2EPCA

Solution structure of zinc finger domain 7 in zinc finger protein 32
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGETPYLCGQCGKSFTQRGSLAVHQRSCSQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of Zinc finger domain 7 in Zinc finger protein 32
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 32
total genus 4
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epcA01
1X6FA 2EMGA 5KL4A 1LLMC 4F2JC 2YRHA 2NABA 2YTEA 1TF3A 2EPZA 1B69A 2EOXA 2EOFA 2EPCA 1G2DC 2EL6A 2DLQA 2EN8A 4R2DA 1X5WA 2CTDA 1P47A 1WJPA 2D9HA 2EOHA 2EM9A 4R2PA 2EOJA 4F6NA 1A1LA 2EP3A 2EPRA 2EMKA 1YUIA 5KL2A 2YSOA 2M9AA 2MKDA 1UN6B 3MHSC 1AAYA 2EPPA 1ZR9A 3EPKA 3EPHA 2GHFA 2EN4A 2R1FA 1Z1BA 2EM6A 2EMAA 1X6HA 2EM7A 2EMCA 2WBTA 3MHHC 1BB8A 2VRDA 2DLKA 2EOYA 1A1GA 2EM5A 4R2RA 4F6MA 2A25A 3EPLA 2LO3A 2EN7A 1JK1A 2EPUA 2PRTA 2EOZA 2YU8A 2EL4A 4FK5C 1A1JA 1A1FA 2DGCA 2EQ1A 4M9VC 2EN3A 1RMDA 5KL5A 1DGCA 2YTQA 1A1IA 2EM8A 2CSHA 1MEYC 1ZAAC 2EQ3A 1TF6A 2BB8A 2EMZA 4X9JA 5KL3A 5KL6A 2YTJA 1X3CA 2RPCA 2YTFA 4IJDA 2YTDA 1JK2A 2GLIA 2CT1A 2JPAA 2ELYA 2MKNA 2EJ4A 2E72A 2RSIA 5KL7A 2ELZA 1YSAC 2YSPA 2ENHA 2EM3A 1A1KA 1TN9A 2EORA 2I13A 2EE8A 4WSGA 2ADRA 2LCEA 2EM0A 2YTNA 2DRPA 4R2EA 2EOMA 2ENAA 4R2SA 4GZNC 2EMWA 2YTIA 1NCSA 2EN2A 1KJKA 2EL5A 2J7JA 2EMFA 2EOOA 2EMYA 1BBOA 2YTGA 1F2IG 4IS1C 2YTPA 2YRMA 2LT7A 2DMIA 2EM4A 2EOQA 2YTOA 2WBSA 2EN1A 4R2QA 2EQ0A 2MDGA 2EMXA 1YUJA 2EMBA 2EM2A 2HGHA 1X6EA 2EMHA 2EOIA 2EPAA 1ZU1A 3EPJA 1UBDC 2EN6A 2LVHA 2EPXA 2WCC3 2EMLA 3UK3C 2EOSA 2WBUA 2JP9A 2LV2A 1A1HA 2ENCA 4R2CA 3VHTB 4R2AA 1G2FC 3M99B 2YRKA 2YU5A 2EMIA 2EOEA
chains in the Genus database with same CATH superfamily
4DR4E 2L92A 3C4BA 1TF3A 2NABA 2YTEA 2EPZA 2EPCA 5A6JA 3BGHA 4LFBE 1BBGA 2EN8A 4TUGA 2CPNA 2F8BA 2LJHA 5LLQA 4R2PA 1HNWE 2N8XA 2EP3A 2MDRA 4KZSA 1YUIA 2YSOA 2M9AA 5A6AA 3MHSC 4JI0E 2VQFE 3EPKA 4KWYA 3EPHA 5AE3A 3J7AG 2EM7A 1UHZA 1A1GA 2EM5A 3EPLA 2EZ6A 2EPMX 1T38A 2ZM6E 1WXRA 3TQMA 1O0WA 3H09A 3HTXA 2EQ1A 2DSYA 4ZYGA 5LMUE 1YYKA 4X65E 1N3GA 2JOXA 4K0KE 2YTQA 4WYQB 1ZAAC 1HR0E 4JYAE 4DUZE 4OX9E 1X3CA 2YTFA 2MKNA 1KYQA 2VQEE 3VYYA 1YSAC 2RS7A 1NEIA 1UILA 2ENHA 1IQSA 4WXDA 2EE8A 3J81C 1GTKA 2LCEA 3F6HA 5F3WA 3LMLA 4X64E 2EM0A 2DRPA 4JI5E 2ENAA 1PKPA 2EMWA 3KWRA 1NCSA 2EN2A 2J7JA 5AE2A 1PJQA 1X49A 1ZBTA 2B9DA 2EOQA 2YTOA 2HHHE 4LTYA 4NXNE 1DQ3A 4DR2E 2HGHA 4DV6E 2EOIA 3BBGA 1IMUA 2V8QB 2EPLX 3T1YE 1UBDC 4F54A 4DUYE 2RQLA 2EPXA 1XNQE 4GEQB 5IV8B 2E5LE 2NUEA 1T4NA 5BR8E 2WBUA 2MC6A 2ENCA 1STUA 4R2AA 4B3ME 4HTGA 4GKKE 2EOEA 2JOBA 2RSMA 2N3GA 2EMGA 4LF8E 2M7QA 1HNZE 3HPZA 1B69A 2IHR1 1RQ0A 2HC5A 5A69A 4B3SE 4P7DA 1PJSA 2DLQA 2R76A 2GPIA 4RHBB 3ADJA 2YPNA 3C6MA 2CTDA 4ZYHA 1WJPA 2EOHA 4F6NA 1A1LA 1EH6A 3ECRA 5KL2A 1X48A 2MKDA 2UUAE 3J7Yp 1MGTA 5ADZA 2GHFA 4WFTA 4DV0E 2R1FA 2F4VE 1N33E 3IWDA 3MHHC 4JI1E 2EMCA 1BB8A 2LJUA 2VRDA 4LU9A 2DLKA 2EOYA 1EH8A 2G7HA 5A6KA 5AC5A 2BBGA 2EOZA 2YU8A 2EL4A 4FK5C 4N4RB 1A1JA 1IBLE 3FIGA 3VK6A 5KL5A 4WX9A 1DGCA 5AASA 2CSHA 2JWOA 2UU9E 1TF6A 2BB8A 1ZBQA 5KL3A 4JI7E 5KL6A 2YTDA 2V86A 2ELYA 2EPOA 4X66E 1PDAA 2EM3A 3THOB 1WRJA 2I13A 4WSGA 1YYOA 1AH5A 3P1XA 4R2EA 2EOMA 3ZOQB 4GZNC 1WHQA 2EWLA 1KJKA 2EL5A 2RS6A 2L33A 2L2KB 2UXDE 2YTGA 4DV5E 4LF6E 2LT7A 1PJTA 4RH8A 3EQ1A 2ODRC 4DV2E 2WBSA 2LMZA 4HEIA 2EQ0A 3JU0A 4R2QA 2EMXA 2EMBA 4Q35B 1X6EA 4DKKA 1N36E 1ZU1A 3EPJA 4LFCE 3F6GA 1QU6A 3ADGA 3JAMC 2EN6A 1GZ6A 4ZYEA 3THNA 2WCC3 2EMLA 1YZ9A 5LMNE 3VHTB 4JV5E 2YRKA 2LTSA 2EMIA 1YYWA 4LF5E 2VE7C 4F2JC 2YRHA 4JI8E 4MLVA 2M4IA 2EOXA 4Q28A 1G2DC 2DMYA 3LLHA 3HPSA 4M2ZA 4R2DA 1FKAE 1X5WA 3JTZA 1GQEA 2L2NA 4O4KA 4P78A 1P47A 2B3TB 2D9HA 2N3HA 4M30A 5IWAE 2L8TA 3MSWA 2NA2A 2EMKA 4DR7E 4BHBA 1UN6B 4OOGC 2YT4A 2EPPA 3QG5C 4BHCA 1T4LB 2EM6A 2EMAA 3KZYA 1YFHA 3DJWA 1J26A 2L2MA 2NUGA 1SFEA 4AQYE 4R2RA 2DB2A 2EN7A 1JK1A 1HNXE 2EPUA 4WPYA 2FV4B 1IBME 1A1FA 4R03A 4L8NA 2DGCA 5LL6R 4BC9A 4M9VC 2EN3A 2KONA 2EM8A 1XMOE 2Q8UA 1MEYC 2EQ3A 2EMZA 2JY9A 2UUCE 4B3RE 4DR3E 3T1HE 3OTOE 2RPCA 1N32E 5KL7A 2LUPB 5CFFE 1J5EE 4J8ZA 2KOUA 2LRSA 4O24A 2EORA 2M1SA 4BMJA 2YTNA 5FLXC 2JYAA 4DR1E 2YTIA 1IBKE 1DI2A 3AV0A 5IXMB 4IS1C 2K4VA 2H36X 1N34E 2EN1A 4X8WA 4O43A 4JI3E 5A6BA 2LBSB 2LVHA 4ZYDA 2LUQA 4JI6E 2EOSA 1RC7A 2JP9A 2LV2A 4F9BB 2FTXB 4F9AB 4R2CA 3ADLA 4F9CB 2RTXA 3M99B 3L00A 4LF4E 3HQ1A 2YZTA 1X6FA 5KL4A 1LLMC 2DIXA 5A6BD 5T6JA 2K7IA 4DR6E 2EOFA 2EL6A 4GKJE 4YY3E 4LFAE 4WSPA 4DV3E 3J80C 3C4TA 2EM9A 2EOJA 2V83A 3C6KA 1SR9A 2EPRA 2UXBE 1AAYA 4O5GA 4X62E 1ZR9A 4MLQA 4BC7A 2EN4A 2UXCE 1Z1BA 1WHNA 3AUZA 2V87A 1X6HA 2WBTA 2JR1A 4BS9A 3VYXA 3BIDA 4F6MA 2A25A 2FGGA 3K6QA 2LO3A 4NZVA 2PRTA 4DR5E 2B7VA 5DNYA 2WZOA 1QNTA 3DF6A 4DV1E 3RMPA 4DV7E 1EH7A 2I9IA 5A2QC 4TUIA 1RMDA 1L4SA 4DMIA 2LTRA 1A1IA 4BCAA 4JI2E 4X9JA 1EKZA 2YTJA 2JPAA 4IJDA 1JK2A 2GLIA 3HXLA 4DV4E 2CT1A 2JVAA 1XMQE 2EJ4A 2E72A 2RSIA 2ELZA 4I8OA 4NXME 1XNRE 2YSPA 4B3TE 1A1KA 1TN9A 2ADRA 3KZZA 1FJGE 4M0VA 5AC4A 1X47A 4YHHE 1IQOA 4R2SA 4JI4E 4LF7E 2L3CA 2EPNA 2EMFA 2EOOA 2EMYA 2VF1A 5IT9C 2UUBE 1BBOA 1F2IG 2B7TA 4NHRA 4R8OA 2YTPA 1YPNA 2YRMA 2DMIA 2EM4A 3IWBA 2KHXA 3OMLA 3ADIA 2YWQA 2MDGA 2ODRD 1YUJA 2EM2A 2MC5A 4KHPE 2EMHA 2EPAA 2LE2A 2E1MA 4L5NC 2HJJA 2EPKX 2NUFA 2L6MA 2JXPA 2V89A 3UK3C 1T39A 1T4OA 2V88A 4WXCA 3IWCA 1A1HA 5AE1A 2L3JA 5TSEA 4LF9E 1I94E 2V85A 1G2FC 2YU5A 4BBYA 3BF2A
chains in the Genus database with same CATH topology
1X6FA 2EMGA 5KL4A 1LLMC 4F2JC 2YRHA 2NABA 2YTEA 1TF3A 2EPZA 1B69A 2EOXA 2EOFA 2EPCA 1G2DC 2EL6A 2DLQA 2EN8A 4R2DA 1X5WA 2CTDA 1P47A 1WJPA 2D9HA 2EOHA 2EM9A 4R2PA 2EOJA 4F6NA 1A1LA 2EP3A 2EPRA 2EMKA 1YUIA 5KL2A 2YSOA 2M9AA 2MKDA 1UN6B 3MHSC 1AAYA 2EPPA 1ZR9A 3EPKA 3EPHA 2GHFA 2EN4A 2R1FA 1Z1BA 2EM6A 2EMAA 1X6HA 2EM7A 2EMCA 2WBTA 3MHHC 1BB8A 2VRDA 2DLKA 2EOYA 1A1GA 2EM5A 4R2RA 4F6MA 2A25A 3EPLA 2LO3A 2EN7A 1JK1A 2EPUA 2PRTA 2EOZA 2YU8A 2EL4A 4FK5C 1A1JA 1A1FA 2DGCA 2EQ1A 4M9VC 2EN3A 1RMDA 5KL5A 1DGCA 2YTQA 1A1IA 2EM8A 2CSHA 1MEYC 1ZAAC 2EQ3A 1TF6A 2BB8A 2EMZA 4X9JA 5KL3A 5KL6A 2YTJA 1X3CA 2RPCA 2YTFA 4IJDA 2YTDA 1JK2A 2GLIA 2CT1A 2JPAA 2ELYA 2MKNA 2EJ4A 2E72A 2RSIA 5KL7A 2ELZA 1YSAC 2YSPA 2ENHA 2EM3A 1A1KA 1TN9A 2EORA 2I13A 2EE8A 4WSGA 2ADRA 2LCEA 2EM0A 2YTNA 2DRPA 4R2EA 2EOMA 2ENAA 4R2SA 4GZNC 2EMWA 2YTIA 1NCSA 2EN2A 1KJKA 2EL5A 2J7JA 2EMFA 2EOOA 2EMYA 1BBOA 2YTGA 1F2IG 4IS1C 2YTPA 2YRMA 2LT7A 2DMIA 2EM4A 2EOQA 2YTOA 2WBSA 2EN1A 4R2QA 2EQ0A 2MDGA 2EMXA 1YUJA 2EMBA 2EM2A 2HGHA 1X6EA 2EMHA 2EOIA 2EPAA 1ZU1A 3EPJA 1UBDC 2EN6A 2LVHA 2EPXA 2WCC3 2EMLA 3UK3C 2EOSA 2WBUA 2JP9A 2LV2A 1A1HA 2ENCA 4R2CA 3VHTB 4R2AA 1G2FC 3M99B 2YRKA 2YU5A 2EMIA 2EOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6F A;  2EMG A;  5KL4 A;  1LLM C;  4F2J C;  2YRH A;  2NAB A;  2YTE A;  1TF3 A;  2EPZ A;  1B69 A;  2EOX A;  2EOF A;  2EPC A;  1G2D C;  2EL6 A;  2DLQ A;  2EN8 A;  4R2D A;  1X5W A;  2CTD A;  1P47 A;  1WJP A;  2D9H A;  2EOH A;  2EM9 A;  4R2P A;  2EOJ A;  4F6N A;  1A1L A;  2EP3 A;  2EPR A;  2EMK A;  1YUI A;  5KL2 A;  2YSO A;  2M9A A;  2MKD A;  1UN6 B;  3MHS C;  1AAY A;  2EPP A;  1ZR9 A;  3EPK A;  3EPH A;  2GHF A;  2EN4 A;  2R1F A;  1Z1B A;  2EM6 A;  2EMA A;  1X6H A;  2EM7 A;  2EMC A;  2WBT A;  3MHH C;  1BB8 A;  2VRD A;  2DLK A;  2EOY A;  1A1G A;  2EM5 A;  4R2R A;  4F6M A;  2A25 A;  3EPL A;  2LO3 A;  2EN7 A;  1JK1 A;  2EPU A;  2PRT A;  2EOZ A;  2YU8 A;  2EL4 A;  4FK5 C;  1A1J A;  1A1F A;  2DGC A;  2EQ1 A;  4M9V C;  2EN3 A;  1RMD A;  5KL5 A;  1DGC A;  2YTQ A;  1A1I A;  2EM8 A;  2CSH A;  1MEY C;  1ZAA C;  2EQ3 A;  1TF6 A;  2BB8 A;  2EMZ A;  4X9J A;  5KL3 A;  5KL6 A;  2YTJ A;  1X3C A;  2RPC A;  2YTF A;  4IJD A;  2YTD A;  1JK2 A;  2GLI A;  2CT1 A;  2JPA A;  2ELY A;  2MKN A;  2EJ4 A;  2E72 A;  2RSI A;  5KL7 A;  2ELZ A;  1YSA C;  2YSP A;  2ENH A;  2EM3 A;  1A1K A;  1TN9 A;  2EOR A;  2I13 A;  2EE8 A;  4WSG A;  2ADR A;  2LCE A;  2EM0 A;  2YTN A;  2DRP A;  4R2E A;  2EOM A;  2ENA A;  4R2S A;  4GZN C;  2EMW A;  2YTI A;  1NCS A;  2EN2 A;  1KJK A;  2EL5 A;  2J7J A;  2EMF A;  2EOO A;  2EMY A;  1BBO A;  2YTG A;  1F2I G;  4IS1 C;  2YTP A;  2YRM A;  2LT7 A;  2DMI A;  2EM4 A;  2EOQ A;  2YTO A;  2WBS A;  2EN1 A;  4R2Q A;  2EQ0 A;  2MDG A;  2EMX A;  1YUJ A;  2EMB A;  2EM2 A;  2HGH A;  1X6E A;  2EMH A;  2EOI A;  2EPA A;  1ZU1 A;  3EPJ A;  1UBD C;  2EN6 A;  2LVH A;  2EPX A;  2WCC 3;  2EML A;  3UK3 C;  2EOS A;  2WBU A;  2JP9 A;  2LV2 A;  1A1H A;  2ENC A;  4R2C A;  3VHT B;  4R2A A;  1G2F C;  3M99 B;  2YRK A;  2YU5 A;  2EMI A;  2EOE A; 
#chains in the Genus database with same CATH topology
 4DR4 E;  2L92 A;  3C4B A;  1TF3 A;  2NAB A;  2YTE A;  2EPZ A;  2EPC A;  5A6J A;  3BGH A;  4LFB E;  1BBG A;  2EN8 A;  4TUG A;  2CPN A;  2F8B A;  2LJH A;  5LLQ A;  4R2P A;  1HNW E;  2N8X A;  2EP3 A;  2MDR A;  4KZS A;  1YUI A;  2YSO A;  2M9A A;  5A6A A;  3MHS C;  4JI0 E;  2VQF E;  3EPK A;  4KWY A;  3EPH A;  5AE3 A;  3J7A G;  2EM7 A;  1UHZ A;  1A1G A;  2EM5 A;  3EPL A;  2EZ6 A;  2EPM X;  1T38 A;  2ZM6 E;  1WXR A;  3TQM A;  1O0W A;  3H09 A;  3HTX A;  2EQ1 A;  2DSY A;  4ZYG A;  5LMU E;  1YYK A;  4X65 E;  1N3G A;  2JOX A;  4K0K E;  2YTQ A;  4WYQ B;  1ZAA C;  1HR0 E;  4JYA E;  4DUZ E;  4OX9 E;  1X3C A;  2YTF A;  2MKN A;  1KYQ A;  2VQE E;  3VYY A;  1YSA C;  2RS7 A;  1NEI A;  1UIL A;  2ENH A;  1IQS A;  4WXD A;  2EE8 A;  3J81 C;  1GTK A;  2LCE A;  3F6H A;  5F3W A;  3LML A;  4X64 E;  2EM0 A;  2DRP A;  4JI5 E;  2ENA A;  1PKP A;  2EMW A;  3KWR A;  1NCS A;  2EN2 A;  2J7J A;  5AE2 A;  1PJQ A;  1X49 A;  1ZBT A;  2B9D A;  2EOQ A;  2YTO A;  2HHH E;  4LTY A;  4NXN E;  1DQ3 A;  4DR2 E;  2HGH A;  4DV6 E;  2EOI A;  3BBG A;  1IMU A;  2V8Q B;  2EPL X;  3T1Y E;  1UBD C;  4F54 A;  4DUY E;  2RQL A;  2EPX A;  1XNQ E;  4GEQ B;  5IV8 B;  2E5L E;  2NUE A;  1T4N A;  5BR8 E;  2WBU A;  2MC6 A;  2ENC A;  1STU A;  4R2A A;  4B3M E;  4HTG A;  4GKK E;  2EOE A;  2JOB A;  2RSM A;  2N3G A;  2EMG A;  4LF8 E;  2M7Q A;  1HNZ E;  3HPZ A;  1B69 A;  2IHR 1;  1RQ0 A;  2HC5 A;  5A69 A;  4B3S E;  4P7D A;  1PJS A;  2DLQ A;  2R76 A;  2GPI A;  4RHB B;  3ADJ A;  2YPN A;  3C6M A;  2CTD A;  4ZYH A;  1WJP A;  2EOH A;  4F6N A;  1A1L A;  1EH6 A;  3ECR A;  5KL2 A;  1X48 A;  2MKD A;  2UUA E;  3J7Y p;  1MGT A;  5ADZ A;  2GHF A;  4WFT A;  4DV0 E;  2R1F A;  2F4V E;  1N33 E;  3IWD A;  3MHH C;  4JI1 E;  2EMC A;  1BB8 A;  2LJU A;  2VRD A;  4LU9 A;  2DLK A;  2EOY A;  1EH8 A;  2G7H A;  5A6K A;  5AC5 A;  2BBG A;  2EOZ A;  2YU8 A;  2EL4 A;  4FK5 C;  4N4R B;  1A1J A;  1IBL E;  3FIG A;  3VK6 A;  5KL5 A;  4WX9 A;  1DGC A;  5AAS A;  2CSH A;  2JWO A;  2UU9 E;  1TF6 A;  2BB8 A;  1ZBQ A;  5KL3 A;  4JI7 E;  5KL6 A;  2YTD A;  2V86 A;  2ELY A;  2EPO A;  4X66 E;  1PDA A;  2EM3 A;  3THO B;  1WRJ A;  2I13 A;  4WSG A;  1YYO A;  1AH5 A;  3P1X A;  4R2E A;  2EOM A;  3ZOQ B;  4GZN C;  1WHQ A;  2EWL A;  1KJK A;  2EL5 A;  2RS6 A;  2L33 A;  2L2K B;  2UXD E;  2YTG A;  4DV5 E;  4LF6 E;  2LT7 A;  1PJT A;  4RH8 A;  3EQ1 A;  2ODR C;  4DV2 E;  2WBS A;  2LMZ A;  4HEI A;  2EQ0 A;  3JU0 A;  4R2Q A;  2EMX A;  2EMB A;  4Q35 B;  1X6E A;  4DKK A;  1N36 E;  1ZU1 A;  3EPJ A;  4LFC E;  3F6G A;  1QU6 A;  3ADG A;  3JAM C;  2EN6 A;  1GZ6 A;  4ZYE A;  3THN A;  2WCC 3;  2EML A;  1YZ9 A;  5LMN E;  3VHT B;  4JV5 E;  2YRK A;  2LTS A;  2EMI A;  1YYW A;  4LF5 E;  2VE7 C;  4F2J C;  2YRH A;  4JI8 E;  4MLV A;  2M4I A;  2EOX A;  4Q28 A;  1G2D C;  2DMY A;  3LLH A;  3HPS A;  4M2Z A;  4R2D A;  1FKA E;  1X5W A;  3JTZ A;  1GQE A;  2L2N A;  4O4K A;  4P78 A;  1P47 A;  2B3T B;  2D9H A;  2N3H A;  4M30 A;  5IWA E;  2L8T A;  3MSW A;  2NA2 A;  2EMK A;  4DR7 E;  4BHB A;  1UN6 B;  4OOG C;  2YT4 A;  2EPP A;  3QG5 C;  4BHC A;  1T4L B;  2EM6 A;  2EMA A;  3KZY A;  1YFH A;  3DJW A;  1J26 A;  2L2M A;  2NUG A;  1SFE A;  4AQY E;  4R2R A;  2DB2 A;  2EN7 A;  1JK1 A;  1HNX E;  2EPU A;  4WPY A;  2FV4 B;  1IBM E;  1A1F A;  4R03 A;  4L8N A;  2DGC A;  5LL6 R;  4BC9 A;  4M9V C;  2EN3 A;  2KON A;  2EM8 A;  1XMO E;  2Q8U A;  1MEY C;  2EQ3 A;  2EMZ A;  2JY9 A;  2UUC E;  4B3R E;  4DR3 E;  3T1H E;  3OTO E;  2RPC A;  1N32 E;  5KL7 A;  2LUP B;  5CFF E;  1J5E E;  4J8Z A;  2KOU A;  2LRS A;  4O24 A;  2EOR A;  2M1S A;  4BMJ A;  2YTN A;  5FLX C;  2JYA A;  4DR1 E;  2YTI A;  1IBK E;  1DI2 A;  3AV0 A;  5IXM B;  4IS1 C;  2K4V A;  2H36 X;  1N34 E;  2EN1 A;  4X8W A;  4O43 A;  4JI3 E;  5A6B A;  2LBS B;  2LVH A;  4ZYD A;  2LUQ A;  4JI6 E;  2EOS A;  1RC7 A;  2JP9 A;  2LV2 A;  4F9B B;  2FTX B;  4F9A B;  4R2C A;  3ADL A;  4F9C B;  2RTX A;  3M99 B;  3L00 A;  4LF4 E;  3HQ1 A;  2YZT A;  1X6F A;  5KL4 A;  1LLM C;  2DIX A;  5A6B D;  5T6J A;  2K7I A;  4DR6 E;  2EOF A;  2EL6 A;  4GKJ E;  4YY3 E;  4LFA E;  4WSP A;  4DV3 E;  3J80 C;  3C4T A;  2EM9 A;  2EOJ A;  2V83 A;  3C6K A;  1SR9 A;  2EPR A;  2UXB E;  1AAY A;  4O5G A;  4X62 E;  1ZR9 A;  4MLQ A;  4BC7 A;  2EN4 A;  2UXC E;  1Z1B A;  1WHN A;  3AUZ A;  2V87 A;  1X6H A;  2WBT A;  2JR1 A;  4BS9 A;  3VYX A;  3BID A;  4F6M A;  2A25 A;  2FGG A;  3K6Q A;  2LO3 A;  4NZV A;  2PRT A;  4DR5 E;  2B7V A;  5DNY A;  2WZO A;  1QNT A;  3DF6 A;  4DV1 E;  3RMP A;  4DV7 E;  1EH7 A;  2I9I A;  5A2Q C;  4TUI A;  1RMD A;  1L4S A;  4DMI A;  2LTR A;  1A1I A;  4BCA A;  4JI2 E;  4X9J A;  1EKZ A;  2YTJ A;  2JPA A;  4IJD A;  1JK2 A;  2GLI A;  3HXL A;  4DV4 E;  2CT1 A;  2JVA A;  1XMQ E;  2EJ4 A;  2E72 A;  2RSI A;  2ELZ A;  4I8O A;  4NXM E;  1XNR E;  2YSP A;  4B3T E;  1A1K A;  1TN9 A;  2ADR A;  3KZZ A;  1FJG E;  4M0V A;  5AC4 A;  1X47 A;  4YHH E;  1IQO A;  4R2S A;  4JI4 E;  4LF7 E;  2L3C A;  2EPN A;  2EMF A;  2EOO A;  2EMY A;  2VF1 A;  5IT9 C;  2UUB E;  1BBO A;  1F2I G;  2B7T A;  4NHR A;  4R8O A;  2YTP A;  1YPN A;  2YRM A;  2DMI A;  2EM4 A;  3IWB A;  2KHX A;  3OML A;  3ADI A;  2YWQ A;  2MDG A;  2ODR D;  1YUJ A;  2EM2 A;  2MC5 A;  4KHP E;  2EMH A;  2EPA A;  2LE2 A;  2E1M A;  4L5N C;  2HJJ A;  2EPK X;  2NUF A;  2L6M A;  2JXP A;  2V89 A;  3UK3 C;  1T39 A;  1T4O A;  2V88 A;  4WXC A;  3IWC A;  1A1H A;  5AE1 A;  2L3J A;  5TSE A;  4LF9 E;  1I94 E;  2V85 A;  1G2F C;  2YU5 A;  4BBY A;  3BF2 A; 
#chains in the Genus database with same CATH homology
 1X6F A;  2EMG A;  5KL4 A;  1LLM C;  4F2J C;  2YRH A;  2NAB A;  2YTE A;  1TF3 A;  2EPZ A;  1B69 A;  2EOX A;  2EOF A;  2EPC A;  1G2D C;  2EL6 A;  2DLQ A;  2EN8 A;  4R2D A;  1X5W A;  2CTD A;  1P47 A;  1WJP A;  2D9H A;  2EOH A;  2EM9 A;  4R2P A;  2EOJ A;  4F6N A;  1A1L A;  2EP3 A;  2EPR A;  2EMK A;  1YUI A;  5KL2 A;  2YSO A;  2M9A A;  2MKD A;  1UN6 B;  3MHS C;  1AAY A;  2EPP A;  1ZR9 A;  3EPK A;  3EPH A;  2GHF A;  2EN4 A;  2R1F A;  1Z1B A;  2EM6 A;  2EMA A;  1X6H A;  2EM7 A;  2EMC A;  2WBT A;  3MHH C;  1BB8 A;  2VRD A;  2DLK A;  2EOY A;  1A1G A;  2EM5 A;  4R2R A;  4F6M A;  2A25 A;  3EPL A;  2LO3 A;  2EN7 A;  1JK1 A;  2EPU A;  2PRT A;  2EOZ A;  2YU8 A;  2EL4 A;  4FK5 C;  1A1J A;  1A1F A;  2DGC A;  2EQ1 A;  4M9V C;  2EN3 A;  1RMD A;  5KL5 A;  1DGC A;  2YTQ A;  1A1I A;  2EM8 A;  2CSH A;  1MEY C;  1ZAA C;  2EQ3 A;  1TF6 A;  2BB8 A;  2EMZ A;  4X9J A;  5KL3 A;  5KL6 A;  2YTJ A;  1X3C A;  2RPC A;  2YTF A;  4IJD A;  2YTD A;  1JK2 A;  2GLI A;  2CT1 A;  2JPA A;  2ELY A;  2MKN A;  2EJ4 A;  2E72 A;  2RSI A;  5KL7 A;  2ELZ A;  1YSA C;  2YSP A;  2ENH A;  2EM3 A;  1A1K A;  1TN9 A;  2EOR A;  2I13 A;  2EE8 A;  4WSG A;  2ADR A;  2LCE A;  2EM0 A;  2YTN A;  2DRP A;  4R2E A;  2EOM A;  2ENA A;  4R2S A;  4GZN C;  2EMW A;  2YTI A;  1NCS A;  2EN2 A;  1KJK A;  2EL5 A;  2J7J A;  2EMF A;  2EOO A;  2EMY A;  1BBO A;  2YTG A;  1F2I G;  4IS1 C;  2YTP A;  2YRM A;  2LT7 A;  2DMI A;  2EM4 A;  2EOQ A;  2YTO A;  2WBS A;  2EN1 A;  4R2Q A;  2EQ0 A;  2MDG A;  2EMX A;  1YUJ A;  2EMB A;  2EM2 A;  2HGH A;  1X6E A;  2EMH A;  2EOI A;  2EPA A;  1ZU1 A;  3EPJ A;  1UBD C;  2EN6 A;  2LVH A;  2EPX A;  2WCC 3;  2EML A;  3UK3 C;  2EOS A;  2WBU A;  2JP9 A;  2LV2 A;  1A1H A;  2ENC A;  4R2C A;  3VHT B;  4R2A A;  1G2F C;  3M99 B;  2YRK A;  2YU5 A;  2EMI A;  2EOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...