4R03A

Crystal structure of a duf3836 family protein (bdi_3222) from parabacteroides distasonis atcc 8503 at 1.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
109
Chain Sequence
GKDYLYDTKEENGKIISKVVFLQENGLLNKQVRYEFQYNENGKVSEKKAFRWDRTNDEWVPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLNVQNMIIPSTNYEEIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BDI_3222) from Parabacteroides distasonis ATCC 8503 at 1.50 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Structural genomics, unknown function
total genus 19
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4r03A00
4R03A 3MSWA 4R8OA
chains in the Genus database with same CATH superfamily
5A6JA 3ADGA 4ZYGA 4M9VC 4R2PA 4R2SA 4DR1E 2L6MA 1WRJA 1DI2A 1RC7A 4DR6E 1KYQA 1BBGA 2YRHA 5TSEA 1X48A 2EPMX 4F2JC 2LJUA 4DR2E 2HJJA 4WFTA 4X65E 1HNWE 4RHBB 4M0VA 4GKJE 1PJTA 2LO3A 5AE2A 2YSPA 4LTYA 3DJWA 2YTEA 2LTSA 3LMLA 3BIDA 2EMHA 2HC5A 2YU5A 2CT1A 4DV1E 1NCSA 3UK3C 4KHPE 1JK2A 2EORA 2LBSB 2FGGA 2UXBE 1XNQE 2DMIA 2IHR1 5AC4A 3F6GA 2Q8UA 3H09A 2L8TA 2EMKA 2EPUA 2FTXB 4F6NA 4JI7E 2EM0A 4F9CB 2EPNA 4DR4E 4LF7E 3OTOE 3EPJA 1YFHA 4DR5E 1N32E 1X49A 5LMUE 2WBTA 1XMOE 2M4IA 3EQ1A 2M7QA 1ZBQA 2ZM6E 2YTPA 2NUFA 4NHRA 2V8QB 1DGCA 1GQEA 3HPSA 2ODRC 2JVAA 2DMYA 2B7TA 2EL6A 1L4SA 1UN6B 4O5GA 3JAMC 1IQOA 2JWOA 5IWAE 1G2FC 4LFBE 2LTRA 3THOB 2KONA 4IS1C 2EMWA 1ZR9A 5IT9C 1A1IA 4LF6E 3HQ1A 1SFEA 2EOXA 3IWCA 3TQMA 1TF6A 3BF2A 2UUAE 4FK5C 1A1JA 2EMIA 4NZVA 1SR9A 4HEIA 1Z1BA 4K0KE 2V87A 4IJDA 1QNTA 2LJHA 2EOYA 4X9JA 3VYYA 4R8OA 4F6MA 4DUYE 2YWQA 2A25A 4B3SE 2L3JA 2LRSA 2B9DA 2DIXA 5A2QC 1P47A 2UU9E 1TN9A 2CTDA 1MGTA 2M9AA 2ENCA 4DV5E 3ADIA 2YT4A 2EPKX 4DV0E 2EM7A 5LL6R 1FJGE 4DMIA 5LMNE 1UILA 2FV4B 2V86A 4WXCA 3KZYA 2B7VA 4X64E 2V88A 1A1FA 1N34E 4LF4E 2LV2A 2YU8A 4BHCA 1T4LB 2DLQA 1O0WA 1WHQA 2V89A 1WXRA 2EMCA 2EOFA 4TUGA 2EMZA 4BMJA 1DQ3A 4OX9E 2GLIA 5LLQA 3AUZA 2EN8A 2EOJA 4DR3E 2MC5A 2CSHA 2EN6A 4BS9A 4KZSA 4DV6E 4L5NC 2UXCE 4JI1E 2BB8A 2J7JA 5KL4A 3QG5C 4LU9A 3T1HE 2EMGA 4JI3E 2V85A 1AH5A 3J80C 2E1MA 1LLMC 2R76A 2JY9A 1HNXE 2EMFA 4R2DA 4BHBA 2EOSA 4O43A 2EP3A 2NUEA 2UUCE 2E5LE 2EPLX 2RTXA 5A6BD 4WSPA 2JOXA 2VQEE 1I94E 2EE8A 2KOUA 2YTQA 4ZYDA 2D9HA 3KZZA 1BB8A 2RS6A 4M30A 1J5EE 1N33E 1X6HA 3C4TA 3OMLA 2G7HA 4JI4E 1XNRE 3K6QA 4P78A 5A6KA 2EPZA 1AAYA 2UXDE 4JI2E 1RMDA 2MDGA 4DV7E 2EQ0A 2EM3A 5AASA 4YHHE 2HHHE 2EN1A 4R2CA 2JR1A 4TUIA 4B3TE 4LFCE 1QU6A 2LUPB 4JYAE 2VF1A 1PJQA 1TF3A 4BC9A 1FKAE 4GEQB 2WBUA 2EN3A 5ADZA 2H36X 3AV0A 1STUA 3ZOQB 1UHZA 2LUQA 2MKNA 2RPCA 2DGCA 1IMUA 2L2KB 4Q35B 2L2MA 4J8ZA 4DR7E 3HXLA 5KL6A 3ADLA 2RSMA 1YYKA 1X6EA 1X47A 5IXMB 3M99B 2EPXA 2ENHA 2YTJA 4KWYA 1T4NA 3LLHA 1EH7A 1RQ0A 2ADRA 4GZNC 2LE2A 4DV3E 4NXME 2BBGA 4Q28A 2ODRD 4LF8E 2M1SA 1A1KA 1YSAC 2EMXA 2N3GA 4MLVA 4R2EA 2EMAA 1YUIA 4X8WA 2LCEA 3JTZA 4AQYE 4OOGC 2EMBA 3IWDA 1A1LA 1X5WA 4F54A 1HR0E 4LFAE 4L8NA 3MHHC 2EZ6A 3IWBA 3J7Yp 1UBDC 1IBLE 2DB2A 4DV4E 2EL5A 1XMQE 1YZ9A 1WJPA 4BC7A 4O24A 3THNA 1T38A 2UUBE 1N3GA 2B3TB 4WX9A 1IBME 5T6JA 1YYOA 1IBKE 2EPRA 3ADJA 3VYXA 2EM8A 2KHXA 2N8XA 1A1GA 2N3HA 4HTGA 5AE1A 2EM5A 1J26A 2HGHA 2I9IA 4WPYA 2JP9A 4F9BB 3RMPA 5KL5A 2L92A 3BBGA 4R2RA 4O4KA 2ELZA 2EOOA 1JK1A 1HNZE 2EOHA 1NEIA 3T1YE 2YTIA 4JI5E 1EH6A 2YTGA 1KJKA 5AC5A 4DKKA 1T39A 2F4VE 4B3ME 3C6KA 5IV8B 1F2IG 3JU0A 1IQSA 2EN4A 2YPNA 1A1HA 2EOMA 2E72A 2EQ3A 3DF6A 1YUJA 1ZAAC 1GTKA 2LMZA 2EM4A 2YTDA 5A6BA 5A69A 1EKZA 4BBYA 1G2DC 2EN2A 2CPNA 3C6MA 2R1FA 5DNYA 4WXDA 2YSOA 3FIGA 2WCC3 3P1XA 4R2QA 2JOBA 2NABA 2WBSA 2I13A 4JI0E 1EH8A 2EPPA 2YTNA 2VE7C 2VQFE 2EM9A 3HTXA 5KL2A 1YYWA 2NUGA 1YPNA 2K4VA 2NA2A 2EQ1A 2LVHA 1ZBTA 1N36E 2EL4A 3VK6A 2L2NA 1ZU1A 3HPZA 2YTOA 4R2AA 5AE3A 3MSWA 4X62E 3ECRA 5F3WA 2YZTA 2GPIA 3VHTB 5KL7A 2MDRA 1MEYC 2LT7A 4ZYEA 2RQLA 2EM2A 4LF9E 4M2ZA 1BBOA 4I8OA 4B3RE 1X3CA 2F8BA 2YTFA 2EN7A 2EM6A 2L3CA 2ELYA 1PJSA 4MLQA 2YRMA 2JPAA 2EOIA 1WHNA 4GKKE 4RH8A 4NXNE 2YRKA 1PKPA 3EPKA 2EOQA 2EMYA 4P7DA 5KL3A 4DV2E 2K7IA 1T4OA 4BCAA 3BGHA 2EOZA 4JV5E 4LF5E 2EJ4A 4F9AB 1B69A 4ZYHA 2EWLA 4JI8E 2JYAA 5BR8E 2RSIA 2MC6A 4WSGA 2DLKA 3J7AG 2DSYA 4R03A 2V83A 4WYQB 2ENAA 4N4RB 5A6AA 1GZ6A 3L00A 2EPOA 2EOEA 2L33A 2EPCA 2DRPA 5CFFE 4JI6E 2GHFA 3KWRA 2PRTA 2EPAA 3EPHA 5FLXC 2MKDA 3J81C 4YY3E 3F6HA 3MHSC 2RS7A 2JXPA 3C4BA 2VRDA 1X6FA 2WZOA 3EPLA 4DUZE 1PDAA 2EMLA 4X66E
chains in the Genus database with same CATH topology
2CPNA 4BC9A 3ADGA 4GEQB 1FKAE 5DNYA 4DUYE 5ADZA 4DR1E 2L6MA 2H36X 3FIGA 1DI2A 3AV0A 4B3SE 3P1XA 2L3JA 2LRSA 1RC7A 4DR6E 2B9DA 2DIXA 1STUA 2JOBA 5A2QC 3ZOQB 2UU9E 4JI0E 1UHZA 1X48A 2LUQA 2VE7C 2VQFE 2L2KB 4DV5E 4DR2E 3ADIA 2YT4A 2L2MA 4J8ZA 4WFTA 4X65E 4DR7E 3HXLA 3ADLA 1HNWE 2RSMA 4DV0E 4M0VA 5LL6R 1FJGE 1YYWA 2NUGA 3HTXA 4DMIA 5LMNE 1UILA 4GKJE 1YYKA 1X47A 2FV4B 2K4VA 2V86A 2NA2A 2B7VA 4X64E 2V88A 5AE2A 1ZBTA 1N36E 1T4NA 3LLHA 3VK6A 2L2NA 4LTYA 3DJWA 1N34E 4LF4E 1RQ0A 3HPZA 2LTSA 3LMLA 2LE2A 4BBYA 3MSWA 5AE3A 4X62E 4DV3E 4Q28A 4NXME 4DV1E 5F3WA 1T4LB 2YZTA 4KHPE 1O0WA 1WHQA 2ODRD 2MDRA 2V89A 1WXRA 2LBSB 4LF8E 2M1SA 2FGGA 4TUGA 2UXBE 1XNQE 2IHR1 4BMJA 4LF9E 1DQ3A 3F6GA 4M2ZA 4OX9E 3H09A 2L8TA 4I8OA 3AUZA 4B3RE 4DR3E 2MC5A 2N3GA 4BS9A 2F8BA 2FTXB 4KZSA 4JI7E 4X8WA 4F9CB 3JTZA 2L3CA 4OOGC 3IWDA 4L5NC 4DV6E 4AQYE 4DR4E 4F54A 4LF7E 2UXCE 1HR0E 3OTOE 4JI1E 4LFAE 4DR5E 1WHNA 4L8NA 1N32E 2EZ6A 1X49A 4NXNE 5LMUE 3IWBA 3J7Yp 4GKKE 1IBLE 4LU9A 1XMOE 1PKPA 2M4IA 2DB2A 3T1HE 4DV4E 2M7QA 2V85A 4JI3E 1ZBQA 4P7DA 2ZM6E 1XMQE 4DV2E 4BC7A 2E1MA 3J80C 2NUFA 1YZ9A 2JY9A 1HNXE 1T4OA 2B3TB 2V8QB 4BCAA 2UUBE 1IBME 5T6JA 1GQEA 3HPSA 2ODRC 2JVAA 2DMYA 2B7TA 3ADJA 1YYOA 1IBKE 4JV5E 4LF5E 2NUEA 4F9AB 2UUCE 3VYXA 2E5LE 3JAMC 2KHXA 2RTXA 2EWLA 3VYYA 2N3HA 4JI8E 4WSPA 2JWOA 5AE1A 1J26A 5IWAE 2JOXA 5BR8E 4WPYA 4LFBE 2MC6A 2VQEE 1I94E 2LTRA 3J7AG 4F9BB 3RMPA 4JYAE 2DSYA 2KOUA 2L92A 4R03A 2KONA 2V83A 4WYQB 1GZ6A 2RS6A 4M30A 1J5EE 1HNZE 5IT9C 1N33E 3C4TA 3OMLA 4LF6E 2G7HA 3T1YE 4JI4E 3HQ1A 4JI5E 1XNRE 2L33A 3IWCA 4DKKA 2UUAE 3K6QA 4P78A 5CFFE 4JI6E 2F4VE 3KWRA 4JI2E 2UXDE 4B3ME 3JU0A 4DV7E 5FLXC 3DF6A 1SR9A 5AASA 4YHHE 2HHHE 2LMZA 3J81C 4YY3E 4K0KE 2JR1A 3F6HA 2V87A 4TUIA 2RS7A 4B3TE 2LJHA 4LFCE 3C4BA 2WZOA 1EKZA 4DUZE 1QU6A 2LUPB 2VF1A 4X66E 4R8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R03 A;  3MSW A;  4R8O A; 
#chains in the Genus database with same CATH topology
 5A6J A;  3ADG A;  4ZYG A;  4M9V C;  4R2P A;  4R2S A;  4DR1 E;  2L6M A;  1WRJ A;  1DI2 A;  1RC7 A;  4DR6 E;  1KYQ A;  1BBG A;  2YRH A;  5TSE A;  1X48 A;  2EPM X;  4F2J C;  2LJU A;  4DR2 E;  2HJJ A;  4WFT A;  4X65 E;  1HNW E;  4RHB B;  4M0V A;  4GKJ E;  1PJT A;  2LO3 A;  5AE2 A;  2YSP A;  4LTY A;  3DJW A;  2YTE A;  2LTS A;  3LML A;  3BID A;  2EMH A;  2HC5 A;  2YU5 A;  2CT1 A;  4DV1 E;  1NCS A;  3UK3 C;  4KHP E;  1JK2 A;  2EOR A;  2LBS B;  2FGG A;  2UXB E;  1XNQ E;  2DMI A;  2IHR 1;  5AC4 A;  3F6G A;  2Q8U A;  3H09 A;  2L8T A;  2EMK A;  2EPU A;  2FTX B;  4F6N A;  4JI7 E;  2EM0 A;  4F9C B;  2EPN A;  4DR4 E;  4LF7 E;  3OTO E;  3EPJ A;  1YFH A;  4DR5 E;  1N32 E;  1X49 A;  5LMU E;  2WBT A;  1XMO E;  2M4I A;  3EQ1 A;  2M7Q A;  1ZBQ A;  2ZM6 E;  2YTP A;  2NUF A;  4NHR A;  2V8Q B;  1DGC A;  1GQE A;  3HPS A;  2ODR C;  2JVA A;  2DMY A;  2B7T A;  2EL6 A;  1L4S A;  1UN6 B;  4O5G A;  3JAM C;  1IQO A;  2JWO A;  5IWA E;  1G2F C;  4LFB E;  2LTR A;  3THO B;  2KON A;  4IS1 C;  2EMW A;  1ZR9 A;  5IT9 C;  1A1I A;  4LF6 E;  3HQ1 A;  1SFE A;  2EOX A;  3IWC A;  3TQM A;  1TF6 A;  3BF2 A;  2UUA E;  4FK5 C;  1A1J A;  2EMI A;  4NZV A;  1SR9 A;  4HEI A;  1Z1B A;  4K0K E;  2V87 A;  4IJD A;  1QNT A;  2LJH A;  2EOY A;  4X9J A;  3VYY A;  4R8O A;  4F6M A;  4DUY E;  2YWQ A;  2A25 A;  4B3S E;  2L3J A;  2LRS A;  2B9D A;  2DIX A;  5A2Q C;  1P47 A;  2UU9 E;  1TN9 A;  2CTD A;  1MGT A;  2M9A A;  2ENC A;  4DV5 E;  3ADI A;  2YT4 A;  2EPK X;  4DV0 E;  2EM7 A;  5LL6 R;  1FJG E;  4DMI A;  5LMN E;  1UIL A;  2FV4 B;  2V86 A;  4WXC A;  3KZY A;  2B7V A;  4X64 E;  2V88 A;  1A1F A;  1N34 E;  4LF4 E;  2LV2 A;  2YU8 A;  4BHC A;  1T4L B;  2DLQ A;  1O0W A;  1WHQ A;  2V89 A;  1WXR A;  2EMC A;  2EOF A;  4TUG A;  2EMZ A;  4BMJ A;  1DQ3 A;  4OX9 E;  2GLI A;  5LLQ A;  3AUZ A;  2EN8 A;  2EOJ A;  4DR3 E;  2MC5 A;  2CSH A;  2EN6 A;  4BS9 A;  4KZS A;  4DV6 E;  4L5N C;  2UXC E;  4JI1 E;  2BB8 A;  2J7J A;  5KL4 A;  3QG5 C;  4LU9 A;  3T1H E;  2EMG A;  4JI3 E;  2V85 A;  1AH5 A;  3J80 C;  2E1M A;  1LLM C;  2R76 A;  2JY9 A;  1HNX E;  2EMF A;  4R2D A;  4BHB A;  2EOS A;  4O43 A;  2EP3 A;  2NUE A;  2UUC E;  2E5L E;  2EPL X;  2RTX A;  5A6B D;  4WSP A;  2JOX A;  2VQE E;  1I94 E;  2EE8 A;  2KOU A;  2YTQ A;  4ZYD A;  2D9H A;  3KZZ A;  1BB8 A;  2RS6 A;  4M30 A;  1J5E E;  1N33 E;  1X6H A;  3C4T A;  3OML A;  2G7H A;  4JI4 E;  1XNR E;  3K6Q A;  4P78 A;  5A6K A;  2EPZ A;  1AAY A;  2UXD E;  4JI2 E;  1RMD A;  2MDG A;  4DV7 E;  2EQ0 A;  2EM3 A;  5AAS A;  4YHH E;  2HHH E;  2EN1 A;  4R2C A;  2JR1 A;  4TUI A;  4B3T E;  4LFC E;  1QU6 A;  2LUP B;  4JYA E;  2VF1 A;  1PJQ A;  1TF3 A;  4BC9 A;  1FKA E;  4GEQ B;  2WBU A;  2EN3 A;  5ADZ A;  2H36 X;  3AV0 A;  1STU A;  3ZOQ B;  1UHZ A;  2LUQ A;  2MKN A;  2RPC A;  2DGC A;  1IMU A;  2L2K B;  4Q35 B;  2L2M A;  4J8Z A;  4DR7 E;  3HXL A;  5KL6 A;  3ADL A;  2RSM A;  1YYK A;  1X6E A;  1X47 A;  5IXM B;  3M99 B;  2EPX A;  2ENH A;  2YTJ A;  4KWY A;  1T4N A;  3LLH A;  1EH7 A;  1RQ0 A;  2ADR A;  4GZN C;  2LE2 A;  4DV3 E;  4NXM E;  2BBG A;  4Q28 A;  2ODR D;  4LF8 E;  2M1S A;  1A1K A;  1YSA C;  2EMX A;  2N3G A;  4MLV A;  4R2E A;  2EMA A;  1YUI A;  4X8W A;  2LCE A;  3JTZ A;  4AQY E;  4OOG C;  2EMB A;  3IWD A;  1A1L A;  1X5W A;  4F54 A;  1HR0 E;  4LFA E;  4L8N A;  3MHH C;  2EZ6 A;  3IWB A;  3J7Y p;  1UBD C;  1IBL E;  2DB2 A;  4DV4 E;  2EL5 A;  1XMQ E;  1YZ9 A;  1WJP A;  4BC7 A;  4O24 A;  3THN A;  1T38 A;  2UUB E;  1N3G A;  2B3T B;  4WX9 A;  1IBM E;  5T6J A;  1YYO A;  1IBK E;  2EPR A;  3ADJ A;  3VYX A;  2EM8 A;  2KHX A;  2N8X A;  1A1G A;  2N3H A;  4HTG A;  5AE1 A;  2EM5 A;  1J26 A;  2HGH A;  2I9I A;  4WPY A;  2JP9 A;  4F9B B;  3RMP A;  5KL5 A;  2L92 A;  3BBG A;  4R2R A;  4O4K A;  2ELZ A;  2EOO A;  1JK1 A;  1HNZ E;  2EOH A;  1NEI A;  3T1Y E;  2YTI A;  4JI5 E;  1EH6 A;  2YTG A;  1KJK A;  5AC5 A;  4DKK A;  1T39 A;  2F4V E;  4B3M E;  3C6K A;  5IV8 B;  1F2I G;  3JU0 A;  1IQS A;  2EN4 A;  2YPN A;  1A1H A;  2EOM A;  2E72 A;  2EQ3 A;  3DF6 A;  1YUJ A;  1ZAA C;  1GTK A;  2LMZ A;  2EM4 A;  2YTD A;  5A6B A;  5A69 A;  1EKZ A;  4BBY A;  1G2D C;  2EN2 A;  2CPN A;  3C6M A;  2R1F A;  5DNY A;  4WXD A;  2YSO A;  3FIG A;  2WCC 3;  3P1X A;  4R2Q A;  2JOB A;  2NAB A;  2WBS A;  2I13 A;  4JI0 E;  1EH8 A;  2EPP A;  2YTN A;  2VE7 C;  2VQF E;  2EM9 A;  3HTX A;  5KL2 A;  1YYW A;  2NUG A;  1YPN A;  2K4V A;  2NA2 A;  2EQ1 A;  2LVH A;  1ZBT A;  1N36 E;  2EL4 A;  3VK6 A;  2L2N A;  1ZU1 A;  3HPZ A;  2YTO A;  4R2A A;  5AE3 A;  3MSW A;  4X62 E;  3ECR A;  5F3W A;  2YZT A;  2GPI A;  3VHT B;  5KL7 A;  2MDR A;  1MEY C;  2LT7 A;  4ZYE A;  2RQL A;  2EM2 A;  4LF9 E;  4M2Z A;  1BBO A;  4I8O A;  4B3R E;  1X3C A;  2F8B A;  2YTF A;  2EN7 A;  2EM6 A;  2L3C A;  2ELY A;  1PJS A;  4MLQ A;  2YRM A;  2JPA A;  2EOI A;  1WHN A;  4GKK E;  4RH8 A;  4NXN E;  2YRK A;  1PKP A;  3EPK A;  2EOQ A;  2EMY A;  4P7D A;  5KL3 A;  4DV2 E;  2K7I A;  1T4O A;  4BCA A;  3BGH A;  2EOZ A;  4JV5 E;  4LF5 E;  2EJ4 A;  4F9A B;  1B69 A;  4ZYH A;  2EWL A;  4JI8 E;  2JYA A;  5BR8 E;  2RSI A;  2MC6 A;  4WSG A;  2DLK A;  3J7A G;  2DSY A;  4R03 A;  2V83 A;  4WYQ B;  2ENA A;  4N4R B;  5A6A A;  1GZ6 A;  3L00 A;  2EPO A;  2EOE A;  2L33 A;  2EPC A;  2DRP A;  5CFF E;  4JI6 E;  2GHF A;  3KWR A;  2PRT A;  2EPA A;  3EPH A;  5FLX C;  2MKD A;  3J81 C;  4YY3 E;  3F6H A;  3MHS C;  2RS7 A;  2JXP A;  3C4B A;  2VRD A;  1X6F A;  2WZO A;  3EPL A;  4DUZ E;  1PDA A;  2EML A;  4X66 E; 
#chains in the Genus database with same CATH homology
 2CPN A;  4BC9 A;  3ADG A;  4GEQ B;  1FKA E;  5DNY A;  4DUY E;  5ADZ A;  4DR1 E;  2L6M A;  2H36 X;  3FIG A;  1DI2 A;  3AV0 A;  4B3S E;  3P1X A;  2L3J A;  2LRS A;  1RC7 A;  4DR6 E;  2B9D A;  2DIX A;  1STU A;  2JOB A;  5A2Q C;  3ZOQ B;  2UU9 E;  4JI0 E;  1UHZ A;  1X48 A;  2LUQ A;  2VE7 C;  2VQF E;  2L2K B;  4DV5 E;  4DR2 E;  3ADI A;  2YT4 A;  2L2M A;  4J8Z A;  4WFT A;  4X65 E;  4DR7 E;  3HXL A;  3ADL A;  1HNW E;  2RSM A;  4DV0 E;  4M0V A;  5LL6 R;  1FJG E;  1YYW A;  2NUG A;  3HTX A;  4DMI A;  5LMN E;  1UIL A;  4GKJ E;  1YYK A;  1X47 A;  2FV4 B;  2K4V A;  2V86 A;  2NA2 A;  2B7V A;  4X64 E;  2V88 A;  5AE2 A;  1ZBT A;  1N36 E;  1T4N A;  3LLH A;  3VK6 A;  2L2N A;  4LTY A;  3DJW A;  1N34 E;  4LF4 E;  1RQ0 A;  3HPZ A;  2LTS A;  3LML A;  2LE2 A;  4BBY A;  3MSW A;  5AE3 A;  4X62 E;  4DV3 E;  4Q28 A;  4NXM E;  4DV1 E;  5F3W A;  1T4L B;  2YZT A;  4KHP E;  1O0W A;  1WHQ A;  2ODR D;  2MDR A;  2V89 A;  1WXR A;  2LBS B;  4LF8 E;  2M1S A;  2FGG A;  4TUG A;  2UXB E;  1XNQ E;  2IHR 1;  4BMJ A;  4LF9 E;  1DQ3 A;  3F6G A;  4M2Z A;  4OX9 E;  3H09 A;  2L8T A;  4I8O A;  3AUZ A;  4B3R E;  4DR3 E;  2MC5 A;  2N3G A;  4BS9 A;  2F8B A;  2FTX B;  4KZS A;  4JI7 E;  4X8W A;  4F9C B;  3JTZ A;  2L3C A;  4OOG C;  3IWD A;  4L5N C;  4DV6 E;  4AQY E;  4DR4 E;  4F54 A;  4LF7 E;  2UXC E;  1HR0 E;  3OTO E;  4JI1 E;  4LFA E;  4DR5 E;  1WHN A;  4L8N A;  1N32 E;  2EZ6 A;  1X49 A;  4NXN E;  5LMU E;  3IWB A;  3J7Y p;  4GKK E;  1IBL E;  4LU9 A;  1XMO E;  1PKP A;  2M4I A;  2DB2 A;  3T1H E;  4DV4 E;  2M7Q A;  2V85 A;  4JI3 E;  1ZBQ A;  4P7D A;  2ZM6 E;  1XMQ E;  4DV2 E;  4BC7 A;  2E1M A;  3J80 C;  2NUF A;  1YZ9 A;  2JY9 A;  1HNX E;  1T4O A;  2B3T B;  2V8Q B;  4BCA A;  2UUB E;  1IBM E;  5T6J A;  1GQE A;  3HPS A;  2ODR C;  2JVA A;  2DMY A;  2B7T A;  3ADJ A;  1YYO A;  1IBK E;  4JV5 E;  4LF5 E;  2NUE A;  4F9A B;  2UUC E;  3VYX A;  2E5L E;  3JAM C;  2KHX A;  2RTX A;  2EWL A;  3VYY A;  2N3H A;  4JI8 E;  4WSP A;  2JWO A;  5AE1 A;  1J26 A;  5IWA E;  2JOX A;  5BR8 E;  4WPY A;  4LFB E;  2MC6 A;  2VQE E;  1I94 E;  2LTR A;  3J7A G;  4F9B B;  3RMP A;  4JYA E;  2DSY A;  2KOU A;  2L92 A;  4R03 A;  2KON A;  2V83 A;  4WYQ B;  1GZ6 A;  2RS6 A;  4M30 A;  1J5E E;  1HNZ E;  5IT9 C;  1N33 E;  3C4T A;  3OML A;  4LF6 E;  2G7H A;  3T1Y E;  4JI4 E;  3HQ1 A;  4JI5 E;  1XNR E;  2L33 A;  3IWC A;  4DKK A;  2UUA E;  3K6Q A;  4P78 A;  5CFF E;  4JI6 E;  2F4V E;  3KWR A;  4JI2 E;  2UXD E;  4B3M E;  3JU0 A;  4DV7 E;  5FLX C;  3DF6 A;  1SR9 A;  5AAS A;  4YHH E;  2HHH E;  2LMZ A;  3J81 C;  4YY3 E;  4K0K E;  2JR1 A;  3F6H A;  2V87 A;  4TUI A;  2RS7 A;  4B3T E;  2LJH A;  4LFC E;  3C4B A;  2WZO A;  1EKZ A;  4DUZ E;  1QU6 A;  2LUP B;  2VF1 A;  4X66 E;  4R8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...