2EPCA

Solution structure of zinc finger domain 7 in zinc finger protein 32
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGETPYLCGQCGKSFTQRGSLAVHQRSCSQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Zinc finger protein 32
publication title Solution structure of Zinc finger domain 7 in Zinc finger protein 32
rcsb
source organism Homo sapiens
total genus 4
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epcA01
2LT7A 2YRHA 1A1KA 2EOHA 3MHHC 4R2RA 2EL5A 1TF3A 2ELYA 2WBSA 2M9AA 2EOXA 2DRPA 2EN6A 2EOEA 2EN8A 2YTJA 3UK3C 4F6MA 2PRTA 2YU5A 2EPRA 2EQ3A 2RPCA 1B69A 2GLIA 2YTFA 2EOJA 2EMWA 2ENHA 1RMDA 1Z1BA 1LLMC 3EPKA 1X3CA 2YRMA 2EMYA 1UBDC 3EPHA 2VRDA 4X9JA 1A1LA 5KL2A 2EMLA 3EPLA 2EOQA 2BB8A 2EOOA 2EN2A 2EOZA 2EPXA 1A1IA 2A25A 2JP9A 2JPAA 2J7JA 2YTQA 2YTNA 1X6EA 2EL4A 2EPPA 5KL7A 2ELZA 2EM6A 2EOSA 2EE8A 1YUJA 1JK1A 2EOMA 1DGCA 2D9HA 2E72A 1X6FA 1F2IG 2EM7A 1A1GA 1BB8A 2EMBA 2EORA 4R2QA 2NABA 4R2EA 2YRKA 2EM0A 2EJ4A 2EM9A 4F6NA 2EMCA 1UN6B 1X5WA 4R2SA 2EN4A 2CSHA 2EM8A 2EP3A 1A1HA 1AAYA 1A1JA 1G2FC 2ENAA 3M99B 2EL6A 2RSIA 2YTPA 2EPZA 1WJPA 4F2JC 2EMXA 2YTOA 2EPUA 4WSGA 1P47A 1A1FA 2DMIA 2CTDA 2EMAA 1JK2A 5KL3A 2LO3A 2EQ1A 2WBTA 2DLKA 1KJKA 1X6HA 2YTIA 2EOFA 2WBUA 5KL4A 2EM3A 2LVHA 1YUIA 2EMZA 5KL5A 2YU8A 2EM4A 4R2DA 2HGHA 2I13A 2YSPA 2YTGA 1MEYC 4R2AA 1TN9A 2DGCA 1NCSA 2EN1A 2MDGA 2DLQA 1ZAAC 4M9VC 1YSAC 2EMGA 2EN7A 2YTDA 2MKDA 2GHFA 2CT1A 2EMIA 2WCC3 3EPJA 4GZNC 2EOIA 1TF6A 2MKNA 2EN3A 4FK5C 5KL6A 1BBOA 2EPCA 2R1FA 2EMFA 2EPAA 2EQ0A 4IS1C 2YTEA 2EMKA 4IJDA 2YSOA 2LV2A 2EM5A 1ZR9A 3VHTB 4R2PA 1G2DC 2ENCA 2ADRA 2EM2A 2EOYA 3MHSC 2LCEA 1ZU1A 4R2CA 2EMHA
chains in the Genus database with same CATH superfamily
4R8OA 2V86A 2L8TA 2EL5A 1HNZE 4AQYE 2M9AA 5FLXC 4BMJA 1PKPA 1QU6A 2V83A 4DKKA 4JI5E 2YTJA 3UK3C 2K7IA 4LFBE 3MSWA 2EPRA 2B9DA 2EPNA 1WHNA 3ADJA 2F8BA 2YPNA 4LTYA 2EOJA 2ENHA 4DV2E 1Z1BA 1X3CA 1UBDC 4JI1E 4X9JA 2JYAA 3RMPA 3J81C 4X65E 1UHZA 2EWLA 4B3ME 4ZYGA 3QG5C 3KZZA 4L8NA 5KL7A 2ELZA 4F9BB 4NXME 4NHRA 1XMQE 2KOUA 2VE7C 2KONA 5LLQA 1DGCA 1XNRE 4WFTA 2E72A 2V88A 3DF6A 3F6HA 4R2EA 2EJ4A 3ADIA 1SFEA 2CSHA 3DJWA 1A1HA 1AAYA 2EZ6A 3M99B 1T4NA 2YTPA 2EPZA 4F2JC 3BBGA 1YYKA 3BGHA 4O5GA 2YTOA 2EPUA 2RS7A 1P47A 1A1FA 1IBKE 5A2QC 3IWDA 1JK2A 5KL3A 2LO3A 3F6GA 4LFAE 2NUFA 2WBUA 2EM3A 1T4OA 1IBLE 1KYQA 2FTXB 1SR9A 4Q28A 1YYOA 1MGTA 2B3TB 5A6JA 2YU8A 5A6AA 2HGHA 4LF6E 3HXLA 3HTXA 2N3HA 2CPNA 1MEYC 2V85A 4X8WA 1TN9A 3C6KA 1NCSA 3C4BA 2NUEA 4F54A 5F3WA 1ZAAC 3HPZA 2RQLA 5A6BA 2LJUA 5IXMB 2UXBE 2YTDA 1IMUA 1TF6A 2MKNA 1PJTA 1BBOA 3J7Yp 1GTKA 2K4VA 2R1FA 4JI3E 4GEQB 4KWYA 5AE3A 2L33A 4J8ZA 1J26A 2EM5A 3VHTB 4JYAE 2V87A 2ENCA 2L92A 4WXCA 4N4RB 2YT4A 1ZU1A 4R2CA 2UUCE 4R2RA 1HNXE 1TF3A 2MC6A 2WBSA 2EOXA 2E5LE 1PJSA 2EOEA 2EN8A 4F6MA 5AE2A 2YU5A 2UUBE 2FV4B 1B69A 4RH8A 4DMIA 2EMWA 1RMDA 4DR3E 2HC5A 2YRMA 4TUGA 2EMYA 2L2KB 1O0WA 5LMUE 3EPHA 2VRDA 1EH6A 2G7HA 3T1YE 1EH7A 3AV0A 4RHBB 1J5EE 2EMLA 3TQMA 2BB8A 2EOOA 2EOZA 1NEIA 2IHR1 5DNYA 5IV8B 2V8QB 2JPAA 2JP9A 2YTNA 4MLQA 2VQEE 4BHCA 2EPPA 2UXCE 3FIGA 4L5NC 1PDAA 1YFHA 4DUZE 1JK1A 3BF2A 1F2IG 4BBYA 1EH8A 4R03A 4R2QA 2YRKA 2EM0A 4BC7A 1GQEA 2EMCA 4F6NA 4B3TE 2L3CA 2EN4A 2EM8A 1G2FC 4JV5E 2EL6A 4O43A 2LMZA 2M1SA 2ODRD 4WSGA 2CTDA 3P1XA 4HEIA 2EQ1A 4X64E 3ADLA 5IWAE 1X6HA 4O4KA 4YHHE 2L2MA 1N3GA 5KL4A 3T1HE 5T6JA 1IBME 2LVHA 2WZOA 4LF5E 4R2DA 4GKJE 4LU9A 2EN1A 4DUYE 2LE2A 5CFFE 4KHPE 4OX9E 2EMGA 3EQ1A 5IT9C 2M7QA 2JXPA 2GHFA 2EMIA 1I94E 3EPJA 4FK5C 4F9AB 2EPCA 5BR8E 1PJQA 4P7DA 4DV1E 2EMFA 2EQ0A 4Q35B 4DV7E 4IJDA 1G2DC 2EM2A 4WSPA 4LF8E 2LUPB 2LCEA 1T39A 4M2ZA 3ADGA 1FJGE 5AASA 2HHHE 1A1KA 3MHHC 2LTRA 2I9IA 3LLHA 2VF1A 2NUGA 2EN6A 3C6MA 2PRTA 4DR5E 2RPCA 1T4LB 4OOGC 3K6QA 2GPIA 2BBGA 2F4VE 4P78A 2M4IA 2KHXA 4BCAA 2EOQA 2JVAA 2A25A 4K0KE 2YTQA 4LF4E 1X6EA 1QNTA 4NXNE 2L6MA 1X48A 2EE8A 2EOSA 2FGGA 1ZBTA 4JI4E 2D9HA 1X6FA 1A1GA 4DR7E 4WX9A 2JY9A 2NABA 2H36X 1XMOE 2EP3A 5AC5A 4NZVA 2LBSB 1XNQE 1WJPA 1FKAE 2YWQA 5LMNE 2DMIA 5AC4A 2DB2A 1DQ3A 2RS6A 3HQ1A 4DV3E 3IWCA 3C4TA 4M30A 5AE1A 2WBTA 2HJJA 2DLKA 3LMLA 2N3GA 2N8XA 2YTIA 5A6KA 4F9CB 4O24A 2UU9E 1X49A 1EKZA 2EMZA 1GZ6A 2JOXA 5KL5A 2EM4A 2YTGA 4YY3E 2RTXA 4BS9A 3VYXA 3VYYA 2DLQA 4I8OA 2MC5A 3KZYA 1YSAC 1N36E 4JI8E 5LL6R 3BIDA 2UUAE 2MKDA 2CT1A 2WCC3 4GZNC 2EOIA 5TSEA 2EMKA 1T38A 3J80C 2DSYA 2YSOA 2LV2A 2B7VA 1ZR9A 2UXDE 2ADRA 2LRSA 1DI2A 2JR1A 4X62E 4B3SE 2EPLX 2EMHA 5A6BD 2LT7A 2YRHA 4HTGA 1YPNA 2DMYA 2EOHA 4B3RE 4DV4E 3VK6A 2JOBA 2ELYA 2DRPA 3ZOQB 4DR6E 2EQ3A 2EPKX 2GLIA 1ZBQA 2YTFA 4JI2E 1N33E 1LLMC 3EPKA 1IQOA 1N34E 4LF7E 4DR2E 4DV6E 1A1LA 1HR0E 1YZ9A 5KL2A 3EPLA 1N32E 2EN2A 3THNA 2EPXA 4MLVA 1A1IA 2ODRC 3JAMC 4LF9E 2J7JA 2L3JA 2Q8UA 4BHBA 2EL4A 2B7TA 2EM6A 1YUJA 2EOMA 3HPSA 3L00A 4X66E 2EM7A 1UILA 2LTSA 1WXRA 1BB8A 2EMBA 2EORA 4DR1E 2NA2A 1WHQA 2EM9A 3JTZA 3JU0A 4DV5E 1UN6B 1STUA 2L2NA 3OTOE 1X5WA 2LUQA 2JWOA 3THOB 4R2SA 1HNWE 4WXDA 1A1JA 2ENAA 2RSIA 2V89A 4M0VA 2EPMX 2EMXA 1BBGA 3KWRA 1L4SA 2EMAA 4WYQB 1RQ0A 4ZYDA 1KJKA 1AH5A 2EOFA 4JI6E 1YUIA 4LFCE 4DR4E 4JI7E 5ADZA 4ZYHA 1YYWA 2E1MA 2I13A 1IQSA 4KZSA 2YSPA 4TUIA 4R2AA 2DGCA 2EPOA 2MDGA 3ECRA 4BC9A 4M9VC 3AUZA 1X47A 2R76A 3H09A 2EN7A 3OMLA 2MDRA 1WRJA 5A69A 1RC7A 3IWBA 3J7AG 2EN3A 4WPYA 5KL6A 2ZM6E 2EPAA 4IS1C 2YZTA 2YTEA 2DIXA 2VQFE 4GKKE 4JI0E 2LJHA 4ZYEA 4R2PA 2EOYA 3MHSC 4DV0E 2RSMA
chains in the Genus database with same CATH topology
2LT7A 2YRHA 1A1KA 2EOHA 3MHHC 4R2RA 2EL5A 1TF3A 2ELYA 2WBSA 2M9AA 2EOXA 2DRPA 2EN6A 2EOEA 2EN8A 2YTJA 3UK3C 4F6MA 2PRTA 2YU5A 2EPRA 2EQ3A 2RPCA 1B69A 2GLIA 2YTFA 2EOJA 2EMWA 2ENHA 1RMDA 1Z1BA 1LLMC 3EPKA 1X3CA 2YRMA 2EMYA 1UBDC 3EPHA 2VRDA 4X9JA 1A1LA 5KL2A 2EMLA 3EPLA 2EOQA 2BB8A 2EOOA 2EN2A 2EOZA 2EPXA 1A1IA 2A25A 2JP9A 2JPAA 2J7JA 2YTQA 2YTNA 1X6EA 2EL4A 2EPPA 5KL7A 2ELZA 2EM6A 2EOSA 2EE8A 1YUJA 1JK1A 2EOMA 1DGCA 2D9HA 2E72A 1X6FA 1F2IG 2EM7A 1A1GA 1BB8A 2EMBA 2EORA 4R2QA 2NABA 4R2EA 2YRKA 2EM0A 2EJ4A 2EM9A 4F6NA 2EMCA 1UN6B 1X5WA 4R2SA 2EN4A 2CSHA 2EM8A 2EP3A 1A1HA 1AAYA 1A1JA 1G2FC 2ENAA 3M99B 2EL6A 2RSIA 2YTPA 2EPZA 1WJPA 4F2JC 2EMXA 2YTOA 2EPUA 4WSGA 1P47A 1A1FA 2DMIA 2CTDA 2EMAA 1JK2A 5KL3A 2LO3A 2EQ1A 2WBTA 2DLKA 1KJKA 1X6HA 2YTIA 2EOFA 2WBUA 5KL4A 2EM3A 2LVHA 1YUIA 2EMZA 5KL5A 2YU8A 2EM4A 4R2DA 2HGHA 2I13A 2YSPA 2YTGA 1MEYC 4R2AA 1TN9A 2DGCA 1NCSA 2EN1A 2MDGA 2DLQA 1ZAAC 4M9VC 1YSAC 2EMGA 2EN7A 2YTDA 2MKDA 2GHFA 2CT1A 2EMIA 2WCC3 3EPJA 4GZNC 2EOIA 1TF6A 2MKNA 2EN3A 4FK5C 5KL6A 1BBOA 2EPCA 2R1FA 2EMFA 2EPAA 2EQ0A 4IS1C 2YTEA 2EMKA 4IJDA 2YSOA 2LV2A 2EM5A 1ZR9A 3VHTB 4R2PA 1G2DC 2ENCA 2ADRA 2EM2A 2EOYA 3MHSC 2LCEA 1ZU1A 4R2CA 2EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT7 A;  2YRH A;  1A1K A;  2EOH A;  3MHH C;  4R2R A;  2EL5 A;  1TF3 A;  2ELY A;  2WBS A;  2M9A A;  2EOX A;  2DRP A;  2EN6 A;  2EOE A;  2EN8 A;  2YTJ A;  3UK3 C;  4F6M A;  2PRT A;  2YU5 A;  2EPR A;  2EQ3 A;  2RPC A;  1B69 A;  2GLI A;  2YTF A;  2EOJ A;  2EMW A;  2ENH A;  1RMD A;  1Z1B A;  1LLM C;  3EPK A;  1X3C A;  2YRM A;  2EMY A;  1UBD C;  3EPH A;  2VRD A;  4X9J A;  1A1L A;  5KL2 A;  2EML A;  3EPL A;  2EOQ A;  2BB8 A;  2EOO A;  2EN2 A;  2EOZ A;  2EPX A;  1A1I A;  2A25 A;  2JP9 A;  2JPA A;  2J7J A;  2YTQ A;  2YTN A;  1X6E A;  2EL4 A;  2EPP A;  5KL7 A;  2ELZ A;  2EM6 A;  2EOS A;  2EE8 A;  1YUJ A;  1JK1 A;  2EOM A;  1DGC A;  2D9H A;  2E72 A;  1X6F A;  1F2I G;  2EM7 A;  1A1G A;  1BB8 A;  2EMB A;  2EOR A;  4R2Q A;  2NAB A;  4R2E A;  2YRK A;  2EM0 A;  2EJ4 A;  2EM9 A;  4F6N A;  2EMC A;  1UN6 B;  1X5W A;  4R2S A;  2EN4 A;  2CSH A;  2EM8 A;  2EP3 A;  1A1H A;  1AAY A;  1A1J A;  1G2F C;  2ENA A;  3M99 B;  2EL6 A;  2RSI A;  2YTP A;  2EPZ A;  1WJP A;  4F2J C;  2EMX A;  2YTO A;  2EPU A;  4WSG A;  1P47 A;  1A1F A;  2DMI A;  2CTD A;  2EMA A;  1JK2 A;  5KL3 A;  2LO3 A;  2EQ1 A;  2WBT A;  2DLK A;  1KJK A;  1X6H A;  2YTI A;  2EOF A;  2WBU A;  5KL4 A;  2EM3 A;  2LVH A;  1YUI A;  2EMZ A;  5KL5 A;  2YU8 A;  2EM4 A;  4R2D A;  2HGH A;  2I13 A;  2YSP A;  2YTG A;  1MEY C;  4R2A A;  1TN9 A;  2DGC A;  1NCS A;  2EN1 A;  2MDG A;  2DLQ A;  1ZAA C;  4M9V C;  1YSA C;  2EMG A;  2EN7 A;  2YTD A;  2MKD A;  2GHF A;  2CT1 A;  2EMI A;  2WCC 3;  3EPJ A;  4GZN C;  2EOI A;  1TF6 A;  2MKN A;  2EN3 A;  4FK5 C;  5KL6 A;  1BBO A;  2EPC A;  2R1F A;  2EMF A;  2EPA A;  2EQ0 A;  4IS1 C;  2YTE A;  2EMK A;  4IJD A;  2YSO A;  2LV2 A;  2EM5 A;  1ZR9 A;  3VHT B;  4R2P A;  1G2D C;  2ENC A;  2ADR A;  2EM2 A;  2EOY A;  3MHS C;  2LCE A;  1ZU1 A;  4R2C A;  2EMH A; 
#chains in the Genus database with same CATH topology
 4R8O A;  2V86 A;  2L8T A;  2EL5 A;  1HNZ E;  4AQY E;  2M9A A;  5FLX C;  4BMJ A;  1PKP A;  1QU6 A;  2V83 A;  4DKK A;  4JI5 E;  2YTJ A;  3UK3 C;  2K7I A;  4LFB E;  3MSW A;  2EPR A;  2B9D A;  2EPN A;  1WHN A;  3ADJ A;  2F8B A;  2YPN A;  4LTY A;  2EOJ A;  2ENH A;  4DV2 E;  1Z1B A;  1X3C A;  1UBD C;  4JI1 E;  4X9J A;  2JYA A;  3RMP A;  3J81 C;  4X65 E;  1UHZ A;  2EWL A;  4B3M E;  4ZYG A;  3QG5 C;  3KZZ A;  4L8N A;  5KL7 A;  2ELZ A;  4F9B B;  4NXM E;  4NHR A;  1XMQ E;  2KOU A;  2VE7 C;  2KON A;  5LLQ A;  1DGC A;  1XNR E;  4WFT A;  2E72 A;  2V88 A;  3DF6 A;  3F6H A;  4R2E A;  2EJ4 A;  3ADI A;  1SFE A;  2CSH A;  3DJW A;  1A1H A;  1AAY A;  2EZ6 A;  3M99 B;  1T4N A;  2YTP A;  2EPZ A;  4F2J C;  3BBG A;  1YYK A;  3BGH A;  4O5G A;  2YTO A;  2EPU A;  2RS7 A;  1P47 A;  1A1F A;  1IBK E;  5A2Q C;  3IWD A;  1JK2 A;  5KL3 A;  2LO3 A;  3F6G A;  4LFA E;  2NUF A;  2WBU A;  2EM3 A;  1T4O A;  1IBL E;  1KYQ A;  2FTX B;  1SR9 A;  4Q28 A;  1YYO A;  1MGT A;  2B3T B;  5A6J A;  2YU8 A;  5A6A A;  2HGH A;  4LF6 E;  3HXL A;  3HTX A;  2N3H A;  2CPN A;  1MEY C;  2V85 A;  4X8W A;  1TN9 A;  3C6K A;  1NCS A;  3C4B A;  2NUE A;  4F54 A;  5F3W A;  1ZAA C;  3HPZ A;  2RQL A;  5A6B A;  2LJU A;  5IXM B;  2UXB E;  2YTD A;  1IMU A;  1TF6 A;  2MKN A;  1PJT A;  1BBO A;  3J7Y p;  1GTK A;  2K4V A;  2R1F A;  4JI3 E;  4GEQ B;  4KWY A;  5AE3 A;  2L33 A;  4J8Z A;  1J26 A;  2EM5 A;  3VHT B;  4JYA E;  2V87 A;  2ENC A;  2L92 A;  4WXC A;  4N4R B;  2YT4 A;  1ZU1 A;  4R2C A;  2UUC E;  4R2R A;  1HNX E;  1TF3 A;  2MC6 A;  2WBS A;  2EOX A;  2E5L E;  1PJS A;  2EOE A;  2EN8 A;  4F6M A;  5AE2 A;  2YU5 A;  2UUB E;  2FV4 B;  1B69 A;  4RH8 A;  4DMI A;  2EMW A;  1RMD A;  4DR3 E;  2HC5 A;  2YRM A;  4TUG A;  2EMY A;  2L2K B;  1O0W A;  5LMU E;  3EPH A;  2VRD A;  1EH6 A;  2G7H A;  3T1Y E;  1EH7 A;  3AV0 A;  4RHB B;  1J5E E;  2EML A;  3TQM A;  2BB8 A;  2EOO A;  2EOZ A;  1NEI A;  2IHR 1;  5DNY A;  5IV8 B;  2V8Q B;  2JPA A;  2JP9 A;  2YTN A;  4MLQ A;  2VQE E;  4BHC A;  2EPP A;  2UXC E;  3FIG A;  4L5N C;  1PDA A;  1YFH A;  4DUZ E;  1JK1 A;  3BF2 A;  1F2I G;  4BBY A;  1EH8 A;  4R03 A;  4R2Q A;  2YRK A;  2EM0 A;  4BC7 A;  1GQE A;  2EMC A;  4F6N A;  4B3T E;  2L3C A;  2EN4 A;  2EM8 A;  1G2F C;  4JV5 E;  2EL6 A;  4O43 A;  2LMZ A;  2M1S A;  2ODR D;  4WSG A;  2CTD A;  3P1X A;  4HEI A;  2EQ1 A;  4X64 E;  3ADL A;  5IWA E;  1X6H A;  4O4K A;  4YHH E;  2L2M A;  1N3G A;  5KL4 A;  3T1H E;  5T6J A;  1IBM E;  2LVH A;  2WZO A;  4LF5 E;  4R2D A;  4GKJ E;  4LU9 A;  2EN1 A;  4DUY E;  2LE2 A;  5CFF E;  4KHP E;  4OX9 E;  2EMG A;  3EQ1 A;  5IT9 C;  2M7Q A;  2JXP A;  2GHF A;  2EMI A;  1I94 E;  3EPJ A;  4FK5 C;  4F9A B;  2EPC A;  5BR8 E;  1PJQ A;  4P7D A;  4DV1 E;  2EMF A;  2EQ0 A;  4Q35 B;  4DV7 E;  4IJD A;  1G2D C;  2EM2 A;  4WSP A;  4LF8 E;  2LUP B;  2LCE A;  1T39 A;  4M2Z A;  3ADG A;  1FJG E;  5AAS A;  2HHH E;  1A1K A;  3MHH C;  2LTR A;  2I9I A;  3LLH A;  2VF1 A;  2NUG A;  2EN6 A;  3C6M A;  2PRT A;  4DR5 E;  2RPC A;  1T4L B;  4OOG C;  3K6Q A;  2GPI A;  2BBG A;  2F4V E;  4P78 A;  2M4I A;  2KHX A;  4BCA A;  2EOQ A;  2JVA A;  2A25 A;  4K0K E;  2YTQ A;  4LF4 E;  1X6E A;  1QNT A;  4NXN E;  2L6M A;  1X48 A;  2EE8 A;  2EOS A;  2FGG A;  1ZBT A;  4JI4 E;  2D9H A;  1X6F A;  1A1G A;  4DR7 E;  4WX9 A;  2JY9 A;  2NAB A;  2H36 X;  1XMO E;  2EP3 A;  5AC5 A;  4NZV A;  2LBS B;  1XNQ E;  1WJP A;  1FKA E;  2YWQ A;  5LMN E;  2DMI A;  5AC4 A;  2DB2 A;  1DQ3 A;  2RS6 A;  3HQ1 A;  4DV3 E;  3IWC A;  3C4T A;  4M30 A;  5AE1 A;  2WBT A;  2HJJ A;  2DLK A;  3LML A;  2N3G A;  2N8X A;  2YTI A;  5A6K A;  4F9C B;  4O24 A;  2UU9 E;  1X49 A;  1EKZ A;  2EMZ A;  1GZ6 A;  2JOX A;  5KL5 A;  2EM4 A;  2YTG A;  4YY3 E;  2RTX A;  4BS9 A;  3VYX A;  3VYY A;  2DLQ A;  4I8O A;  2MC5 A;  3KZY A;  1YSA C;  1N36 E;  4JI8 E;  5LL6 R;  3BID A;  2UUA E;  2MKD A;  2CT1 A;  2WCC 3;  4GZN C;  2EOI A;  5TSE A;  2EMK A;  1T38 A;  3J80 C;  2DSY A;  2YSO A;  2LV2 A;  2B7V A;  1ZR9 A;  2UXD E;  2ADR A;  2LRS A;  1DI2 A;  2JR1 A;  4X62 E;  4B3S E;  2EPL X;  2EMH A;  5A6B D;  2LT7 A;  2YRH A;  4HTG A;  1YPN A;  2DMY A;  2EOH A;  4B3R E;  4DV4 E;  3VK6 A;  2JOB A;  2ELY A;  2DRP A;  3ZOQ B;  4DR6 E;  2EQ3 A;  2EPK X;  2GLI A;  1ZBQ A;  2YTF A;  4JI2 E;  1N33 E;  1LLM C;  3EPK A;  1IQO A;  1N34 E;  4LF7 E;  4DR2 E;  4DV6 E;  1A1L A;  1HR0 E;  1YZ9 A;  5KL2 A;  3EPL A;  1N32 E;  2EN2 A;  3THN A;  2EPX A;  4MLV A;  1A1I A;  2ODR C;  3JAM C;  4LF9 E;  2J7J A;  2L3J A;  2Q8U A;  4BHB A;  2EL4 A;  2B7T A;  2EM6 A;  1YUJ A;  2EOM A;  3HPS A;  3L00 A;  4X66 E;  2EM7 A;  1UIL A;  2LTS A;  1WXR A;  1BB8 A;  2EMB A;  2EOR A;  4DR1 E;  2NA2 A;  1WHQ A;  2EM9 A;  3JTZ A;  3JU0 A;  4DV5 E;  1UN6 B;  1STU A;  2L2N A;  3OTO E;  1X5W A;  2LUQ A;  2JWO A;  3THO B;  4R2S A;  1HNW E;  4WXD A;  1A1J A;  2ENA A;  2RSI A;  2V89 A;  4M0V A;  2EPM X;  2EMX A;  1BBG A;  3KWR A;  1L4S A;  2EMA A;  4WYQ B;  1RQ0 A;  4ZYD A;  1KJK A;  1AH5 A;  2EOF A;  4JI6 E;  1YUI A;  4LFC E;  4DR4 E;  4JI7 E;  5ADZ A;  4ZYH A;  1YYW A;  2E1M A;  2I13 A;  1IQS A;  4KZS A;  2YSP A;  4TUI A;  4R2A A;  2DGC A;  2EPO A;  2MDG A;  3ECR A;  4BC9 A;  4M9V C;  3AUZ A;  1X47 A;  2R76 A;  3H09 A;  2EN7 A;  3OML A;  2MDR A;  1WRJ A;  5A69 A;  1RC7 A;  3IWB A;  3J7A G;  2EN3 A;  4WPY A;  5KL6 A;  2ZM6 E;  2EPA A;  4IS1 C;  2YZT A;  2YTE A;  2DIX A;  2VQF E;  4GKK E;  4JI0 E;  2LJH A;  4ZYE A;  4R2P A;  2EOY A;  3MHS C;  4DV0 E;  2RSM A; 
#chains in the Genus database with same CATH homology
 2LT7 A;  2YRH A;  1A1K A;  2EOH A;  3MHH C;  4R2R A;  2EL5 A;  1TF3 A;  2ELY A;  2WBS A;  2M9A A;  2EOX A;  2DRP A;  2EN6 A;  2EOE A;  2EN8 A;  2YTJ A;  3UK3 C;  4F6M A;  2PRT A;  2YU5 A;  2EPR A;  2EQ3 A;  2RPC A;  1B69 A;  2GLI A;  2YTF A;  2EOJ A;  2EMW A;  2ENH A;  1RMD A;  1Z1B A;  1LLM C;  3EPK A;  1X3C A;  2YRM A;  2EMY A;  1UBD C;  3EPH A;  2VRD A;  4X9J A;  1A1L A;  5KL2 A;  2EML A;  3EPL A;  2EOQ A;  2BB8 A;  2EOO A;  2EN2 A;  2EOZ A;  2EPX A;  1A1I A;  2A25 A;  2JP9 A;  2JPA A;  2J7J A;  2YTQ A;  2YTN A;  1X6E A;  2EL4 A;  2EPP A;  5KL7 A;  2ELZ A;  2EM6 A;  2EOS A;  2EE8 A;  1YUJ A;  1JK1 A;  2EOM A;  1DGC A;  2D9H A;  2E72 A;  1X6F A;  1F2I G;  2EM7 A;  1A1G A;  1BB8 A;  2EMB A;  2EOR A;  4R2Q A;  2NAB A;  4R2E A;  2YRK A;  2EM0 A;  2EJ4 A;  2EM9 A;  4F6N A;  2EMC A;  1UN6 B;  1X5W A;  4R2S A;  2EN4 A;  2CSH A;  2EM8 A;  2EP3 A;  1A1H A;  1AAY A;  1A1J A;  1G2F C;  2ENA A;  3M99 B;  2EL6 A;  2RSI A;  2YTP A;  2EPZ A;  1WJP A;  4F2J C;  2EMX A;  2YTO A;  2EPU A;  4WSG A;  1P47 A;  1A1F A;  2DMI A;  2CTD A;  2EMA A;  1JK2 A;  5KL3 A;  2LO3 A;  2EQ1 A;  2WBT A;  2DLK A;  1KJK A;  1X6H A;  2YTI A;  2EOF A;  2WBU A;  5KL4 A;  2EM3 A;  2LVH A;  1YUI A;  2EMZ A;  5KL5 A;  2YU8 A;  2EM4 A;  4R2D A;  2HGH A;  2I13 A;  2YSP A;  2YTG A;  1MEY C;  4R2A A;  1TN9 A;  2DGC A;  1NCS A;  2EN1 A;  2MDG A;  2DLQ A;  1ZAA C;  4M9V C;  1YSA C;  2EMG A;  2EN7 A;  2YTD A;  2MKD A;  2GHF A;  2CT1 A;  2EMI A;  2WCC 3;  3EPJ A;  4GZN C;  2EOI A;  1TF6 A;  2MKN A;  2EN3 A;  4FK5 C;  5KL6 A;  1BBO A;  2EPC A;  2R1F A;  2EMF A;  2EPA A;  2EQ0 A;  4IS1 C;  2YTE A;  2EMK A;  4IJD A;  2YSO A;  2LV2 A;  2EM5 A;  1ZR9 A;  3VHT B;  4R2P A;  1G2D C;  2ENC A;  2ADR A;  2EM2 A;  2EOY A;  3MHS C;  2LCE A;  1ZU1 A;  4R2C A;  2EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...