4R03A

Crystal structure of a duf3836 family protein (bdi_3222) from parabacteroides distasonis atcc 8503 at 1.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
109
Chain Sequence
b'GKDYLYDTKEENGKIISKVVFLQENGLLNKQVRYEFQYNENGKVSEKKAFRWDRTNDEWVPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLNVQNMIIPSTNYEEIFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Parabacteroides distasonis atcc 8503
publication title Crystal structure of a hypothetical protein (BDI_3222) from Parabacteroides distasonis ATCC 8503 at 1.50 A resolution
rcsb
total genus 19
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4r03A00
3MSWA 4R03A 4R8OA
chains in the Genus database with same CATH superfamily
4LFBE 2DMYA 4M2ZA 4JI1E 3HQ1A 1A1JA 3AV0A 2UU9E 2EL5A 1T38A 1NCSA 3OTOE 4M9VC 2EPPA 3C6KA 2E72A 1EKZA 2L33A 3ADJA 2EM6A 2JR1A 4LF6E 3EPJA 2EZ6A 4GEQB 3KZZA 2V89A 1GZ6A 2EPOA 1IQOA 5LLQA 3T1YE 2HJJA 4BC9A 2F8BA 3C4TA 1X6HA 1HNZE 4HTGA 3VK6A 2L3JA 1G2FC 1F2IG 4BCAA 2LV2A 3BF2A 2R1FA 1GQEA 2YSPA 5AC4A 1WHQA 1B69A 1A1FA 5BR8E 1TF3A 2CPNA 2CSHA 2EOSA 2JYAA 4AQYE 1DQ3A 4GZNC 1PJSA 1A1HA 2B9DA 1KJKA 1SR9A 3H09A 1J5EE 1YYKA 4F6MA 2F4VE 2JP9A 2M1SA 3P1XA 2EM0A 2ENCA 4DR3E 2KHXA 3IWDA 5A6KA 4LFAE 2EM8A 4WXDA 2YU8A 2UUBE 2EM7A 2JY9A 4OOGC 1JK2A 4LF8E 3ZOQB 1DI2A 3HTXA 4JI8E 1YFHA 1XMOE 4X9JA 2RSMA 4N4RB 2LCEA 4LF7E 2WBSA 2ENHA 4WSPA 2EQ3A 1WJPA 1T39A 2FGGA 4RH8A 2E1MA 1IBLE 5A6AA 1MEYC 1O0WA 2YRKA 3VHTB 1I94E 2YTNA 2Q8UA 2ELZA 1PJTA 2EMGA 4ZYGA 5KL4A 3RMPA 2G7HA 2EPCA 2YZTA 2VE7C 1UN6B 5AE2A 2EOQA 2LO3A 4GKJE 1SFEA 2MC6A 2EPLX 3ADIA 2GPIA 4WFTA 2LUPB 1WXRA 3ADLA 1ZU1A 1T4NA 5A6BA 1EH8A 4R2EA 2YTJA 4R2QA 2LE2A 1PDAA 4F2JC 1ZBQA 2E5LE 4DR6E 4KZSA 2V86A 2LRSA 4HEIA 2YTDA 4NXNE 4BBYA 3THNA 2EMKA 2L2MA 4R8OA 4R2DA 1G2DC 4DR7E 4DV5E 3KWRA 1FJGE 1HNXE 2L8TA 4BS9A 2DGCA 3J81C 1UBDC 2EN8A 2YTQA 4NXME 2GHFA 2EOXA 5KL6A 1FKAE 1WRJA 2RTXA 2JWOA 4F9BB 3LMLA 2DIXA 4GKKE 1IQSA 2EOZA 2N3HA 4DMIA 3BBGA 5A69A 2EPAA 1BB8A 2YTFA 3C4BA 2H36X 5A6JA 5F3WA 4M30A 1MGTA 2K4VA 2ENAA 2L2KB 1T4LB 4TUGA 2DLKA 3OMLA 2EQ0A 1N33E 4M0VA 2LBSB 3VYXA 4WXCA 2EMZA 1ZBTA 1X6EA 4JI4E 1YZ9A 3EPKA 4DR2E 1PJQA 2YPNA 2WBTA 1DGCA 2EP3A 2EMAA 3F6GA 2JOXA 4FK5C 3EPHA 4JI6E 2EWLA 2UXBE 2KONA 3M99B 4DR5E 1TN9A 1YUJA 4LF5E 4L5NC 1NEIA 1YUIA 4F9AB 3MHSC 2EPUA 4OX9E 1RC7A 4LF9E 2JVAA 1BBGA 2M4IA 3JTZA 4WYQB 1STUA 2RQLA 2YRMA 4F9CB 4JI0E 4X8WA 3VYYA 3MHHC 4IS1C 2EM2A 5AC5A 3KZYA 2VQEE 2YRHA 1RQ0A 4R2RA 2DRPA 2VQFE 4BC7A 4DV2E 2GLIA 3MSWA 2ELYA 2EMYA 2RS6A 2MKNA 2EOJA 2UUCE 1GTKA 2V83A 1WHNA 3F6HA 3ECRA 1ZAAC 4LFCE 2LT7A 1RMDA 2EORA 3LLHA 4O5GA 1J26A 2EMIA 5CFFE 3HPZA 2YTOA 3DF6A 4LTYA 2EPZA 4BMJA 4DUZE 2EM5A 2EPRA 1A1IA 1JK1A 2EMCA 2EPKX 4WPYA 1IMUA 2EMFA 3EPLA 2A25A 2RSIA 2MDRA 2EMWA 2CT1A 4MLQA 2EJ4A 2B7TA 2EOIA 2K7IA 3IWBA 4BHBA 4JI2E 1QU6A 2JPAA 1A1LA 2YTIA 2EM9A 4YHHE 4DR1E 1EH7A 2ODRC 2EM3A 2LMZA 4JI5E 5AE1A 4X64E 2I9IA 5IXMB 1LLMC 1EH6A 1X47A 2N3GA 1IBME 2NUGA 2HC5A 4DV7E 2EPXA 4F54A 4Q35B 4X66E 2L3CA 5IV8B 2EOMA 4R2CA 4ZYEA 5TSEA 5KL5A 2LUQA 3HXLA 5AASA 2EQ1A 2LJHA 3FIGA 4DKKA 4R2PA 2YU5A 2V87A 4O24A 2UXCE 2VRDA 3J7AG 5KL7A 4DV4E 1L4SA 2MKDA 2DB2A 5A2QC 5LMNE 2M7QA 4DR4E 2EOFA 1QNTA 1AAYA 3BGHA 2NUFA 2R76A 4J8ZA 2V85A 1IBKE 1YYOA 4NZVA 1HR0E 1X5WA 5KL3A 5LL6R 1KYQA 4B3TE 2YT4A 4P78A 2CTDA 4DV3E 2HGHA 2L2NA 1ZR9A 3C6MA 4X65E 4DUYE 2EMHA 4JYAE 2EL4A 2NABA 3TQMA 4JV5E 2YTGA 4X62E 4WX9A 5DNYA 2EN1A 1TF6A 2LTRA 2BBGA 5IT9C 4IJDA 4WSGA 2YTEA 2J7JA 2WBUA 1YSAC 2EN7A 1XNQE 1YYWA 2EN2A 2EPMX 2IHR1 5FLXC 4R2AA 4R2SA 4K0KE 2BB8A 3BIDA 2EMXA 2EN4A 2ADRA 4P7DA 5T6JA 3QG5C 2B3TB 3THOB 2EN6A 4L8NA 4DV6E 1UILA 2V88A 1XNRE 2DSYA 5A6BD 2YWQA 4JI3E 2RPCA 5KL2A 2EOEA 3HPSA 4BHCA 1UHZA 2KOUA 4R03A 4DV1E 1X49A 2LVHA 2EN3A 2EMLA 2YSOA 1N36E 2UXDE 1A1GA 1N3GA 4ZYDA 3J7Yp 3JU0A 4TUIA 2NUEA 1X3CA 2NA2A 2WCC3 4B3ME 2MC5A 2EL6A 2LJUA 2M9AA 1BBOA 4LU9A 1Z1BA 1YPNA 3UK3C 1A1KA 2L6MA 2I13A 2JXPA 4B3RE 2FV4B 3DJWA 4F6NA 2HHHE 2EOOA 1X48A 4DV0E 4JI7E 2WZOA 1XMQE 4O4KA 2JOBA 2MDGA 2ZM6E 2RS7A 4I8OA 2ODRD 2DLQA 4KWYA 2UUAE 5AE3A 1T4OA 4O43A 2EM4A 2PRTA 1AH5A 2EOYA 2EE8A 3JAMC 3IWCA 2EOHA 4NHRA 3EQ1A 2YTPA 1N32E 1P47A 2V8QB 1PKPA 2FTXB 2N8XA 2DMIA 2B7VA 3ADGA 5LMUE 2LTSA 2EPNA 3L00A 4B3SE 4YY3E 2VF1A 4RHBB 1HNWE 3J80C 2EMBA 1N34E 1X6FA 2L92A 3K6QA 5IWAE 3AUZA 4LF4E 4Q28A 3T1HE 2D9HA 4MLVA 5ADZA 4ZYHA 4KHPE
chains in the Genus database with same CATH topology
4X62E 2VQEE 4LFBE 2DMYA 5DNYA 1RQ0A 4JI1E 4M2ZA 2LTRA 3HQ1A 2MC6A 3AV0A 4BC7A 2VQFE 2UU9E 4DV2E 5IT9C 3ADIA 2LUPB 4WFTA 3MSWA 1WXRA 1YYWA 3OTOE 1XNQE 2RS6A 3ADLA 1T4NA 2UUCE 2V83A 1EKZA 1WHNA 2L33A 3F6HA 3ADJA 2IHR1 4LFCE 5FLXC 2JR1A 2LE2A 4K0KE 4LF6E 2EZ6A 5T6JA 4P7DA 1ZBQA 2E5LE 3LLHA 4KZSA 4GEQB 4DR6E 2B3TB 2V89A 2V86A 1GZ6A 2LRSA 1J26A 5CFFE 4L8NA 4BBYA 4DV6E 3HPZA 2L2MA 4R8OA 4NXNE 1UILA 2V88A 3T1YE 1XNRE 4DR7E 2DSYA 4DV5E 3KWRA 1FJGE 4JI3E 3DF6A 4LTYA 1HNXE 3HPSA 4BC9A 2F8BA 1UHZA 2KOUA 2L8TA 3C4TA 4R03A 4BMJA 1X49A 4BS9A 3J81C 4WPYA 4DUZE 4DV1E 1HNZE 4NXME 3VK6A 1N36E 2UXDE 2MDRA 2L3JA 3J7Yp 2B7TA 3JU0A 4TUIA 1FKAE 2NA2A 3IWBA 4BCAA 2NUEA 4JI2E 1QU6A 2RTXA 1GQEA 2JWOA 4F9BB 3LMLA 4B3ME 2DIXA 1WHQA 4GKKE 2MC5A 4YHHE 2N3HA 4DMIA 4DR1E 5BR8E 2ODRC 2CPNA 4LU9A 2LMZA 4JI5E 5AE1A 4X64E 2L6MA 4AQYE 1DQ3A 3C4BA 1X47A 4B3RE 2N3GA 2H36X 1IBME 5F3WA 2FV4B 3DJWA 2NUGA 2B9DA 1SR9A 3H09A 4M30A 1J5EE 4DV7E 2HHHE 1YYKA 1X48A 4F54A 2F4VE 2K4VA 4X66E 2L3CA 4DV0E 2L2KB 4JI7E 1T4LB 4TUGA 2M1SA 3P1XA 2WZOA 2LUQA 3OMLA 3HXLA 5AASA 1XMQE 2JOBA 2ZM6E 1N33E 4DR3E 4M0VA 2LJHA 2RS7A 2KHXA 2ODRD 3FIGA 3IWDA 4I8OA 4DKKA 2LBSB 4LFAE 3VYXA 2UXCE 2V87A 2UUAE 3J7AG 4DV4E 5AE3A 1ZBTA 1T4OA 2UUBE 2JY9A 2DB2A 4OOGC 5A2QC 4LF8E 3ZOQB 5LMNE 2M7QA 4JI4E 1DI2A 3HTXA 4JI8E 4DR4E 1XMOE 1YZ9A 3JAMC 4DR2E 2RSMA 4LF7E 3IWCA 2NUFA 4J8ZA 2V85A 4WSPA 1N32E 1IBKE 2FGGA 1YYOA 1HR0E 2V8QB 1PKPA 2E1MA 2FTXB 3F6GA 2JOXA 1IBLE 1O0WA 2B7VA 3ADGA 5LL6R 1I94E 4JI6E 2EWLA 5LMUE 2LTSA 2UXBE 2KONA 4DR5E 4B3TE 4LF5E 4L5NC 2YT4A 4YY3E 4P78A 4B3SE 2VF1A 1HNWE 4F9AB 3J80C 4OX9E 4DV3E 1RC7A 4LF9E 2JVAA 2M4IA 3RMPA 1N34E 2G7HA 2L2NA 2L92A 2VE7C 2YZTA 3JTZA 3AUZA 1STUA 3K6QA 4WYQB 5IWAE 4X65E 4DUYE 4LF4E 4Q28A 4F9CB 3T1HE 4JYAE 5ADZA 4JI0E 4X8WA 5AE2A 3VYYA 4JV5E 4KHPE 4GKJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSW A;  4R03 A;  4R8O A; 
#chains in the Genus database with same CATH topology
 4LFB E;  2DMY A;  4M2Z A;  4JI1 E;  3HQ1 A;  1A1J A;  3AV0 A;  2UU9 E;  2EL5 A;  1T38 A;  1NCS A;  3OTO E;  4M9V C;  2EPP A;  3C6K A;  2E72 A;  1EKZ A;  2L33 A;  3ADJ A;  2EM6 A;  2JR1 A;  4LF6 E;  3EPJ A;  2EZ6 A;  4GEQ B;  3KZZ A;  2V89 A;  1GZ6 A;  2EPO A;  1IQO A;  5LLQ A;  3T1Y E;  2HJJ A;  4BC9 A;  2F8B A;  3C4T A;  1X6H A;  1HNZ E;  4HTG A;  3VK6 A;  2L3J A;  1G2F C;  1F2I G;  4BCA A;  2LV2 A;  3BF2 A;  2R1F A;  1GQE A;  2YSP A;  5AC4 A;  1WHQ A;  1B69 A;  1A1F A;  5BR8 E;  1TF3 A;  2CPN A;  2CSH A;  2EOS A;  2JYA A;  4AQY E;  1DQ3 A;  4GZN C;  1PJS A;  1A1H A;  2B9D A;  1KJK A;  1SR9 A;  3H09 A;  1J5E E;  1YYK A;  4F6M A;  2F4V E;  2JP9 A;  2M1S A;  3P1X A;  2EM0 A;  2ENC A;  4DR3 E;  2KHX A;  3IWD A;  5A6K A;  4LFA E;  2EM8 A;  4WXD A;  2YU8 A;  2UUB E;  2EM7 A;  2JY9 A;  4OOG C;  1JK2 A;  4LF8 E;  3ZOQ B;  1DI2 A;  3HTX A;  4JI8 E;  1YFH A;  1XMO E;  4X9J A;  2RSM A;  4N4R B;  2LCE A;  4LF7 E;  2WBS A;  2ENH A;  4WSP A;  2EQ3 A;  1WJP A;  1T39 A;  2FGG A;  4RH8 A;  2E1M A;  1IBL E;  5A6A A;  1MEY C;  1O0W A;  2YRK A;  3VHT B;  1I94 E;  2YTN A;  2Q8U A;  2ELZ A;  1PJT A;  2EMG A;  4ZYG A;  5KL4 A;  3RMP A;  2G7H A;  2EPC A;  2YZT A;  2VE7 C;  1UN6 B;  5AE2 A;  2EOQ A;  2LO3 A;  4GKJ E;  1SFE A;  2MC6 A;  2EPL X;  3ADI A;  2GPI A;  4WFT A;  2LUP B;  1WXR A;  3ADL A;  1ZU1 A;  1T4N A;  5A6B A;  1EH8 A;  4R2E A;  2YTJ A;  4R2Q A;  2LE2 A;  1PDA A;  4F2J C;  1ZBQ A;  2E5L E;  4DR6 E;  4KZS A;  2V86 A;  2LRS A;  4HEI A;  2YTD A;  4NXN E;  4BBY A;  3THN A;  2EMK A;  2L2M A;  4R8O A;  4R2D A;  1G2D C;  4DR7 E;  4DV5 E;  3KWR A;  1FJG E;  1HNX E;  2L8T A;  4BS9 A;  2DGC A;  3J81 C;  1UBD C;  2EN8 A;  2YTQ A;  4NXM E;  2GHF A;  2EOX A;  5KL6 A;  1FKA E;  1WRJ A;  2RTX A;  2JWO A;  4F9B B;  3LML A;  2DIX A;  4GKK E;  1IQS A;  2EOZ A;  2N3H A;  4DMI A;  3BBG A;  5A69 A;  2EPA A;  1BB8 A;  2YTF A;  3C4B A;  2H36 X;  5A6J A;  5F3W A;  4M30 A;  1MGT A;  2K4V A;  2ENA A;  2L2K B;  1T4L B;  4TUG A;  2DLK A;  3OML A;  2EQ0 A;  1N33 E;  4M0V A;  2LBS B;  3VYX A;  4WXC A;  2EMZ A;  1ZBT A;  1X6E A;  4JI4 E;  1YZ9 A;  3EPK A;  4DR2 E;  1PJQ A;  2YPN A;  2WBT A;  1DGC A;  2EP3 A;  2EMA A;  3F6G A;  2JOX A;  4FK5 C;  3EPH A;  4JI6 E;  2EWL A;  2UXB E;  2KON A;  3M99 B;  4DR5 E;  1TN9 A;  1YUJ A;  4LF5 E;  4L5N C;  1NEI A;  1YUI A;  4F9A B;  3MHS C;  2EPU A;  4OX9 E;  1RC7 A;  4LF9 E;  2JVA A;  1BBG A;  2M4I A;  3JTZ A;  4WYQ B;  1STU A;  2RQL A;  2YRM A;  4F9C B;  4JI0 E;  4X8W A;  3VYY A;  3MHH C;  4IS1 C;  2EM2 A;  5AC5 A;  3KZY A;  2VQE E;  2YRH A;  1RQ0 A;  4R2R A;  2DRP A;  2VQF E;  4BC7 A;  4DV2 E;  2GLI A;  3MSW A;  2ELY A;  2EMY A;  2RS6 A;  2MKN A;  2EOJ A;  2UUC E;  1GTK A;  2V83 A;  1WHN A;  3F6H A;  3ECR A;  1ZAA C;  4LFC E;  2LT7 A;  1RMD A;  2EOR A;  3LLH A;  4O5G A;  1J26 A;  2EMI A;  5CFF E;  3HPZ A;  2YTO A;  3DF6 A;  4LTY A;  2EPZ A;  4BMJ A;  4DUZ E;  2EM5 A;  2EPR A;  1A1I A;  1JK1 A;  2EMC A;  2EPK X;  4WPY A;  1IMU A;  2EMF A;  3EPL A;  2A25 A;  2RSI A;  2MDR A;  2EMW A;  2CT1 A;  4MLQ A;  2EJ4 A;  2B7T A;  2EOI A;  2K7I A;  3IWB A;  4BHB A;  4JI2 E;  1QU6 A;  2JPA A;  1A1L A;  2YTI A;  2EM9 A;  4YHH E;  4DR1 E;  1EH7 A;  2ODR C;  2EM3 A;  2LMZ A;  4JI5 E;  5AE1 A;  4X64 E;  2I9I A;  5IXM B;  1LLM C;  1EH6 A;  1X47 A;  2N3G A;  1IBM E;  2NUG A;  2HC5 A;  4DV7 E;  2EPX A;  4F54 A;  4Q35 B;  4X66 E;  2L3C A;  5IV8 B;  2EOM A;  4R2C A;  4ZYE A;  5TSE A;  5KL5 A;  2LUQ A;  3HXL A;  5AAS A;  2EQ1 A;  2LJH A;  3FIG A;  4DKK A;  4R2P A;  2YU5 A;  2V87 A;  4O24 A;  2UXC E;  2VRD A;  3J7A G;  5KL7 A;  4DV4 E;  1L4S A;  2MKD A;  2DB2 A;  5A2Q C;  5LMN E;  2M7Q A;  4DR4 E;  2EOF A;  1QNT A;  1AAY A;  3BGH A;  2NUF A;  2R76 A;  4J8Z A;  2V85 A;  1IBK E;  1YYO A;  4NZV A;  1HR0 E;  1X5W A;  5KL3 A;  5LL6 R;  1KYQ A;  4B3T E;  2YT4 A;  4P78 A;  2CTD A;  4DV3 E;  2HGH A;  2L2N A;  1ZR9 A;  3C6M A;  4X65 E;  4DUY E;  2EMH A;  4JYA E;  2EL4 A;  2NAB A;  3TQM A;  4JV5 E;  2YTG A;  4X62 E;  4WX9 A;  5DNY A;  2EN1 A;  1TF6 A;  2LTR A;  2BBG A;  5IT9 C;  4IJD A;  4WSG A;  2YTE A;  2J7J A;  2WBU A;  1YSA C;  2EN7 A;  1XNQ E;  1YYW A;  2EN2 A;  2EPM X;  2IHR 1;  5FLX C;  4R2A A;  4R2S A;  4K0K E;  2BB8 A;  3BID A;  2EMX A;  2EN4 A;  2ADR A;  4P7D A;  5T6J A;  3QG5 C;  2B3T B;  3THO B;  2EN6 A;  4L8N A;  4DV6 E;  1UIL A;  2V88 A;  1XNR E;  2DSY A;  5A6B D;  2YWQ A;  4JI3 E;  2RPC A;  5KL2 A;  2EOE A;  3HPS A;  4BHC A;  1UHZ A;  2KOU A;  4R03 A;  4DV1 E;  1X49 A;  2LVH A;  2EN3 A;  2EML A;  2YSO A;  1N36 E;  2UXD E;  1A1G A;  1N3G A;  4ZYD A;  3J7Y p;  3JU0 A;  4TUI A;  2NUE A;  1X3C A;  2NA2 A;  2WCC 3;  4B3M E;  2MC5 A;  2EL6 A;  2LJU A;  2M9A A;  1BBO A;  4LU9 A;  1Z1B A;  1YPN A;  3UK3 C;  1A1K A;  2L6M A;  2I13 A;  2JXP A;  4B3R E;  2FV4 B;  3DJW A;  4F6N A;  2HHH E;  2EOO A;  1X48 A;  4DV0 E;  4JI7 E;  2WZO A;  1XMQ E;  4O4K A;  2JOB A;  2MDG A;  2ZM6 E;  2RS7 A;  4I8O A;  2ODR D;  2DLQ A;  4KWY A;  2UUA E;  5AE3 A;  1T4O A;  4O43 A;  2EM4 A;  2PRT A;  1AH5 A;  2EOY A;  2EE8 A;  3JAM C;  3IWC A;  2EOH A;  4NHR A;  3EQ1 A;  2YTP A;  1N32 E;  1P47 A;  2V8Q B;  1PKP A;  2FTX B;  2N8X A;  2DMI A;  2B7V A;  3ADG A;  5LMU E;  2LTS A;  2EPN A;  3L00 A;  4B3S E;  4YY3 E;  2VF1 A;  4RHB B;  1HNW E;  3J80 C;  2EMB A;  1N34 E;  1X6F A;  2L92 A;  3K6Q A;  5IWA E;  3AUZ A;  4LF4 E;  4Q28 A;  3T1H E;  2D9H A;  4MLV A;  5ADZ A;  4ZYH A;  4KHP E; 
#chains in the Genus database with same CATH homology
 4X62 E;  2VQE E;  4LFB E;  2DMY A;  5DNY A;  1RQ0 A;  4JI1 E;  4M2Z A;  2LTR A;  3HQ1 A;  2MC6 A;  3AV0 A;  4BC7 A;  2VQF E;  2UU9 E;  4DV2 E;  5IT9 C;  3ADI A;  2LUP B;  4WFT A;  3MSW A;  1WXR A;  1YYW A;  3OTO E;  1XNQ E;  2RS6 A;  3ADL A;  1T4N A;  2UUC E;  2V83 A;  1EKZ A;  1WHN A;  2L33 A;  3F6H A;  3ADJ A;  2IHR 1;  4LFC E;  5FLX C;  2JR1 A;  2LE2 A;  4K0K E;  4LF6 E;  2EZ6 A;  5T6J A;  4P7D A;  1ZBQ A;  2E5L E;  3LLH A;  4KZS A;  4GEQ B;  4DR6 E;  2B3T B;  2V89 A;  2V86 A;  1GZ6 A;  2LRS A;  1J26 A;  5CFF E;  4L8N A;  4BBY A;  4DV6 E;  3HPZ A;  2L2M A;  4R8O A;  4NXN E;  1UIL A;  2V88 A;  3T1Y E;  1XNR E;  4DR7 E;  2DSY A;  4DV5 E;  3KWR A;  1FJG E;  4JI3 E;  3DF6 A;  4LTY A;  1HNX E;  3HPS A;  4BC9 A;  2F8B A;  1UHZ A;  2KOU A;  2L8T A;  3C4T A;  4R03 A;  4BMJ A;  1X49 A;  4BS9 A;  3J81 C;  4WPY A;  4DUZ E;  4DV1 E;  1HNZ E;  4NXM E;  3VK6 A;  1N36 E;  2UXD E;  2MDR A;  2L3J A;  3J7Y p;  2B7T A;  3JU0 A;  4TUI A;  1FKA E;  2NA2 A;  3IWB A;  4BCA A;  2NUE A;  4JI2 E;  1QU6 A;  2RTX A;  1GQE A;  2JWO A;  4F9B B;  3LML A;  4B3M E;  2DIX A;  1WHQ A;  4GKK E;  2MC5 A;  4YHH E;  2N3H A;  4DMI A;  4DR1 E;  5BR8 E;  2ODR C;  2CPN A;  4LU9 A;  2LMZ A;  4JI5 E;  5AE1 A;  4X64 E;  2L6M A;  4AQY E;  1DQ3 A;  3C4B A;  1X47 A;  4B3R E;  2N3G A;  2H36 X;  1IBM E;  5F3W A;  2FV4 B;  3DJW A;  2NUG A;  2B9D A;  1SR9 A;  3H09 A;  4M30 A;  1J5E E;  4DV7 E;  2HHH E;  1YYK A;  1X48 A;  4F54 A;  2F4V E;  2K4V A;  4X66 E;  2L3C A;  4DV0 E;  2L2K B;  4JI7 E;  1T4L B;  4TUG A;  2M1S A;  3P1X A;  2WZO A;  2LUQ A;  3OML A;  3HXL A;  5AAS A;  1XMQ E;  2JOB A;  2ZM6 E;  1N33 E;  4DR3 E;  4M0V A;  2LJH A;  2RS7 A;  2KHX A;  2ODR D;  3FIG A;  3IWD A;  4I8O A;  4DKK A;  2LBS B;  4LFA E;  3VYX A;  2UXC E;  2V87 A;  2UUA E;  3J7A G;  4DV4 E;  5AE3 A;  1ZBT A;  1T4O A;  2UUB E;  2JY9 A;  2DB2 A;  4OOG C;  5A2Q C;  4LF8 E;  3ZOQ B;  5LMN E;  2M7Q A;  4JI4 E;  1DI2 A;  3HTX A;  4JI8 E;  4DR4 E;  1XMO E;  1YZ9 A;  3JAM C;  4DR2 E;  2RSM A;  4LF7 E;  3IWC A;  2NUF A;  4J8Z A;  2V85 A;  4WSP A;  1N32 E;  1IBK E;  2FGG A;  1YYO A;  1HR0 E;  2V8Q B;  1PKP A;  2E1M A;  2FTX B;  3F6G A;  2JOX A;  1IBL E;  1O0W A;  2B7V A;  3ADG A;  5LL6 R;  1I94 E;  4JI6 E;  2EWL A;  5LMU E;  2LTS A;  2UXB E;  2KON A;  4DR5 E;  4B3T E;  4LF5 E;  4L5N C;  2YT4 A;  4YY3 E;  4P78 A;  4B3S E;  2VF1 A;  1HNW E;  4F9A B;  3J80 C;  4OX9 E;  4DV3 E;  1RC7 A;  4LF9 E;  2JVA A;  2M4I A;  3RMP A;  1N34 E;  2G7H A;  2L2N A;  2L92 A;  2VE7 C;  2YZT A;  3JTZ A;  3AUZ A;  1STU A;  3K6Q A;  4WYQ B;  5IWA E;  4X65 E;  4DUY E;  4LF4 E;  4Q28 A;  4F9C B;  3T1H E;  4JYA E;  5ADZ A;  4JI0 E;  4X8W A;  5AE2 A;  3VYY A;  4JV5 E;  4KHP E;  4GKJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...