4R03A

Crystal structure of a duf3836 family protein (bdi_3222) from parabacteroides distasonis atcc 8503 at 1.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
109
Chain Sequence
GKDYLYDTKEENGKIISKVVFLQENGLLNKQVRYEFQYNENGKVSEKKAFRWDRTNDEWVPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLNVQNMIIPSTNYEEIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BDI_3222) from Parabacteroides distasonis ATCC 8503 at 1.50 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
total genus 19
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4r03A00
4R8OA 3MSWA 4R03A
chains in the Genus database with same CATH superfamily
4P78A 2GHFA 2EOJA 3BBGA 4GZNC 1EH8A 1YFHA 2EOHA 2YTIA 1XMQE 4DUZE 2MDGA 1X6HA 3THNA 4F2JC 4JI0E 2EMAA 4BHCA 2V83A 2EPOA 1BBGA 1G2DC 1LLMC 1YYKA 1BB8A 1HR0E 3ECRA 5KL4A 1YSAC 4JI2E 3MHSC 4O5GA 3OTOE 5A6BA 4M9VC 4DR6E 3HPZA 4BHBA 4NXME 5LL6R 1I94E 3EQ1A 3HQ1A 4J8ZA 2YTPA 1TF3A 1JK1A 2ZM6E 1DQ3A 4BBYA 2ENHA 2YSPA 2EMXA 2N3HA 4K0KE 3C4TA 3F6GA 1X3CA 5AE3A 4GEQB 4HEIA 3ADGA 2GLIA 1WXRA 4L5NC 4KHPE 1IMUA 3MSWA 1XMOE 2EQ0A 2EL6A 4LF9E 2VQFE 3AUZA 1O0WA 1L4SA 4DV2E 1GZ6A 5IWAE 2UXDE 4HTGA 3J80C 2RS6A 4DR7E 3EPKA 2EMCA 4JI3E 2L92A 4DV3E 5A6AA 4JI6E 1EH7A 1STUA 2EMZA 2VE7C 1T38A 4WPYA 2ELYA 2RTXA 3M99B 5AE1A 2KONA 2EMGA 3VYXA 2YU8A 4RHBB 1A1IA 1P47A 1UBDC 5FLXC 2WBSA 2FTXB 3BF2A 3KZYA 4DV6E 3K6QA 4F9BB 1YUJA 2CSHA 2VF1A 5ADZA 1A1JA 3VHTB 2DMIA 5TSEA 2IHR1 1A1GA 1A1HA 2DIXA 2DMYA 2G7HA 5KL2A 5A6BD 2JVAA 4DR3E 2B3TB 2EPKX 3VK6A 3C4BA 2LJHA 4LTYA 4DR2E 2EMFA 4R2EA 1ZBQA 4BC9A 1YYWA 4R2PA 4JV5E 2EN7A 5A69A 2A25A 1A1KA 2NUGA 2YPNA 2LTSA 3DJWA 4X65E 4DR4E 3LLHA 4Q28A 2VQEE 4R2DA 3UK3C 4O43A 1XNRE 4L8NA 1IBKE 4WYQB 1X47A 2MC5A 4JI7E 4B3ME 2RQLA 3C6MA 3DF6A 3EPJA 2ODRD 3BIDA 2YTQA 4LFCE 3J7Yp 1UN6B 4GKKE 1B69A 2EOMA 2CPNA 2EN1A 3AV0A 2MC6A 4DR5E 4NZVA 1X5WA 5BR8E 4WX9A 4F9CB 1IBLE 2JOBA 3HPSA 1JK2A 1J5EE 2V88A 2YWQA 2E1MA 2EM0A 2L8TA 2BBGA 1PDAA 1FJGE 1UILA 4JI4E 3T1HE 1X48A 1Z1BA 4R2AA 4OOGC 2YTEA 3L00A 2UU9E 1YYOA 1XNQE 2DLQA 4BC7A 1RMDA 4DUYE 2N3GA 2UXBE 2R76A 2LRSA 2EOIA 1SR9A 2PRTA 4DV7E 5IT9C 3KWRA 4JI8E 4O24A 2LT7A 4WSGA 4N4RB 2EPNA 4X62E 1ZR9A 2DB2A 1N34E 5LMNE 4LF5E 4LFAE 2EM4A 2EL4A 4M2ZA 2RS7A 4DKKA 2E5LE 1T4NA 3T1YE 2V85A 2NUEA 3P1XA 4WSPA 4F9AB 2CTDA 4FK5C 2I9IA 5F3WA 2EMIA 2L2MA 4X8WA 2LO3A 2RPCA 1X49A 2L6MA 4BCAA 1G2FC 2EPRA 4TUGA 4M0VA 5A2QC 1DGCA 2EPAA 2UXCE 2YTDA 1YZ9A 4B3SE 3C6KA 1J26A 2EQ3A 1IQSA 1NCSA 3LMLA 1PJTA 2V86A 4LF7E 2EM3A 2EPMX 4RH8A 2EWLA 4NHRA 4X64E 1X6EA 1T4OA 4BS9A 2EOFA 2ELZA 2K4VA 2LV2A 2YTOA 3J81C 2F8BA 1A1LA 2RSIA 1RQ0A 2HGHA 4B3RE 3TQMA 2DRPA 4DV4E 2JWOA 1PJSA 5AC4A 2YTJA 2EMKA 1PKPA 1N32E 2YRMA 2WBUA 4R8OA 4Q35B 4WFTA 5A6JA 3EPLA 2YT4A 1ZAAC 2LE2A 5IXMB 3RMPA 1NEIA 5KL6A 2M1SA 3IWDA 4R2QA 4F54A 2E72A 2EM5A 2M4IA 1YPNA 2YSOA 2EPPA 2B7TA 3ADJA 4LF8E 1N3GA 2EZ6A 4R03A 2L2NA 4LF6E 3F6HA 2YRKA 2JY9A 2V89A 3IWBA 4DV0E 2V87A 4YHHE 2J7JA 4JI1E 1HNXE 2LJUA 4KWYA 2ENCA 3FIGA 2YZTA 2HJJA 4MLQA 4TUIA 2EOEA 4B3TE 2MKNA 2B7VA 2EE8A 4JI5E 2UUAE 2EN3A 4WXCA 2EOYA 1WJPA 1TF6A 1F2IG 3EPHA 2HHHE 2EOZA 1BBOA 2EOOA 2EN8A 2EOSA 2I13A 2EOQA 4IJDA 1IQOA 2GPIA 2ADRA 2FGGA 2B9DA 2EM8A 3J7AG 2RSMA 1MEYC 2EPLX 1WHQA 2HC5A 4ZYDA 2EMYA 4P7DA 2EMBA 1FKAE 1HNWE 1A1FA 4ZYHA 2EP3A 3THOB 2BB8A 4F6NA 4F6MA 5KL5A 2R1FA 1MGTA 1YUIA 4I8OA 3IWCA 2EMHA 2F4VE 2EMWA 5KL7A 2Q8UA 3OMLA 4ZYGA 2EJ4A 2EN6A 2YTNA 1KYQA 4WXDA 2JP9A 1SFEA 2MDRA 4OX9E 4GKJE 1UHZA 4R2CA 5LLQA 2YRHA 4DR1E 1T4LB 2MKDA 2EPZA 2L33A 2LUPB 2JYAA 2EM2A 2YTFA 5AE2A 1KJKA 2WCC3 1X6FA 1ZBTA 1PJQA 2JR1A 3ZOQB 2DGCA 2UUBE 2EN2A 4DV1E 2LCEA 3KZZA 2L3CA 2ODRC 3JU0A 1RC7A 3VYYA 2EORA 2EPCA 4ZYEA 2WZOA 2V8QB 5LMUE 2NA2A 4DMIA 2EM6A 1TN9A 2N8XA 3MHHC 5A6KA 1N33E 2YU5A 1WRJA 4BMJA 4YY3E 4KZSA 1AH5A 2NUFA 3HXLA 4NXNE 3JTZA 2LUQA 1WHNA 2JPAA 2DSYA 2EN4A 5DNYA 2YTGA 1T39A 3ADIA 2EL5A 2M9AA 1QU6A 2LVHA 1GTKA 4MLVA 2LTRA 1EH6A 5IV8B 2KHXA 2EOXA 2EM7A 5T6JA 2EQ1A 2ENAA 2EM9A 2K7IA 5KL3A 4DV5E 1AAYA 4X66E 4M30A 1IBME 4LU9A 2KOUA 2CT1A 2LBSB 5AASA 2M7QA 4LFBE 4O4KA 2NABA 1HNZE 2H36X 3JAMC 4IS1C 4LF4E 4AQYE 1QNTA 5CFFE 2FV4B 1EKZA 5AC5A 2JXPA 3BGHA 2UUCE 2L2KB 2EMLA 1DI2A 2L3JA 1GQEA 2EPXA 3H09A 2VRDA 1N36E 2EPUA 4R2SA 1ZU1A 3ADLA 3HTXA 2DLKA 2D9HA 3QG5C 4X9JA 2WBTA 2LMZA 4R2RA 2JOXA 4JYAE
chains in the Genus database with same CATH topology
1UHZA 4P78A 4DR1E 1T4LB 2NUGA 2LTSA 3J81C 2F8BA 3DJWA 1RQ0A 4X65E 3LLHA 4DR4E 4Q28A 2VQEE 4B3RE 2L33A 1XNRE 1XMQE 4L8NA 4DV4E 2JWOA 4DUZE 2LUPB 1IBKE 5AE2A 4WYQB 4JI0E 1ZBTA 1PKPA 1X47A 2JR1A 3ZOQB 2V83A 1N32E 2UUBE 2MC5A 4JI7E 4R8OA 4B3ME 3DF6A 4WFTA 2YT4A 4DV1E 2ODRD 2LE2A 1YYKA 2L3CA 3RMPA 4LFCE 3J7Yp 1HR0E 2EZ6A 2M1SA 2ODRC 4GKKE 3JU0A 3IWDA 1RC7A 3VYYA 4F54A 2CPNA 3AV0A 2MC6A 4JI2E 4DR5E 2M4IA 1IBLE 2WZOA 5BR8E 4F9CB 2B7TA 2V8QB 3ADJA 5LMUE 2JOBA 3HPSA 3OTOE 2NA2A 4DMIA 4DR6E 3HPZA 4LF8E 1J5EE 2V88A 5LL6R 2E1MA 2L8TA 4R03A 1I94E 4NXME 3HQ1A 1FJGE 1UILA 4J8ZA 2L2NA 1N33E 4JI4E 4LF6E 3F6HA 3T1HE 1X48A 4BMJA 4YY3E 2JY9A 2V89A 3IWBA 4KZSA 4OOGC 1DQ3A 3HXLA 2ZM6E 4DV0E 2V87A 4YHHE 4NXNE 3JTZA 4BBYA 2UU9E 1YYOA 1XNQE 2LUQA 1WHNA 4JI1E 1HNXE 2DSYA 2N3HA 4K0KE 3C4TA 3F6GA 4BC7A 5DNYA 3FIGA 3ADIA 2YZTA 4KHPE 4DUYE 4TUIA 2N3GA 5AE3A 4B3TE 1QU6A 4GEQB 2UXBE 2LRSA 3ADGA 1SR9A 2B7VA 2LTRA 4L5NC 2KHXA 3MSWA 1WXRA 4DV7E 5IT9C 1XMOE 5T6JA 2UUAE 4JI5E 4LF9E 3KWRA 3AUZA 1O0WA 2VQFE 4JI8E 4DV5E 4DV2E 1GZ6A 5IWAE 2UXDE 4X62E 4X66E 2DB2A 3J80C 2RS6A 4DR7E 1N34E 4M30A 2HHHE 1IBME 4LU9A 5LMNE 2KOUA 4LF5E 4JI3E 4LFAE 2L92A 4DV3E 4JI6E 4M2ZA 2LBSB 2RS7A 1STUA 2VE7C 4DKKA 2M7QA 5AASA 2E5LE 1T4NA 2FGGA 2RTXA 4WPYA 3T1YE 4LFBE 2V85A 1HNZE 2B9DA 3P1XA 2NUEA 3J7AG 2RSMA 4WSPA 2H36X 4F9AB 3JAMC 5AE1A 4AQYE 4LF4E 1WHQA 2KONA 5CFFE 5F3WA 3VYXA 2FV4B 1EKZA 4P7DA 2L2MA 1FKAE 1HNWE 5FLXC 4X8WA 2UUCE 2FTXB 2L2KB 1X49A 2L6MA 1DI2A 4BCAA 4TUGA 4DV6E 3K6QA 4F9BB 4M0VA 5A2QC 2VF1A 2L3JA 2UXCE 5ADZA 1YZ9A 4B3SE 1J26A 1GQEA 2IHR1 4I8OA 3IWCA 2DIXA 2DMYA 2G7HA 3H09A 4DR3E 2JVAA 2F4VE 3LMLA 1N36E 2V86A 4LF7E 3ADLA 3OMLA 2NUFA 2B3TB 2EWLA 3VK6A 4DR2E 3C4BA 2LJHA 4LTYA 1ZBQA 3HTXA 4X64E 4BC9A 1YYWA 4JV5E 2MDRA 2LMZA 4OX9E 1T4OA 4BS9A 4GKJE 4JYAE 2JOXA 2K4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8O A;  3MSW A;  4R03 A; 
#chains in the Genus database with same CATH topology
 4P78 A;  2GHF A;  2EOJ A;  3BBG A;  4GZN C;  1EH8 A;  1YFH A;  2EOH A;  2YTI A;  1XMQ E;  4DUZ E;  2MDG A;  1X6H A;  3THN A;  4F2J C;  4JI0 E;  2EMA A;  4BHC A;  2V83 A;  2EPO A;  1BBG A;  1G2D C;  1LLM C;  1YYK A;  1BB8 A;  1HR0 E;  3ECR A;  5KL4 A;  1YSA C;  4JI2 E;  3MHS C;  4O5G A;  3OTO E;  5A6B A;  4M9V C;  4DR6 E;  3HPZ A;  4BHB A;  4NXM E;  5LL6 R;  1I94 E;  3EQ1 A;  3HQ1 A;  4J8Z A;  2YTP A;  1TF3 A;  1JK1 A;  2ZM6 E;  1DQ3 A;  4BBY A;  2ENH A;  2YSP A;  2EMX A;  2N3H A;  4K0K E;  3C4T A;  3F6G A;  1X3C A;  5AE3 A;  4GEQ B;  4HEI A;  3ADG A;  2GLI A;  1WXR A;  4L5N C;  4KHP E;  1IMU A;  3MSW A;  1XMO E;  2EQ0 A;  2EL6 A;  4LF9 E;  2VQF E;  3AUZ A;  1O0W A;  1L4S A;  4DV2 E;  1GZ6 A;  5IWA E;  2UXD E;  4HTG A;  3J80 C;  2RS6 A;  4DR7 E;  3EPK A;  2EMC A;  4JI3 E;  2L92 A;  4DV3 E;  5A6A A;  4JI6 E;  1EH7 A;  1STU A;  2EMZ A;  2VE7 C;  1T38 A;  4WPY A;  2ELY A;  2RTX A;  3M99 B;  5AE1 A;  2KON A;  2EMG A;  3VYX A;  2YU8 A;  4RHB B;  1A1I A;  1P47 A;  1UBD C;  5FLX C;  2WBS A;  2FTX B;  3BF2 A;  3KZY A;  4DV6 E;  3K6Q A;  4F9B B;  1YUJ A;  2CSH A;  2VF1 A;  5ADZ A;  1A1J A;  3VHT B;  2DMI A;  5TSE A;  2IHR 1;  1A1G A;  1A1H A;  2DIX A;  2DMY A;  2G7H A;  5KL2 A;  5A6B D;  2JVA A;  4DR3 E;  2B3T B;  2EPK X;  3VK6 A;  3C4B A;  2LJH A;  4LTY A;  4DR2 E;  2EMF A;  4R2E A;  1ZBQ A;  4BC9 A;  1YYW A;  4R2P A;  4JV5 E;  2EN7 A;  5A69 A;  2A25 A;  1A1K A;  2NUG A;  2YPN A;  2LTS A;  3DJW A;  4X65 E;  4DR4 E;  3LLH A;  4Q28 A;  2VQE E;  4R2D A;  3UK3 C;  4O43 A;  1XNR E;  4L8N A;  1IBK E;  4WYQ B;  1X47 A;  2MC5 A;  4JI7 E;  4B3M E;  2RQL A;  3C6M A;  3DF6 A;  3EPJ A;  2ODR D;  3BID A;  2YTQ A;  4LFC E;  3J7Y p;  1UN6 B;  4GKK E;  1B69 A;  2EOM A;  2CPN A;  2EN1 A;  3AV0 A;  2MC6 A;  4DR5 E;  4NZV A;  1X5W A;  5BR8 E;  4WX9 A;  4F9C B;  1IBL E;  2JOB A;  3HPS A;  1JK2 A;  1J5E E;  2V88 A;  2YWQ A;  2E1M A;  2EM0 A;  2L8T A;  2BBG A;  1PDA A;  1FJG E;  1UIL A;  4JI4 E;  3T1H E;  1X48 A;  1Z1B A;  4R2A A;  4OOG C;  2YTE A;  3L00 A;  2UU9 E;  1YYO A;  1XNQ E;  2DLQ A;  4BC7 A;  1RMD A;  4DUY E;  2N3G A;  2UXB E;  2R76 A;  2LRS A;  2EOI A;  1SR9 A;  2PRT A;  4DV7 E;  5IT9 C;  3KWR A;  4JI8 E;  4O24 A;  2LT7 A;  4WSG A;  4N4R B;  2EPN A;  4X62 E;  1ZR9 A;  2DB2 A;  1N34 E;  5LMN E;  4LF5 E;  4LFA E;  2EM4 A;  2EL4 A;  4M2Z A;  2RS7 A;  4DKK A;  2E5L E;  1T4N A;  3T1Y E;  2V85 A;  2NUE A;  3P1X A;  4WSP A;  4F9A B;  2CTD A;  4FK5 C;  2I9I A;  5F3W A;  2EMI A;  2L2M A;  4X8W A;  2LO3 A;  2RPC A;  1X49 A;  2L6M A;  4BCA A;  1G2F C;  2EPR A;  4TUG A;  4M0V A;  5A2Q C;  1DGC A;  2EPA A;  2UXC E;  2YTD A;  1YZ9 A;  4B3S E;  3C6K A;  1J26 A;  2EQ3 A;  1IQS A;  1NCS A;  3LML A;  1PJT A;  2V86 A;  4LF7 E;  2EM3 A;  2EPM X;  4RH8 A;  2EWL A;  4NHR A;  4X64 E;  1X6E A;  1T4O A;  4BS9 A;  2EOF A;  2ELZ A;  2K4V A;  2LV2 A;  2YTO A;  3J81 C;  2F8B A;  1A1L A;  2RSI A;  1RQ0 A;  2HGH A;  4B3R E;  3TQM A;  2DRP A;  4DV4 E;  2JWO A;  1PJS A;  5AC4 A;  2YTJ A;  2EMK A;  1PKP A;  1N32 E;  2YRM A;  2WBU A;  4R8O A;  4Q35 B;  4WFT A;  5A6J A;  3EPL A;  2YT4 A;  1ZAA C;  2LE2 A;  5IXM B;  3RMP A;  1NEI A;  5KL6 A;  2M1S A;  3IWD A;  4R2Q A;  4F54 A;  2E72 A;  2EM5 A;  2M4I A;  1YPN A;  2YSO A;  2EPP A;  2B7T A;  3ADJ A;  4LF8 E;  1N3G A;  2EZ6 A;  4R03 A;  2L2N A;  4LF6 E;  3F6H A;  2YRK A;  2JY9 A;  2V89 A;  3IWB A;  4DV0 E;  2V87 A;  4YHH E;  2J7J A;  4JI1 E;  1HNX E;  2LJU A;  4KWY A;  2ENC A;  3FIG A;  2YZT A;  2HJJ A;  4MLQ A;  4TUI A;  2EOE A;  4B3T E;  2MKN A;  2B7V A;  2EE8 A;  4JI5 E;  2UUA E;  2EN3 A;  4WXC A;  2EOY A;  1WJP A;  1TF6 A;  1F2I G;  3EPH A;  2HHH E;  2EOZ A;  1BBO A;  2EOO A;  2EN8 A;  2EOS A;  2I13 A;  2EOQ A;  4IJD A;  1IQO A;  2GPI A;  2ADR A;  2FGG A;  2B9D A;  2EM8 A;  3J7A G;  2RSM A;  1MEY C;  2EPL X;  1WHQ A;  2HC5 A;  4ZYD A;  2EMY A;  4P7D A;  2EMB A;  1FKA E;  1HNW E;  1A1F A;  4ZYH A;  2EP3 A;  3THO B;  2BB8 A;  4F6N A;  4F6M A;  5KL5 A;  2R1F A;  1MGT A;  1YUI A;  4I8O A;  3IWC A;  2EMH A;  2F4V E;  2EMW A;  5KL7 A;  2Q8U A;  3OML A;  4ZYG A;  2EJ4 A;  2EN6 A;  2YTN A;  1KYQ A;  4WXD A;  2JP9 A;  1SFE A;  2MDR A;  4OX9 E;  4GKJ E;  1UHZ A;  4R2C A;  5LLQ A;  2YRH A;  4DR1 E;  1T4L B;  2MKD A;  2EPZ A;  2L33 A;  2LUP B;  2JYA A;  2EM2 A;  2YTF A;  5AE2 A;  1KJK A;  2WCC 3;  1X6F A;  1ZBT A;  1PJQ A;  2JR1 A;  3ZOQ B;  2DGC A;  2UUB E;  2EN2 A;  4DV1 E;  2LCE A;  3KZZ A;  2L3C A;  2ODR C;  3JU0 A;  1RC7 A;  3VYY A;  2EOR A;  2EPC A;  4ZYE A;  2WZO A;  2V8Q B;  5LMU E;  2NA2 A;  4DMI A;  2EM6 A;  1TN9 A;  2N8X A;  3MHH C;  5A6K A;  1N33 E;  2YU5 A;  1WRJ A;  4BMJ A;  4YY3 E;  4KZS A;  1AH5 A;  2NUF A;  3HXL A;  4NXN E;  3JTZ A;  2LUQ A;  1WHN A;  2JPA A;  2DSY A;  2EN4 A;  5DNY A;  2YTG A;  1T39 A;  3ADI A;  2EL5 A;  2M9A A;  1QU6 A;  2LVH A;  1GTK A;  4MLV A;  2LTR A;  1EH6 A;  5IV8 B;  2KHX A;  2EOX A;  2EM7 A;  5T6J A;  2EQ1 A;  2ENA A;  2EM9 A;  2K7I A;  5KL3 A;  4DV5 E;  1AAY A;  4X66 E;  4M30 A;  1IBM E;  4LU9 A;  2KOU A;  2CT1 A;  2LBS B;  5AAS A;  2M7Q A;  4LFB E;  4O4K A;  2NAB A;  1HNZ E;  2H36 X;  3JAM C;  4IS1 C;  4LF4 E;  4AQY E;  1QNT A;  5CFF E;  2FV4 B;  1EKZ A;  5AC5 A;  2JXP A;  3BGH A;  2UUC E;  2L2K B;  2EML A;  1DI2 A;  2L3J A;  1GQE A;  2EPX A;  3H09 A;  2VRD A;  1N36 E;  2EPU A;  4R2S A;  1ZU1 A;  3ADL A;  3HTX A;  2DLK A;  2D9H A;  3QG5 C;  4X9J A;  2WBT A;  2LMZ A;  4R2R A;  2JOX A;  4JYA E; 
#chains in the Genus database with same CATH homology
 1UHZ A;  4P78 A;  4DR1 E;  1T4L B;  2NUG A;  2LTS A;  3J81 C;  2F8B A;  3DJW A;  1RQ0 A;  4X65 E;  3LLH A;  4DR4 E;  4Q28 A;  2VQE E;  4B3R E;  2L33 A;  1XNR E;  1XMQ E;  4L8N A;  4DV4 E;  2JWO A;  4DUZ E;  2LUP B;  1IBK E;  5AE2 A;  4WYQ B;  4JI0 E;  1ZBT A;  1PKP A;  1X47 A;  2JR1 A;  3ZOQ B;  2V83 A;  1N32 E;  2UUB E;  2MC5 A;  4JI7 E;  4R8O A;  4B3M E;  3DF6 A;  4WFT A;  2YT4 A;  4DV1 E;  2ODR D;  2LE2 A;  1YYK A;  2L3C A;  3RMP A;  4LFC E;  3J7Y p;  1HR0 E;  2EZ6 A;  2M1S A;  2ODR C;  4GKK E;  3JU0 A;  3IWD A;  1RC7 A;  3VYY A;  4F54 A;  2CPN A;  3AV0 A;  2MC6 A;  4JI2 E;  4DR5 E;  2M4I A;  1IBL E;  2WZO A;  5BR8 E;  4F9C B;  2B7T A;  2V8Q B;  3ADJ A;  5LMU E;  2JOB A;  3HPS A;  3OTO E;  2NA2 A;  4DMI A;  4DR6 E;  3HPZ A;  4LF8 E;  1J5E E;  2V88 A;  5LL6 R;  2E1M A;  2L8T A;  4R03 A;  1I94 E;  4NXM E;  3HQ1 A;  1FJG E;  1UIL A;  4J8Z A;  2L2N A;  1N33 E;  4JI4 E;  4LF6 E;  3F6H A;  3T1H E;  1X48 A;  4BMJ A;  4YY3 E;  2JY9 A;  2V89 A;  3IWB A;  4KZS A;  4OOG C;  1DQ3 A;  3HXL A;  2ZM6 E;  4DV0 E;  2V87 A;  4YHH E;  4NXN E;  3JTZ A;  4BBY A;  2UU9 E;  1YYO A;  1XNQ E;  2LUQ A;  1WHN A;  4JI1 E;  1HNX E;  2DSY A;  2N3H A;  4K0K E;  3C4T A;  3F6G A;  4BC7 A;  5DNY A;  3FIG A;  3ADI A;  2YZT A;  4KHP E;  4DUY E;  4TUI A;  2N3G A;  5AE3 A;  4B3T E;  1QU6 A;  4GEQ B;  2UXB E;  2LRS A;  3ADG A;  1SR9 A;  2B7V A;  2LTR A;  4L5N C;  2KHX A;  3MSW A;  1WXR A;  4DV7 E;  5IT9 C;  1XMO E;  5T6J A;  2UUA E;  4JI5 E;  4LF9 E;  3KWR A;  3AUZ A;  1O0W A;  2VQF E;  4JI8 E;  4DV5 E;  4DV2 E;  1GZ6 A;  5IWA E;  2UXD E;  4X62 E;  4X66 E;  2DB2 A;  3J80 C;  2RS6 A;  4DR7 E;  1N34 E;  4M30 A;  2HHH E;  1IBM E;  4LU9 A;  5LMN E;  2KOU A;  4LF5 E;  4JI3 E;  4LFA E;  2L92 A;  4DV3 E;  4JI6 E;  4M2Z A;  2LBS B;  2RS7 A;  1STU A;  2VE7 C;  4DKK A;  2M7Q A;  5AAS A;  2E5L E;  1T4N A;  2FGG A;  2RTX A;  4WPY A;  3T1Y E;  4LFB E;  2V85 A;  1HNZ E;  2B9D A;  3P1X A;  2NUE A;  3J7A G;  2RSM A;  4WSP A;  2H36 X;  4F9A B;  3JAM C;  5AE1 A;  4AQY E;  4LF4 E;  1WHQ A;  2KON A;  5CFF E;  5F3W A;  3VYX A;  2FV4 B;  1EKZ A;  4P7D A;  2L2M A;  1FKA E;  1HNW E;  5FLX C;  4X8W A;  2UUC E;  2FTX B;  2L2K B;  1X49 A;  2L6M A;  1DI2 A;  4BCA A;  4TUG A;  4DV6 E;  3K6Q A;  4F9B B;  4M0V A;  5A2Q C;  2VF1 A;  2L3J A;  2UXC E;  5ADZ A;  1YZ9 A;  4B3S E;  1J26 A;  1GQE A;  2IHR 1;  4I8O A;  3IWC A;  2DIX A;  2DMY A;  2G7H A;  3H09 A;  4DR3 E;  2JVA A;  2F4V E;  3LML A;  1N36 E;  2V86 A;  4LF7 E;  3ADL A;  3OML A;  2NUF A;  2B3T B;  2EWL A;  3VK6 A;  4DR2 E;  3C4B A;  2LJH A;  4LTY A;  1ZBQ A;  3HTX A;  4X64 E;  4BC9 A;  1YYW A;  4JV5 E;  2MDR A;  2LMZ A;  4OX9 E;  1T4O A;  4BS9 A;  4GKJ E;  4JYA E;  2JOX A;  2K4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...