3IWBA 4X64E 2VE7C 4NXNE 2KONA 4J8ZA 2YT4A 4DR6E 2DB2A 3ADGA 3C4BA 4LF9E 3ZOQB 4OX9E 3VK6A 4DR5E 2NA2A 3LMLA 2UUAE 1YYOA 4B3RE 1FKAE 3HPZA 4DV0E 2L2NA 4Q28A 4LFCE 2JY9A 1GQEA 4X65E 1IBLE 2B7VA 2MC5A 4LF6E 2H36X 2LTSA 1T4LB 5DNYA 1T4OA 2L2MA 4WFTA 2EWLA 2VQEE 1WHQA 4WSPA 1UHZA 4DUYE 3ADJA 5IT9C 5CFFE 4LF5E 2F4VE 1I94E 3VYYA 2V86A 4YY3E 1WHNA 2JVAA 5BR8E 4F9CB 1HNWE 4X66E 4BS9A 1N33E 1DI2A 2WZOA 2M4IA 4LFAE 2LBSB 4L5NC 4P78A 4B3SE 2UXBE 1ZBTA 2L92A 4GEQB 3FIGA 4DR1E 4DR4E 2EZ6A 2L33A 1DQ3A 4BCAA 4NXME 2JWOA 2JOXA 1XNRE 5FLXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSW A;  4R8O A;  4R03 A; 
#chains in the Genus database with same CATH topology
 2MDR A;  4DR3 E;  3JAM C;  4DMI A;  1X6F A;  1A1K A;  2EOZ A;  4DKK A;  1UBD C;  5A69 A;  1DGC A;  3KZZ A;  4DV2 E;  1JK1 A;  4F54 A;  4JI6 E;  2UXC E;  2E72 A;  4F9A B;  2M7Q A;  3F6G A;  2ENA A;  1A1G A;  1HNZ E;  4WSG A;  2YTD A;  1RQ0 A;  2EPX A;  2GHF A;  1RMD A;  1QU6 A;  2EOI A;  2YTF A;  5ADZ A;  4IJD A;  1WRJ A;  1A1J A;  1TF6 A;  1WXR A;  1IQS A;  2DMY A;  2DIX A;  4F6N A;  3K6Q A;  2EMH A;  1UIL A;  1X49 A;  2F8B A;  2RS6 A;  1MEY C;  1YYK A;  5A2Q C;  4DV1 E;  4DV6 E;  3HQ1 A;  2EM8 A;  1N32 E;  2EOR A;  2ODR C;  3KWR A;  1GZ6 A;  2EOS A;  1ZAA C;  4RHB B;  2ELZ A;  3M99 B;  4X62 E;  2N8X A;  1X48 A;  2EM4 A;  2EPL X;  3T1H E;  1T4N A;  3ECR A;  4IS1 C;  2EOO A;  1TN9 A;  4GKJ E;  2RSI A;  2E5L E;  4BHC A;  3HXL A;  3J80 C;  1FJG E;  5IXM B;  1N36 E;  2B9D A;  2YSP A;  2Q8U A;  1IBK E;  2JXP A;  4NZV A;  2EOF A;  4X9J A;  5IWA E;  1XMQ E;  1MGT A;  4BHB A;  2E1M A;  2DRP A;  3EPK A;  2V87 A;  1UN6 B;  1BBO A;  4JV5 E;  2LTR A;  4WPY A;  2NUE A;  3C4T A;  4JI5 E;  4NHR A;  1BBG A;  1J5E E;  2I13 A;  4BC9 A;  2R76 A;  4BBY A;  4X64 E;  2EOM A;  3EPJ A;  2KON A;  4J8Z A;  4NXN E;  2EOE A;  1TF3 A;  2YTQ A;  4DR5 E;  3HPZ A;  4R2S A;  4X65 E;  1GQE A;  4LFC E;  1SFE A;  4LF6 E;  2LTS A;  2L2M A;  5IT9 C;  1WHQ A;  2LVH A;  2YU5 A;  1P47 A;  2WZO A;  2M4I A;  2EPO A;  4P78 A;  4DR4 E;  4BCA A;  1ZU1 A;  2EQ3 A;  1X47 A;  2EMI A;  4BMJ A;  2EM0 A;  3OML A;  3IWC A;  3HTX A;  2EMG A;  3P1X A;  2NUF A;  2V85 A;  4O5G A;  1EH8 A;  3J81 C;  4JYA E;  1G2F C;  1PDA A;  4R2E A;  5AAS A;  4DUZ E;  2RTX A;  4LTY A;  4FK5 C;  2HHH E;  2EL4 A;  5A6A A;  4K0K E;  2LE2 A;  1XNQ E;  4AQY E;  2M1S A;  1AH5 A;  4F9B B;  1XMO E;  3JTZ A;  2EOQ A;  2ADR A;  2ZM6 E;  4WXD A;  2PRT A;  2UUC E;  4R2Q A;  2K7I A;  4OOG C;  5A6K A;  2FV4 B;  3BGH A;  4GKK E;  2FTX B;  3BBG A;  1PKP A;  3MSW A;  4F6M A;  3OTO E;  2EN6 A;  5LMU E;  5AE1 A;  2RQL A;  4R8O A;  2UU9 E;  2BBG A;  2DSY A;  4R2C A;  4ZYG A;  2EMY A;  4JI3 E;  2LCE A;  2EPR A;  2UXD E;  4M2Z A;  1YYW A;  3F6H A;  2LJH A;  4Q35 B;  2EMX A;  2EPC A;  2EMZ A;  3AUZ A;  2EML A;  4O4K A;  1L4S A;  4KHP E;  2B7T A;  4O24 A;  2V83 A;  4B3T E;  4RH8 A;  2YRH A;  2FGG A;  3IWD A;  3DJW A;  2N3H A;  3VHT B;  1AAY A;  2YWQ A;  3THO B;  2KOU A;  1EH7 A;  3IWB A;  5KL2 A;  2EMF A;  4OX9 E;  2YTP A;  5KL4 A;  2UUA E;  4B3R E;  4DV0 E;  4Q28 A;  2DLQ A;  2JY9 A;  4R2A A;  2B7V A;  1KJK A;  5DNY A;  1F2I G;  4LF5 E;  4WSP A;  3ADJ A;  1A1H A;  5CFF E;  1I94 E;  3VYY A;  2EM9 A;  1PJS A;  1QNT A;  1WHN A;  4YY3 E;  1PJQ A;  2YTO A;  1ZR9 A;  5KL3 A;  2YTJ A;  2EPM X;  2EPA A;  2YTE A;  2JPA A;  1ZBT A;  4DR1 E;  3FIG A;  2HJJ A;  4WX9 A;  2YSO A;  1XNR E;  4P7D A;  2EM7 A;  3H09 A;  2MKN A;  2JYA A;  5LL6 R;  1JK2 A;  2YTG A;  2EN4 A;  2EL6 A;  2EQ1 A;  4M30 A;  4DV7 E;  4JI8 E;  4F2J C;  3L00 A;  1X6H A;  2UUB E;  2YRK A;  2GPI A;  3QG5 C;  2LUP B;  1NEI A;  1YZ9 A;  2B3T B;  4HTG A;  2DMI A;  3JU0 A;  4JI0 E;  2K4V A;  2DGC A;  4DR2 E;  2EMK A;  1HNX E;  2DLK A;  5F3W A;  2HGH A;  5TSE A;  2L2K B;  4B3M E;  4KWY A;  2CT1 A;  2J7J A;  2ELY A;  1ZBQ A;  2JR1 A;  2EOH A;  3KZY A;  4WYQ B;  3J7Y p;  3DF6 A;  1J26 A;  4M0V A;  3TQM A;  5LLQ A;  1BB8 A;  2CTD A;  4LU9 A;  2LMZ A;  2LRS A;  3ADI A;  4GZN C;  1YSA C;  5AE3 A;  1A1L A;  4KZS A;  3LLH A;  5KL7 A;  2RS7 A;  4JI4 E;  2YTN A;  2RSM A;  5A6B A;  5IV8 B;  3HPS A;  2NAB A;  2LV2 A;  2JOB A;  2EM3 A;  4LF7 E;  2EMB A;  2L8T A;  4BC7 A;  4TUG A;  4DV3 E;  4ZYH A;  2GLI A;  4I8O A;  2JP9 A;  2A25 A;  2LUQ A;  1B69 A;  4JI7 E;  1X5W A;  4ZYE A;  5A6B D;  3BID A;  2L3C A;  2VQF E;  4R2P A;  2NUG A;  5AC5 A;  3MHS C;  2L3J A;  1X6E A;  4DR7 E;  2EN3 A;  1IBM E;  2ENH A;  2EOJ A;  2LT7 A;  1NCS A;  2ODR D;  2VF1 A;  1STU A;  2EN1 A;  4WXC A;  3C4B A;  3ZOQ B;  2M9A A;  3VK6 A;  2NA2 A;  3LML A;  2EPP A;  4MLQ A;  2WBU A;  1IBL E;  1YUJ A;  2WBT A;  2MC5 A;  1Z1B A;  2EP3 A;  1IQO A;  4WFT A;  2EWL A;  4DUY E;  2F4V E;  1UHZ A;  2V86 A;  2JVA A;  5BR8 E;  4F9C B;  1A1I A;  2EMC A;  3C6K A;  4BS9 A;  3BF2 A;  4LFA E;  2EM2 A;  2LBS B;  4L5N C;  4R2D A;  4GEQ B;  2EZ6 A;  2EOX A;  1IMU A;  3MHH C;  3EPL A;  4M9V C;  4NXM E;  2EE8 A;  1LLM C;  2JOX A;  1RC7 A;  5FLX C;  2HC5 A;  1KYQ A;  2EMW A;  2EMA A;  4R03 A;  2YZT A;  2EPU A;  2EM6 A;  3AV0 A;  2MDG A;  4L8N A;  4N4R B;  3T1Y E;  2EPK X;  1T38 A;  3J7A G;  1YUI A;  1T39 A;  4O43 A;  2KHX A;  1A1F A;  5AC4 A;  4LF4 E;  1O0W A;  1YPN A;  2VRD A;  5AE2 A;  4YHH E;  2CSH A;  2V8Q B;  2YTI A;  5LMN E;  2L6M A;  4JI1 E;  3VYX A;  3RMP A;  2IHR 1;  2UXB E;  3UK3 C;  1HR0 E;  4DV5 E;  2EN2 A;  4DV4 E;  3ADL A;  3THN A;  2N3G A;  2MC6 A;  2MKD A;  1YFH A;  4DR6 E;  2I9I A;  2V88 A;  2ENC A;  5A6J A;  1N34 E;  1G2D C;  2WBS A;  2YU8 A;  2EN7 A;  2YRM A;  1N3G A;  2EM5 A;  1PJT A;  1EKZ A;  2V89 A;  1X3C A;  2EQ0 A;  4R2R A;  4LFB E;  4LF8 E;  4X8W A;  2CPN A;  1SR9 A;  3C6M A;  2R1F A;  2YPN A;  4JI2 E;  5T6J A;  2G7H A;  2BB8 A;  2VE7 C;  2YT4 A;  4MLV A;  2DB2 A;  3ADG A;  1GTK A;  4LF9 E;  2D9H A;  2EPN A;  1YYO A;  2EPZ A;  1FKA E;  2L2N A;  3EQ1 A;  5KL5 A;  3EPH A;  5KL6 A;  2H36 X;  2LO3 A;  1T4L B;  1T4O A;  2VQE E;  2WCC 3;  2LJU A;  2EJ4 A;  1HNW E;  4X66 E;  2RPC A;  1N33 E;  1WJP A;  1DI2 A;  4ZYD A;  2EN8 A;  4B3S E;  2L92 A;  2EOY A;  2EL5 A;  1EH6 A;  4HEI A;  2L33 A;  1DQ3 A;  2JWO A;  4TUI A; 
#chains in the Genus database with same CATH homology
 1X47 A;  2MDR A;  4P7D A;  3H09 A;  4BMJ A;  3JAM C;  4DR3 E;  3OML A;  3IWC A;  5LL6 R;  4DMI A;  3HTX A;  3P1X A;  4R03 A;  2YZT A;  4M30 A;  4DKK A;  4JI8 E;  4DV7 E;  2NUF A;  2V85 A;  2UUB E;  3AV0 A;  3J81 C;  4L8N A;  4JYA E;  2LUP B;  1YZ9 A;  4DV2 E;  2B3T B;  3T1Y E;  4F54 A;  3JU0 A;  4DUZ E;  5AAS A;  3ADI A;  4JI6 E;  4JI0 E;  2K4V A;  2RTX A;  4LTY A;  3J7A G;  2UXC E;  2HHH E;  4DR2 E;  4K0K E;  1HNX E;  4F9A B;  2LE2 A;  2KHX A;  5F3W A;  1XNQ E;  2L2K B;  4B3M E;  4LF4 E;  2M7Q A;  4AQY E;  2M1S A;  1O0W A;  3F6G A;  1HNZ E;  4F9B B;  5AE2 A;  1RQ0 A;  1QU6 A;  4YHH E;  1XMO E;  1ZBQ A;  5ADZ A;  3JTZ A;  2JR1 A;  2V8Q B;  1WXR A;  4WYQ B;  2ZM6 E;  5LMN E;  3J7Y p;  3DF6 A;  2DMY A;  2L6M A;  4JI1 E;  4M0V A;  2UUC E;  1J26 A;  4OOG C;  2FV4 B;  2DIX A;  4LU9 A;  4GKK E;  2FTX B;  3VYX A;  2LMZ A;  3K6Q A;  1YYK A;  1PKP A;  2LRS A;  3MSW A;  3RMP A;  1UIL A;  1X49 A;  2F8B A;  2RS6 A;  2IHR 1;  3OTO E;  4TUI A;  5A2Q C;  4DV1 E;  5LMU E;  3HQ1 A;  4DV6 E;  5AE3 A;  1N32 E;  4KZS A;  1HR0 E;  3LLH A;  5AE1 A;  4DV5 E;  2RS7 A;  2ODR C;  3KWR A;  1GZ6 A;  4JI4 E;  4DV4 E;  4R8O A;  2RSM A;  4X62 E;  2UU9 E;  3HPS A;  3ADL A;  1X48 A;  2DSY A;  2JOB A;  2N3G A;  3T1H E;  1T4N A;  2MC6 A;  4LF7 E;  4JI3 E;  4GKJ E;  2UXD E;  2E5L E;  4M2Z A;  1YYW A;  2L8T A;  3F6H A;  4BC7 A;  3HXL A;  3J80 C;  2V88 A;  4TUG A;  2LJH A;  4DV3 E;  1FJG E;  1N36 E;  4I8O A;  1N34 E;  2B9D A;  2LUQ A;  4JI7 E;  3AUZ A;  1IBK E;  4KHP E;  1EKZ A;  2V89 A;  2B7T A;  2V83 A;  1RC7 A;  5IWA E;  2L3C A;  2VQF E;  1XMQ E;  2E1M A;  2NUG A;  4B3T E;  2V87 A;  3IWD A;  2FGG A;  2L3J A;  3DJW A;  4JV5 E;  2LTR A;  4WPY A;  2N3H A;  4DR7 E;  2NUE A;  4LFB E;  3C4T A;  1IBM E;  4JI5 E;  4LF8 E;  4X8W A;  2CPN A;  1J5E E;  1SR9 A;  2KOU A;  4JI2 E;  4BC9 A;  2ODR D;  4BBY A;  2VF1 A;  5T6J A;  1STU A;  2G7H A;  3IWB A;  4X64 E;  2VE7 C;  4NXN E;  2KON A;  4J8Z A;  2YT4 A;  4DR6 E;  2DB2 A;  3ADG A;  3C4B A;  4LF9 E;  3ZOQ B;  4OX9 E;  3VK6 A;  4DR5 E;  2NA2 A;  3LML A;  2UUA E;  1YYO A;  4B3R E;  1FKA E;  3HPZ A;  4DV0 E;  2L2N A;  4Q28 A;  4LFC E;  2JY9 A;  1GQE A;  4X65 E;  1IBL E;  2B7V A;  2MC5 A;  4LF6 E;  2H36 X;  2LTS A;  1T4L B;  5DNY A;  1T4O A;  2L2M A;  4WFT A;  2EWL A;  2VQE E;  1WHQ A;  4WSP A;  1UHZ A;  4DUY E;  3ADJ A;  5IT9 C;  5CFF E;  4LF5 E;  2F4V E;  1I94 E;  3VYY A;  2V86 A;  4YY3 E;  1WHN A;  2JVA A;  5BR8 E;  4F9C B;  1HNW E;  4X66 E;  4BS9 A;  1N33 E;  1DI2 A;  2WZO A;  2M4I A;  4LFA E;  2LBS B;  4L5N C;  4P78 A;  4B3S E;  2UXB E;  1ZBT A;  2L92 A;  4GEQ B;  3FIG A;  4DR1 E;  4DR4 E;  2EZ6 A;  2L33 A;  1DQ3 A;  4BCA A;  4NXM E;  2JWO A;  2JOX A;  1XNR E;  5FLX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...