4R03A

Crystal structure of a duf3836 family protein (bdi_3222) from parabacteroides distasonis atcc 8503 at 1.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
109
structure length
109
Chain Sequence
GKDYLYDTKEENGKIISKVVFLQENGLLNKQVRYEFQYNENGKVSEKKAFRWDRTNDEWVPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLNVQNMIIPSTNYEEIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BDI_3222) from Parabacteroides distasonis ATCC 8503 at 1.50 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 19
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4r03A00
4R03A 3MSWA 4R8OA
chains in the Genus database with same CATH superfamily
2N8XA 5LLQA 1XMQE 2EM2A 2WBUA 2DIXA 2Q8UA 2YTIA 4F9BB 3EPHA 2EM8A 5KL6A 2EJ4A 4TUIA 2EOSA 5DNYA 2WCC3 2BB8A 2EPLX 2EOEA 4NXNE 2NUGA 3L00A 3BF2A 1HNXE 4BBYA 2L2KB 2MC6A 2YRKA 1ZR9A 4P7DA 4F6MA 4Q28A 3C4TA 5KL2A 5LMNE 3MHHC 5A6JA 2EN6A 2BBGA 2H36X 3IWDA 4R2AA 2NUFA 4I8OA 1X6FA 4R2DA 1F2IG 5A2QC 4F54A 2EPAA 2EZ6A 1X5WA 1YFHA 3EPLA 1JK1A 2EMGA 3QG5C 4DR1E 4X65E 2VE7C 2LTRA 5LL6R 1J5EE 4LF4E 3THOB 4MLQA 4ZYEA 2F8BA 2EOMA 5KL7A 2JOBA 1XNQE 1A1JA 1YUJA 1EKZA 2L92A 2V87A 1YSAC 4LFBE 2L3CA 5T6JA 4NHRA 4R2SA 4DR7E 4F6NA 1IBME 1TF3A 2UUBE 3ADJA 1BBOA 2LUQA 3MSWA 1PKPA 5AE2A 1GQEA 1DI2A 2JY9A 2JYAA 1IQOA 1DGCA 2EOZA 4B3RE 2EOOA 2I13A 2V89A 4JI3E 2ENAA 4JV5E 1EH8A 3J81C 1L4SA 4JI2E 2KONA 4HTGA 4L8NA 3K6QA 2LO3A 4DR4E 2EM5A 3F6GA 4OOGC 1DQ3A 4DR6E 5AC5A 5AE1A 4R2CA 4DUYE 2EQ3A 3JAMC 2EN2A 2UUCE 2EMIA 2ELZA 2JR1A 4GKKE 1RMDA 2LMZA 3DJWA 2E1MA 4LF7E 4GZNC 2UXBE 2M4IA 1ZAAC 3KZYA 4NXME 3JTZA 2YTNA 4O4KA 1IQSA 2L6MA 4DUZE 1HNWE 1AAYA 1YYWA 2HJJA 2LVHA 2EMXA 4DV1E 1G2DC 1T4NA 2VRDA 1PDAA 3T1YE 2DLQA 2MDGA 1BBGA 2EMBA 2UUAE 2CSHA 2YRMA 3J7AG 1YYKA 2DMYA 4ZYHA 1WXRA 1T4OA 5FLXC 1YPNA 2EPCA 1UN6B 1BB8A 2R1FA 1LLMC 2LV2A 3VK6A 3J80C 1T38A 2CTDA 2GHFA 4JI5E 2UXCE 4M0VA 2ENHA 2HC5A 3BIDA 2KHXA 1YYOA 2EM4A 1KJKA 4B3SE 1YUIA 1IBKE 2B9DA 2YSPA 1ZU1A 4F9AB 2EOYA 2L2MA 4X9JA 3VYYA 4M30A 5BR8E 1Z1BA 2DGCA 3BBGA 4GKJE 4RH8A 2ODRC 2LJHA 1SR9A 3T1HE 1RQ0A 4DV4E 2ADRA 2EP3A 3IWCA 3HPSA 2EN8A 2YPNA 2EPUA 1N36E 1IMUA 2V83A 2YRHA 2LE2A 1TN9A 2DRPA 4HEIA 4DV2E 1AH5A 4JI0E 2JOXA 2G7HA 3C6KA 1X48A 4JI1E 2CT1A 2WZOA 5IWAE 3EQ1A 2B3TB 2EMYA 2L8TA 3ADIA 2EMFA 1ZBTA 1T39A 1UILA 1EH6A 4X62E 4LFCE 2EMKA 4BCAA 2EMLA 2M9AA 2EPNA 5A6KA 2FGGA 4KZSA 4AQYE 4YHHE 1HR0E 3M99B 1X49A 2EPKX 3ADLA 5A6BA 2R76A 2L33A 5KL4A 1UHZA 4WSGA 3F6HA 2EOHA 4BC7A 4LFAE 1T4LB 2ODRD 2E5LE 4KWYA 5A6BD 1FJGE 2EPOA 2CPNA 2RSMA 2IHR1 2JWOA 2L2NA 4DV5E 4WXCA 1PJQA 1WHQA 4F9CB 2VQFE 2UU9E 5IV8B 1XNRE 2HHHE 2FV4B 2B7TA 3HQ1A 4F2JC 1STUA 4JI7E 4JI6E 3HXLA 4LTYA 4DMIA 3FIGA 4R8OA 3RMPA 4BHCA 4FK5C 3EPKA 2YU5A 2EN3A 1WHNA 2WBTA 2EMCA 1N3GA 3THNA 2LBSB 2NUEA 4B3TE 2JVAA 2ENCA 4LF8E 2EE8A 4WSPA 1QNTA 4DV0E 2EMWA 4DR3E 4IS1C 2E72A 5IT9C 4R2QA 2B7VA 4LF6E 4WFTA 2YTGA 2N3HA 4P78A 4DV3E 4WX9A 1NCSA 4X66E 1UBDC 1KYQA 2RS7A 3EPJA 1X6HA 2K7IA 4JYAE 1WRJA 2EL5A 4B3ME 2NABA 2EORA 2N3GA 2NA2A 2EM6A 5CFFE 3ZOQB 2EQ1A 1I94E 2HGHA 4IJDA 3C6MA 2RPCA 2YTOA 5F3WA 2ELYA 2MKDA 2EN7A 2DB2A 4BHBA 2MDRA 4LU9A 2EOJA 3KWRA 1RC7A 4LF9E 2RTXA 2EMAA 4K0KE 3TQMA 2D9HA 5KL3A 1X3CA 4R2EA 4M2ZA 3VHTB 2EWLA 1NEIA 4WPYA 2V85A 2WBSA 2VQEE 2UXDE 3IWBA 1P47A 4JI8E 3HTXA 4WYQB 5AC4A 2PRTA 2YWQA 1B69A 5AASA 1N33E 3VYXA 4BS9A 1A1LA 4GEQB 2J7JA 2A25A 2LT7A 2ZM6E 1TF6A 3UK3C 5KL5A 3LMLA 2M1SA 1YZ9A 2EOXA 3OMLA 3LLHA 4TUGA 2YTJA 2V88A 4DR5E 3AV0A 3J7Yp 2EPPA 2LJUA 2L3JA 1MEYC 2JPAA 2RS6A 1X47A 2YTEA 3HPZA 4ZYDA 4NZVA 3ECRA 2FTXB 3KZZA 2V8QB 2EOIA 2EL6A 4KHPE 1GZ6A 2EMHA 2GPIA 2EN4A 4L5NC 2RQLA 3P1XA 2YSOA 2EM0A 2JXPA 1FKAE 2M7QA 1PJTA 3JU0A 2MKNA 1XMOE 3BGHA 2MC5A 4R03A 2LRSA 5A6AA 1N34E 4DR2E 5ADZA 1GTKA 4Q35B 4R2RA 1A1GA 4DV7E 1N32E 4MLVA 3OTOE 2LCEA 2DSYA 1A1HA 1J26A 5A69A 2V86A 2YTFA 1IBLE 1ZBQA 2YT4A 2EM7A 1A1IA 4RHBB 4ZYGA 2EN1A 2YTQA 2LTSA 5LMUE 5IXMB 1A1FA 3C4BA 4O24A 4OX9E 2EM9A 4WXDA 4J8ZA 2YU8A 4O5GA 2EOQA 2VF1A 2JP9A 4M9VC 1MGTA 3DF6A 1HNZE 1O0WA 1SFEA 4YY3E 1QU6A 2EOFA 2GLIA 3ADGA 2YTPA 4DKKA 1WJPA 4DV6E 2EPMX 2EPZA 2LUPB 2EPRA 1EH7A 4LF5E 3H09A 2EQ0A 4X8WA 2KOUA 1PJSA 4BC9A 3AUZA 2EPXA 5TSEA 1A1KA 4X64E 3MHSC 4JI4E 4BMJA 2YZTA 2EMZA 2DMIA 1JK2A 2EL4A 2YTDA 2K4VA 4O43A 2F4VE 1X6EA 2DLKA 2RSIA 4R2PA 2I9IA 4N4RB 1G2FC 2EM3A 5AE3A
chains in the Genus database with same CATH topology
3OMLA 2LMZA 3LLHA 3DJWA 4TUGA 2RSMA 2E1MA 2V88A 4DR5E 2IHR1 2JWOA 2L2NA 3AV0A 4DV5E 3J7Yp 1XMQE 4LF7E 1WHQA 2UXBE 2L3JA 2M4IA 2DIXA 4F9CB 4F9BB 2VQFE 4NXME 2UU9E 1XNRE 2RS6A 1X47A 2FV4B 2HHHE 2B7TA 3HPZA 3JTZA 4TUIA 3HQ1A 2L6MA 4DUZE 1HNWE 5DNYA 1STUA 2FTXB 1YYWA 2V8QB 4JI7E 4KHPE 1GZ6A 4JI6E 4NXNE 3HXLA 4DV1E 2NUGA 4LTYA 1HNXE 4DMIA 4L5NC 4BBYA 3FIGA 3P1XA 2L2KB 2MC6A 1T4NA 4R8OA 3RMPA 4P7DA 3T1YE 4Q28A 3C4TA 1WHNA 5LMNE 2UUAE 3J7AG 1FKAE 2LBSB 2NUEA 2H36X 2M7QA 3IWDA 1YYKA 4B3TE 3JU0A 2DMYA 1WXRA 1T4OA 2JVAA 5FLXC 1XMOE 4LF8E 4WSPA 2MC5A 4DV0E 4R03A 2NUFA 2LRSA 4I8OA 1N34E 4DR2E 4DR3E 5IT9C 3VK6A 5ADZA 3J80C 4DV7E 4JI5E 1N32E 2UXCE 4M0VA 2B7VA 5A2QC 4F54A 4LF6E 3OTOE 4WFTA 2EZ6A 2KHXA 2N3HA 2DSYA 1YYOA 4P78A 1J26A 4DV3E 4B3SE 1IBKE 2B9DA 4X66E 4F9AB 4DR1E 2L2MA 2V86A 2VE7C 2LTRA 2RS7A 4M30A 5LL6R 5BR8E 4X65E 3VYYA 1J5EE 1IBLE 4LF4E 4GKJE 1ZBQA 2YT4A 4JYAE 2ODRC 2F8BA 4B3ME 2LJHA 1SR9A 3T1HE 2JOBA 2LTSA 2N3GA 1RQ0A 2NA2A 5LMUE 1XNQE 5CFFE 3C4BA 3ZOQB 4DV4E 1N36E 3IWCA 3HPSA 1I94E 4OX9E 2V83A 5F3WA 1EKZA 2L92A 2LE2A 4J8ZA 2V87A 2DB2A 4LFBE 2L3CA 5T6JA 4DR7E 2VF1A 1IBME 2UUBE 3ADJA 2MDRA 4DV2E 4JI0E 3DF6A 4LU9A 2LUQA 3MSWA 1HNZE 1O0WA 2JOXA 4YY3E 2G7HA 1PKPA 1QU6A 1X48A 1GQEA 5AE2A 4JI1E 1DI2A 2JY9A 2WZOA 3KWRA 5IWAE 1RC7A 2B3TB 3ADGA 4LF9E 2RTXA 4DKKA 4B3RE 2V89A 4DV6E 4K0KE 4JI3E 2L8TA 3ADIA 1ZBTA 4JV5E 1UILA 4X62E 2LUPB 4LFCE 4BCAA 3J81C 4LF5E 3H09A 4JI2E 4M2ZA 2EWLA 4X8WA 2KONA 2KOUA 2FGGA 4L8NA 4BC9A 3AUZA 4KZSA 4AQYE 4YHHE 4WPYA 1HR0E 2V85A 3K6QA 1X49A 2VQEE 3ADLA 4X64E 2UXDE 2L33A 3IWBA 5AE3A 4DR4E 4JI8E 1UHZA 4JI4E 3HTXA 4WYQB 3F6GA 4BMJA 4OOGC 2YZTA 3F6HA 1DQ3A 4DR6E 5AASA 4BC7A 5AE1A 4DUYE 3JAMC 4LFAE 3VYXA 2K4VA 1N33E 2F4VE 4BS9A 4GEQB 2UUCE 1T4LB 2ZM6E 2ODRD 2JR1A 2E5LE 4GKKE 1FJGE 3LMLA 2M1SA 1YZ9A 2CPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R03 A;  3MSW A;  4R8O A; 
#chains in the Genus database with same CATH topology
 2N8X A;  5LLQ A;  1XMQ E;  2EM2 A;  2WBU A;  2DIX A;  2Q8U A;  2YTI A;  4F9B B;  3EPH A;  2EM8 A;  5KL6 A;  2EJ4 A;  4TUI A;  2EOS A;  5DNY A;  2WCC 3;  2BB8 A;  2EPL X;  2EOE A;  4NXN E;  2NUG A;  3L00 A;  3BF2 A;  1HNX E;  4BBY A;  2L2K B;  2MC6 A;  2YRK A;  1ZR9 A;  4P7D A;  4F6M A;  4Q28 A;  3C4T A;  5KL2 A;  5LMN E;  3MHH C;  5A6J A;  2EN6 A;  2BBG A;  2H36 X;  3IWD A;  4R2A A;  2NUF A;  4I8O A;  1X6F A;  4R2D A;  1F2I G;  5A2Q C;  4F54 A;  2EPA A;  2EZ6 A;  1X5W A;  1YFH A;  3EPL A;  1JK1 A;  2EMG A;  3QG5 C;  4DR1 E;  4X65 E;  2VE7 C;  2LTR A;  5LL6 R;  1J5E E;  4LF4 E;  3THO B;  4MLQ A;  4ZYE A;  2F8B A;  2EOM A;  5KL7 A;  2JOB A;  1XNQ E;  1A1J A;  1YUJ A;  1EKZ A;  2L92 A;  2V87 A;  1YSA C;  4LFB E;  2L3C A;  5T6J A;  4NHR A;  4R2S A;  4DR7 E;  4F6N A;  1IBM E;  1TF3 A;  2UUB E;  3ADJ A;  1BBO A;  2LUQ A;  3MSW A;  1PKP A;  5AE2 A;  1GQE A;  1DI2 A;  2JY9 A;  2JYA A;  1IQO A;  1DGC A;  2EOZ A;  4B3R E;  2EOO A;  2I13 A;  2V89 A;  4JI3 E;  2ENA A;  4JV5 E;  1EH8 A;  3J81 C;  1L4S A;  4JI2 E;  2KON A;  4HTG A;  4L8N A;  3K6Q A;  2LO3 A;  4DR4 E;  2EM5 A;  3F6G A;  4OOG C;  1DQ3 A;  4DR6 E;  5AC5 A;  5AE1 A;  4R2C A;  4DUY E;  2EQ3 A;  3JAM C;  2EN2 A;  2UUC E;  2EMI A;  2ELZ A;  2JR1 A;  4GKK E;  1RMD A;  2LMZ A;  3DJW A;  2E1M A;  4LF7 E;  4GZN C;  2UXB E;  2M4I A;  1ZAA C;  3KZY A;  4NXM E;  3JTZ A;  2YTN A;  4O4K A;  1IQS A;  2L6M A;  4DUZ E;  1HNW E;  1AAY A;  1YYW A;  2HJJ A;  2LVH A;  2EMX A;  4DV1 E;  1G2D C;  1T4N A;  2VRD A;  1PDA A;  3T1Y E;  2DLQ A;  2MDG A;  1BBG A;  2EMB A;  2UUA E;  2CSH A;  2YRM A;  3J7A G;  1YYK A;  2DMY A;  4ZYH A;  1WXR A;  1T4O A;  5FLX C;  1YPN A;  2EPC A;  1UN6 B;  1BB8 A;  2R1F A;  1LLM C;  2LV2 A;  3VK6 A;  3J80 C;  1T38 A;  2CTD A;  2GHF A;  4JI5 E;  2UXC E;  4M0V A;  2ENH A;  2HC5 A;  3BID A;  2KHX A;  1YYO A;  2EM4 A;  1KJK A;  4B3S E;  1YUI A;  1IBK E;  2B9D A;  2YSP A;  1ZU1 A;  4F9A B;  2EOY A;  2L2M A;  4X9J A;  3VYY A;  4M30 A;  5BR8 E;  1Z1B A;  2DGC A;  3BBG A;  4GKJ E;  4RH8 A;  2ODR C;  2LJH A;  1SR9 A;  3T1H E;  1RQ0 A;  4DV4 E;  2ADR A;  2EP3 A;  3IWC A;  3HPS A;  2EN8 A;  2YPN A;  2EPU A;  1N36 E;  1IMU A;  2V83 A;  2YRH A;  2LE2 A;  1TN9 A;  2DRP A;  4HEI A;  4DV2 E;  1AH5 A;  4JI0 E;  2JOX A;  2G7H A;  3C6K A;  1X48 A;  4JI1 E;  2CT1 A;  2WZO A;  5IWA E;  3EQ1 A;  2B3T B;  2EMY A;  2L8T A;  3ADI A;  2EMF A;  1ZBT A;  1T39 A;  1UIL A;  1EH6 A;  4X62 E;  4LFC E;  2EMK A;  4BCA A;  2EML A;  2M9A A;  2EPN A;  5A6K A;  2FGG A;  4KZS A;  4AQY E;  4YHH E;  1HR0 E;  3M99 B;  1X49 A;  2EPK X;  3ADL A;  5A6B A;  2R76 A;  2L33 A;  5KL4 A;  1UHZ A;  4WSG A;  3F6H A;  2EOH A;  4BC7 A;  4LFA E;  1T4L B;  2ODR D;  2E5L E;  4KWY A;  5A6B D;  1FJG E;  2EPO A;  2CPN A;  2RSM A;  2IHR 1;  2JWO A;  2L2N A;  4DV5 E;  4WXC A;  1PJQ A;  1WHQ A;  4F9C B;  2VQF E;  2UU9 E;  5IV8 B;  1XNR E;  2HHH E;  2FV4 B;  2B7T A;  3HQ1 A;  4F2J C;  1STU A;  4JI7 E;  4JI6 E;  3HXL A;  4LTY A;  4DMI A;  3FIG A;  4R8O A;  3RMP A;  4BHC A;  4FK5 C;  3EPK A;  2YU5 A;  2EN3 A;  1WHN A;  2WBT A;  2EMC A;  1N3G A;  3THN A;  2LBS B;  2NUE A;  4B3T E;  2JVA A;  2ENC A;  4LF8 E;  2EE8 A;  4WSP A;  1QNT A;  4DV0 E;  2EMW A;  4DR3 E;  4IS1 C;  2E72 A;  5IT9 C;  4R2Q A;  2B7V A;  4LF6 E;  4WFT A;  2YTG A;  2N3H A;  4P78 A;  4DV3 E;  4WX9 A;  1NCS A;  4X66 E;  1UBD C;  1KYQ A;  2RS7 A;  3EPJ A;  1X6H A;  2K7I A;  4JYA E;  1WRJ A;  2EL5 A;  4B3M E;  2NAB A;  2EOR A;  2N3G A;  2NA2 A;  2EM6 A;  5CFF E;  3ZOQ B;  2EQ1 A;  1I94 E;  2HGH A;  4IJD A;  3C6M A;  2RPC A;  2YTO A;  5F3W A;  2ELY A;  2MKD A;  2EN7 A;  2DB2 A;  4BHB A;  2MDR A;  4LU9 A;  2EOJ A;  3KWR A;  1RC7 A;  4LF9 E;  2RTX A;  2EMA A;  4K0K E;  3TQM A;  2D9H A;  5KL3 A;  1X3C A;  4R2E A;  4M2Z A;  3VHT B;  2EWL A;  1NEI A;  4WPY A;  2V85 A;  2WBS A;  2VQE E;  2UXD E;  3IWB A;  1P47 A;  4JI8 E;  3HTX A;  4WYQ B;  5AC4 A;  2PRT A;  2YWQ A;  1B69 A;  5AAS A;  1N33 E;  3VYX A;  4BS9 A;  1A1L A;  4GEQ B;  2J7J A;  2A25 A;  2LT7 A;  2ZM6 E;  1TF6 A;  3UK3 C;  5KL5 A;  3LML A;  2M1S A;  1YZ9 A;  2EOX A;  3OML A;  3LLH A;  4TUG A;  2YTJ A;  2V88 A;  4DR5 E;  3AV0 A;  3J7Y p;  2EPP A;  2LJU A;  2L3J A;  1MEY C;  2JPA A;  2RS6 A;  1X47 A;  2YTE A;  3HPZ A;  4ZYD A;  4NZV A;  3ECR A;  2FTX B;  3KZZ A;  2V8Q B;  2EOI A;  2EL6 A;  4KHP E;  1GZ6 A;  2EMH A;  2GPI A;  2EN4 A;  4L5N C;  2RQL A;  3P1X A;  2YSO A;  2EM0 A;  2JXP A;  1FKA E;  2M7Q A;  1PJT A;  3JU0 A;  2MKN A;  1XMO E;  3BGH A;  2MC5 A;  4R03 A;  2LRS A;  5A6A A;  1N34 E;  4DR2 E;  5ADZ A;  1GTK A;  4Q35 B;  4R2R A;  1A1G A;  4DV7 E;  1N32 E;  4MLV A;  3OTO E;  2LCE A;  2DSY A;  1A1H A;  1J26 A;  5A69 A;  2V86 A;  2YTF A;  1IBL E;  1ZBQ A;  2YT4 A;  2EM7 A;  1A1I A;  4RHB B;  4ZYG A;  2EN1 A;  2YTQ A;  2LTS A;  5LMU E;  5IXM B;  1A1F A;  3C4B A;  4O24 A;  4OX9 E;  2EM9 A;  4WXD A;  4J8Z A;  2YU8 A;  4O5G A;  2EOQ A;  2VF1 A;  2JP9 A;  4M9V C;  1MGT A;  3DF6 A;  1HNZ E;  1O0W A;  1SFE A;  4YY3 E;  1QU6 A;  2EOF A;  2GLI A;  3ADG A;  2YTP A;  4DKK A;  1WJP A;  4DV6 E;  2EPM X;  2EPZ A;  2LUP B;  2EPR A;  1EH7 A;  4LF5 E;  3H09 A;  2EQ0 A;  4X8W A;  2KOU A;  1PJS A;  4BC9 A;  3AUZ A;  2EPX A;  5TSE A;  1A1K A;  4X64 E;  3MHS C;  4JI4 E;  4BMJ A;  2YZT A;  2EMZ A;  2DMI A;  1JK2 A;  2EL4 A;  2YTD A;  2K4V A;  4O43 A;  2F4V E;  1X6E A;  2DLK A;  2RSI A;  4R2P A;  2I9I A;  4N4R B;  1G2F C;  2EM3 A;  5AE3 A; 
#chains in the Genus database with same CATH homology
 3OML A;  2LMZ A;  3LLH A;  3DJW A;  4TUG A;  2RSM A;  2E1M A;  2V88 A;  4DR5 E;  2IHR 1;  2JWO A;  2L2N A;  3AV0 A;  4DV5 E;  3J7Y p;  1XMQ E;  4LF7 E;  1WHQ A;  2UXB E;  2L3J A;  2M4I A;  2DIX A;  4F9C B;  4F9B B;  2VQF E;  4NXM E;  2UU9 E;  1XNR E;  2RS6 A;  1X47 A;  2FV4 B;  2HHH E;  2B7T A;  3HPZ A;  3JTZ A;  4TUI A;  3HQ1 A;  2L6M A;  4DUZ E;  1HNW E;  5DNY A;  1STU A;  2FTX B;  1YYW A;  2V8Q B;  4JI7 E;  4KHP E;  1GZ6 A;  4JI6 E;  4NXN E;  3HXL A;  4DV1 E;  2NUG A;  4LTY A;  1HNX E;  4DMI A;  4L5N C;  4BBY A;  3FIG A;  3P1X A;  2L2K B;  2MC6 A;  1T4N A;  4R8O A;  3RMP A;  4P7D A;  3T1Y E;  4Q28 A;  3C4T A;  1WHN A;  5LMN E;  2UUA E;  3J7A G;  1FKA E;  2LBS B;  2NUE A;  2H36 X;  2M7Q A;  3IWD A;  1YYK A;  4B3T E;  3JU0 A;  2DMY A;  1WXR A;  1T4O A;  2JVA A;  5FLX C;  1XMO E;  4LF8 E;  4WSP A;  2MC5 A;  4DV0 E;  4R03 A;  2NUF A;  2LRS A;  4I8O A;  1N34 E;  4DR2 E;  4DR3 E;  5IT9 C;  3VK6 A;  5ADZ A;  3J80 C;  4DV7 E;  4JI5 E;  1N32 E;  2UXC E;  4M0V A;  2B7V A;  5A2Q C;  4F54 A;  4LF6 E;  3OTO E;  4WFT A;  2EZ6 A;  2KHX A;  2N3H A;  2DSY A;  1YYO A;  4P78 A;  1J26 A;  4DV3 E;  4B3S E;  1IBK E;  2B9D A;  4X66 E;  4F9A B;  4DR1 E;  2L2M A;  2V86 A;  2VE7 C;  2LTR A;  2RS7 A;  4M30 A;  5LL6 R;  5BR8 E;  4X65 E;  3VYY A;  1J5E E;  1IBL E;  4LF4 E;  4GKJ E;  1ZBQ A;  2YT4 A;  4JYA E;  2ODR C;  2F8B A;  4B3M E;  2LJH A;  1SR9 A;  3T1H E;  2JOB A;  2LTS A;  2N3G A;  1RQ0 A;  2NA2 A;  5LMU E;  1XNQ E;  5CFF E;  3C4B A;  3ZOQ B;  4DV4 E;  1N36 E;  3IWC A;  3HPS A;  1I94 E;  4OX9 E;  2V83 A;  5F3W A;  1EKZ A;  2L92 A;  2LE2 A;  4J8Z A;  2V87 A;  2DB2 A;  4LFB E;  2L3C A;  5T6J A;  4DR7 E;  2VF1 A;  1IBM E;  2UUB E;  3ADJ A;  2MDR A;  4DV2 E;  4JI0 E;  3DF6 A;  4LU9 A;  2LUQ A;  3MSW A;  1HNZ E;  1O0W A;  2JOX A;  4YY3 E;  2G7H A;  1PKP A;  1QU6 A;  1X48 A;  1GQE A;  5AE2 A;  4JI1 E;  1DI2 A;  2JY9 A;  2WZO A;  3KWR A;  5IWA E;  1RC7 A;  2B3T B;  3ADG A;  4LF9 E;  2RTX A;  4DKK A;  4B3R E;  2V89 A;  4DV6 E;  4K0K E;  4JI3 E;  2L8T A;  3ADI A;  1ZBT A;  4JV5 E;  1UIL A;  4X62 E;  2LUP B;  4LFC E;  4BCA A;  3J81 C;  4LF5 E;  3H09 A;  4JI2 E;  4M2Z A;  2EWL A;  4X8W A;  2KON A;  2KOU A;  2FGG A;  4L8N A;  4BC9 A;  3AUZ A;  4KZS A;  4AQY E;  4YHH E;  4WPY A;  1HR0 E;  2V85 A;  3K6Q A;  1X49 A;  2VQE E;  3ADL A;  4X64 E;  2UXD E;  2L33 A;  3IWB A;  5AE3 A;  4DR4 E;  4JI8 E;  1UHZ A;  4JI4 E;  3HTX A;  4WYQ B;  3F6G A;  4BMJ A;  4OOG C;  2YZT A;  3F6H A;  1DQ3 A;  4DR6 E;  5AAS A;  4BC7 A;  5AE1 A;  4DUY E;  3JAM C;  4LFA E;  3VYX A;  2K4V A;  1N33 E;  2F4V E;  4BS9 A;  4GEQ B;  2UUC E;  1T4L B;  2ZM6 E;  2ODR D;  2JR1 A;  2E5L E;  4GKK E;  1FJG E;  3LML A;  2M1S A;  1YZ9 A;  2CPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...