2L2MA

Solution structure of the second dsrbd of hyl1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
LCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and RNA Interactions of the Plant MicroRNA Processing-Associated Protein HYL1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein, plant protein
molecule keywords Hyponastic leave 1
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l2mA00
5IWAE 1FKAE 5LMUE 4DR3E 2NUGA 1WHNA 4LFAE 2RS6A 2DMYA 3LLHA 3J7Yp 2CPNA 2NA2A 2ZM6E 4NXNE 1IBME 4DUZE 1J26A 2VQEE 1YYOA 4JI1E 2UU9E 4K0KE 1QU6A 1UHZA 1I94E 2L3JA 4NXME 3ADIA 3ADGA 4B3RE 1HNZE 2L33A 5CFFE 5BR8E 4DR5E 1STUA 4DV4E 2RS7A 3P1XA 1HR0E 4YY3E 2UXBE 1HNWE 4GKJE 4JI0E 4DV6E 4DR7E 4DUYE 1FJGE 1GQEA 2LRSA 4X64E 4LF8E 4DV5E 2JY9A 1IBLE 4KHPE 2HHHE 4LF5E 1XMQE 4LF6E 1T4OA 1ZBTA 4X65E 4JI5E 3ADLA 4YHHE 1IBKE 2L2MA 2UXCE 4DV1E 4DR1E 1T4LB 2EZ6A 1J5EE 1XNQE 1N34E 2UXDE 2RTXA 3C4TA 2RSMA 1RC7A 4LF9E 2LUQA 4JI7E 2UUAE 3C4BA 2JVAA 4M30A 2MDRA 4B3SE 4LF7E 2LUPB 1XNRE 2L2NA 2DB2A 3ADJA 2NUFA 1YYWA 4DR4E 1EKZA 3OTOE 1N36E 2LTRA 4M2ZA 4X8WA 3VYYA 3VYXA 4X62E 2E5LE 4JYAE 2L2KB 2YT4A 2F4VE 2IHR1 2LBSB 2DIXA 5LMNE 1DI2A 4B3TE 1WHQA 4JI2E 1N32E 1N33E 1X49A 3HTXA 4LFBE 4WYQB 3T1YE 2LTSA 4DV7E 1YZ9A 4JI6E 4JI8E 2N3HA 4B3ME 1X48A 2VQFE 1O0WA 1HNXE 2UUCE 4DV3E 4LF4E 2B7VA 1RQ0A 4X66E 4AQYE 1YYKA 4DV0E 4DR6E 2B7TA 1X47A 4JV5E 2N3GA 4OOGC 4OX9E 2KHXA 4WFTA 2UUBE 2L3CA 4JI4E 4JI3E 4DKKA 1XMOE 1UILA 4DR2E 4LFCE 1PKPA 2B3TB 3T1HE 4GKKE 2NUEA 2LJHA 4DV2E 1T4NA
chains in the Genus database with same CATH superfamily
3JU0A 3UK3C 4N4RB 5IWAE 4R2RA 1X6FA 2MC6A 3C6KA 1A1JA 3J7Yp 2CPNA 2EM8A 2I9IA 2NA2A 1A1FA 4F9BB 4NXNE 2EPCA 2EMLA 2EMKA 2G7HA 2L3JA 3ADIA 2EQ0A 2YTQA 3ADGA 1YUJA 2YPNA 2RPCA 4F9CB 5BR8E 5CFFE 2EOFA 2Q8UA 3K6QA 3EPJA 1BBOA 2BB8A 2ADRA 1RMDA 3HXLA 3BIDA 1IQOA 1FJGE 1YFHA 1GQEA 4ZYHA 4R2PA 5A6KA 4F6NA 1L4SA 5KL3A 1IMUA 3RMPA 1G2DC 3JTZA 2VRDA 2ENHA 3ECRA 2PRTA 3VHTB 2YTIA 1IBKE 2L2MA 2M4IA 4HTGA 4BHCA 1XNQE 2DLKA 5A6BD 2ELYA 2EN1A 1TN9A 2RSMA 1RC7A 2LUQA 3QG5C 1A1GA 4JI7E 3LMLA 4FK5C 4B3SE 1KJKA 2EMIA 2EMFA 2DB2A 1P47A 2NUFA 1N36E 4LFBE 3HPZA 2EMGA 2IHR1 2DIXA 2NABA 1DI2A 5A2QC 2EOZA 2HJJA 3EPLA 3BGHA 2JXPA 4JI2E 1N32E 5F3WA 1N33E 2EM2A 3T1YE 2L92A 2EP3A 4JI6E 3BF2A 4Q28A 4IJDA 2EQ3A 1O0WA 2FV4B 2UUCE 2EPUA 1PJQA 2YZTA 4R2CA 3EPHA 1MEYC 1WJPA 4BCAA 1DQ3A 2EE8A 2EN7A 4AQYE 4DR6E 2B7TA 2E1MA 4F9AB 2N3GA 3TQMA 1G2FC 3KZZA 1AH5A 4WFTA 2F8BA 5AE1A 2L3CA 4DMIA 1PJSA 3OMLA 2EPMX 2EM5A 4DR2E 4LFCE 1JK1A 3T1HE 1IBLE 1UBDC 1T4NA 2K4VA 4TUIA 1FKAE 4DR3E 2EPXA 1WHNA 2WCC3 2RS6A 1BBGA 2WBUA 2DMYA 3LLHA 1BB8A 5A69A 2JWOA 5KL5A 2EOOA 2EL5A 2D9HA 2ENCA 1YYOA 4LTYA 1QU6A 1I94E 3FIGA 1NCSA 2EM9A 1F2IG 2YU8A 4F54A 2EL6A 1HNZE 2LT7A 2K7IA 2L33A 1A1LA 2ENAA 5FLXC 1STUA 2RS7A 2YWQA 3HQ1A 3P1XA 5AE3A 1HR0E 4YY3E 1NEIA 4GKJE 4DV6E 4DR7E 2YTOA 4KZSA 4R2AA 3ZOQB 2LRSA 4X64E 2EPZA 2V8QB 4RHBB 1SFEA 3THOB 2HHHE 3VK6A 2VE7C 2J7JA 2EL4A 2ODRD 4WSPA 4JI5E 3EPKA 2CSHA 1YSAC 3J7AG 4GEQB 2EOYA 2EMBA 4DR1E 2EZ6A 1J5EE 2UXDE 1ZBQA 3C4TA 2EOEA 2V85A 4R8OA 2JYAA 2UUAE 1YUIA 1X5WA 2V83A 4M30A 3J80C 4J8ZA 4LF7E 5AC5A 4ZYGA 4NHRA 2EWLA 2DMIA 4M2ZA 2LJUA 1GTKA 4M0VA 2L8TA 3IWBA 5T6JA 2YT4A 4L8NA 5KL7A 3F6HA 2EPKX 2YTGA 5LMNE 2DGCA 1WHQA 2YRKA 1SR9A 1JK2A 2YTDA 4WPYA 4WSGA 2EOXA 2N3HA 3M99B 4B3ME 1PJTA 2EMCA 2EPPA 4HEIA 1EH7A 4R2EA 2HC5A 4BS9A 2EMWA 2HGHA 1YYKA 4DV0E 2EPAA 3HPSA 4JV5E 2MKNA 2EN4A 2YRMA 4JI3E 1XMOE 1TF3A 2EOSA 2EN6A 1N34E 2V89A 3KWRA 2EM6A 2YTPA 4LU9A 1WXRA 2M9AA 2NUGA 1TF6A 4LFAE 4BC7A 1WRJA 1Z1BA 4M9VC 2EOQA 3C6MA 2ZM6E 1IBME 4DUZE 2VQEE 4JI1E 4K0KE 4NXME 4B3RE 5IT9C 1X6EA 4DR5E 2WBSA 2LVHA 2EMAA 4IS1C 2JP9A 1HNWE 2EN8A 4DUYE 5LLQA 5A6JA 1GZ6A 2MDGA 4O43A 4BBYA 4DV5E 2GPIA 2JY9A 3IWCA 4R03A 5AE2A 2VF1A 4WXDA 3AV0A 2I13A 2EPLX 4LF5E 1ZU1A 1XMQE 2MKDA 4P7DA 1T4OA 1A1IA 2FGGA 2LE2A 5DNYA 4I8OA 4YHHE 2UXCE 4DV1E 5AC4A 4TUGA 4MLVA 2DSYA 2EORA 2JVAA 2MDRA 2YRHA 2LV2A 2ODRC 4P78A 4O24A 1B69A 2YSPA 2DLQA 1YYWA 2CTDA 3OTOE 3VYXA 2LTRA 2EOIA 4X8WA 5A6AA 2R76A 4X62E 3VYYA 4JYAE 2F4VE 5IXMB 1KYQA 5ADZA 4WYQB 4DV7E 4JI8E 2N8XA 1X48A 2VQFE 1HNXE 3THNA 2YSOA 2KONA 4LF4E 2EN3A 3MHSC 4O5GA 5IV8B 2YTNA 1RQ0A 1UN6B 2YU5A 2LO3A 2KOUA 4WX9A 3IWDA 3DF6A 2DRPA 2EPOA 3BBGA 2MC5A 3JAMC 4BC9A 4OX9E 2KHXA 4JI4E 2V86A 4DKKA 1UILA 1X3CA 4BMJA 5KL6A 4R2DA 2NUEA 4L5NC 2LJHA 4DV2E 2EMZA 2EM7A 2EQ1A 4NZVA 1T38A 1ZAAC 2EMHA 5LMUE 3DJWA 2WZOA 4KWYA 4GZNC 1LLMC 1DGCA 1J26A 2UU9E 2E72A 1UHZA 4O4KA 2EPNA 5AASA 2V88A 1EH6A 4DV4E 3L00A 2UXBE 4ZYEA 2V87A 2A25A 3F6GA 5KL2A 4JI0E 1EH8A 2L6MA 2R1FA 2EMYA 3MSWA 4ZYDA 3KZYA 4LF8E 2WBTA 5A6BA 2EM3A 1N3GA 2EPRA 2YTEA 1QNTA 4KHPE 2RQLA 2EM0A 2BBGA 1PDAA 4Q35B 4LF6E 1ZBTA 4X65E 3ADLA 2B9DA 1ZR9A 4WXCA 2M1SA 1T4LB 2RTXA 2H36X 2YTFA 1A1HA 4LF9E 2EOHA 3C4BA 2RSIA 1IQSA 4F6MA 2EOMA 1AAYA 2LUPB 1XNRE 2L2NA 3ADJA 5LL6R 4DR4E 1EKZA 3H09A 2GLIA 2ELZA 2E5LE 1T39A 2EM4A 2L2KB 2FTXB 4F2JC 2EMXA 4R2QA 2LBSB 2JOBA 4R2SA 4B3TE 1X6HA 2EJ4A 4RH8A 5KL4A 3AUZA 2EOJA 1X49A 3HTXA 2LTSA 1YZ9A 4MLQA 2JR1A 3J81C 4DV3E 3MHHC 2B7VA 5TSEA 4BHBA 4X66E 2LMZA 2JPAA 1X47A 2JOXA 1MGTA 4OOGC 2UUBE 2GHFA 2LCEA 4X9JA 2M7QA 1A1KA 2EN2A 1YPNA 1PKPA 2B3TB 2CT1A 4GKKE 3EQ1A 2YTJA
chains in the Genus database with same CATH topology
3JU0A 4LU9A 2K4VA 5IWAE 4TUIA 1FKAE 2MC6A 1WXRA 5LMUE 4DR3E 2NUGA 1WHNA 3DJWA 2RS6A 4LFAE 4BC7A 2WZOA 2DMYA 3LLHA 3J7Yp 2CPNA 2NA2A 4F9BB 2ZM6E 4NXNE 2JWOA 1IBME 4DUZE 1J26A 2VQEE 1YYOA 4JI1E 2UU9E 2G7HA 1QU6A 1UHZA 4LTYA 1I94E 4K0KE 3FIGA 2L3JA 4NXME 3ADIA 3ADGA 5IT9C 4F54A 3VYXA 4B3RE 1HNZE 2L33A 5AASA 4F9CB 5BR8E 5CFFE 4DR5E 5FLXC 2V88A 1STUA 4DV4E 2RS7A 3HQ1A 3K6QA 3P1XA 5AE3A 1HR0E 4YY3E 2UXBE 2V87A 1HNWE 4GKJE 3F6GA 4JI0E 2L6MA 4DV6E 3HXLA 4DUYE 4DR7E 4JYAE 4KZSA 1FJGE 3MSWA 1GZ6A 1GQEA 3ZOQB 2LRSA 4X64E 4LF8E 4BBYA 4DV5E 2JY9A 3IWCA 4R03A 2V8QB 5AE2A 2VF1A 3AV0A 1IBLE 4KHPE 2HHHE 4LF5E 3RMPA 1XMQE 3JTZA 4P7DA 4LF6E 1T4OA 3VK6A 2VE7C 1ZBTA 2ODRD 4X65E 4WSPA 4JI5E 3ADLA 2FGGA 2LE2A 5DNYA 4I8OA 2B9DA 4YHHE 1IBKE 2L2MA 2M4IA 3J7AG 4GEQB 2UXCE 2M1SA 4DV1E 4DR1E 1T4LB 2EZ6A 1J5EE 1XNQE 4TUGA 1N34E 2UXDE 2RTXA 1ZBQA 2H36X 3C4TA 2RSMA 2DSYA 2V85A 1RC7A 4LF9E 2LUQA 4R8OA 4JI7E 2UUAE 3LMLA 3C4BA 4L5NC 2JVAA 4DV2E 2V83A 4M30A 3J80C 2MDRA 4J8ZA 4B3SE 4LF7E 2ODRC 4P78A 2LUPB 1XNRE 2L2NA 2DB2A 2EWLA 3ADJA 5LL6R 2NUFA 1YYWA 1EKZA 4DR4E 3OTOE 1N36E 2LTRA 4M2ZA 4X8WA 3H09A 3VYYA 4M0VA 4X62E 2E5LE 2L8TA 3HPZA 3IWBA 5T6JA 2FTXB 2YT4A 2L2KB 2IHR1 4L8NA 2F4VE 2LBSB 2DIXA 3F6HA 5LMNE 1DI2A 2JOBA 5A2QC 4B3TE 1WHQA 1SR9A 5ADZA 4JI2E 3AUZA 1N32E 5F3WA 1X49A 3HTXA 4LFBE 1N33E 4WYQB 4WPYA 3T1YE 2LTSA 2L92A 4DV7E 4JI6E 4JI8E 1YZ9A 4Q28A 2N3HA 4B3ME 1X48A 2VQFE 1O0WA 1HNXE 2FV4B 2UUCE 2KONA 2JR1A 3J81C 4DV3E 4LF4E 2YZTA 2B7VA 1RQ0A 2KOUA 4BCAA 4BS9A 3IWDA 1DQ3A 4X66E 3DF6A 4AQYE 1YYKA 2LMZA 4DV0E 4DR6E 2B7TA 2MC5A 1X47A 2E1MA 3HPSA 3JAMC 4JV5E 2JOXA 2N3GA 4F9AB 4BC9A 4OOGC 4OX9E 2KHXA 2F8BA 4WFTA 5AE1A 2UUBE 2L3CA 4JI4E 4DMIA 4JI3E 3OMLA 2V86A 4DKKA 1XMOE 2M7QA 1UILA 4DR2E 4BMJA 4LFCE 1PKPA 2B3TB 3T1HE 4GKKE 2NUEA 2LJHA 2V89A 1T4NA 3KWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA E;  1FKA E;  5LMU E;  4DR3 E;  2NUG A;  1WHN A;  4LFA E;  2RS6 A;  2DMY A;  3LLH A;  3J7Y p;  2CPN A;  2NA2 A;  2ZM6 E;  4NXN E;  1IBM E;  4DUZ E;  1J26 A;  2VQE E;  1YYO A;  4JI1 E;  2UU9 E;  4K0K E;  1QU6 A;  1UHZ A;  1I94 E;  2L3J A;  4NXM E;  3ADI A;  3ADG A;  4B3R E;  1HNZ E;  2L33 A;  5CFF E;  5BR8 E;  4DR5 E;  1STU A;  4DV4 E;  2RS7 A;  3P1X A;  1HR0 E;  4YY3 E;  2UXB E;  1HNW E;  4GKJ E;  4JI0 E;  4DV6 E;  4DR7 E;  4DUY E;  1FJG E;  1GQE A;  2LRS A;  4X64 E;  4LF8 E;  4DV5 E;  2JY9 A;  1IBL E;  4KHP E;  2HHH E;  4LF5 E;  1XMQ E;  4LF6 E;  1T4O A;  1ZBT A;  4X65 E;  4JI5 E;  3ADL A;  4YHH E;  1IBK E;  2L2M A;  2UXC E;  4DV1 E;  4DR1 E;  1T4L B;  2EZ6 A;  1J5E E;  1XNQ E;  1N34 E;  2UXD E;  2RTX A;  3C4T A;  2RSM A;  1RC7 A;  4LF9 E;  2LUQ A;  4JI7 E;  2UUA E;  3C4B A;  2JVA A;  4M30 A;  2MDR A;  4B3S E;  4LF7 E;  2LUP B;  1XNR E;  2L2N A;  2DB2 A;  3ADJ A;  2NUF A;  1YYW A;  4DR4 E;  1EKZ A;  3OTO E;  1N36 E;  2LTR A;  4M2Z A;  4X8W A;  3VYY A;  3VYX A;  4X62 E;  2E5L E;  4JYA E;  2L2K B;  2YT4 A;  2F4V E;  2IHR 1;  2LBS B;  2DIX A;  5LMN E;  1DI2 A;  4B3T E;  1WHQ A;  4JI2 E;  1N32 E;  1N33 E;  1X49 A;  3HTX A;  4LFB E;  4WYQ B;  3T1Y E;  2LTS A;  4DV7 E;  1YZ9 A;  4JI6 E;  4JI8 E;  2N3H A;  4B3M E;  1X48 A;  2VQF E;  1O0W A;  1HNX E;  2UUC E;  4DV3 E;  4LF4 E;  2B7V A;  1RQ0 A;  4X66 E;  4AQY E;  1YYK A;  4DV0 E;  4DR6 E;  2B7T A;  1X47 A;  4JV5 E;  2N3G A;  4OOG C;  4OX9 E;  2KHX A;  4WFT A;  2UUB E;  2L3C A;  4JI4 E;  4JI3 E;  4DKK A;  1XMO E;  1UIL A;  4DR2 E;  4LFC E;  1PKP A;  2B3T B;  3T1H E;  4GKK E;  2NUE A;  2LJH A;  4DV2 E;  1T4N A; 
#chains in the Genus database with same CATH topology
 3JU0 A;  3UK3 C;  4N4R B;  5IWA E;  4R2R A;  1X6F A;  2MC6 A;  3C6K A;  1A1J A;  3J7Y p;  2CPN A;  2EM8 A;  2I9I A;  2NA2 A;  1A1F A;  4F9B B;  4NXN E;  2EPC A;  2EML A;  2EMK A;  2G7H A;  2L3J A;  3ADI A;  2EQ0 A;  2YTQ A;  3ADG A;  1YUJ A;  2YPN A;  2RPC A;  4F9C B;  5BR8 E;  5CFF E;  2EOF A;  2Q8U A;  3K6Q A;  3EPJ A;  1BBO A;  2BB8 A;  2ADR A;  1RMD A;  3HXL A;  3BID A;  1IQO A;  1FJG E;  1YFH A;  1GQE A;  4ZYH A;  4R2P A;  5A6K A;  4F6N A;  1L4S A;  5KL3 A;  1IMU A;  3RMP A;  1G2D C;  3JTZ A;  2VRD A;  2ENH A;  3ECR A;  2PRT A;  3VHT B;  2YTI A;  1IBK E;  2L2M A;  2M4I A;  4HTG A;  4BHC A;  1XNQ E;  2DLK A;  5A6B D;  2ELY A;  2EN1 A;  1TN9 A;  2RSM A;  1RC7 A;  2LUQ A;  3QG5 C;  1A1G A;  4JI7 E;  3LML A;  4FK5 C;  4B3S E;  1KJK A;  2EMI A;  2EMF A;  2DB2 A;  1P47 A;  2NUF A;  1N36 E;  4LFB E;  3HPZ A;  2EMG A;  2IHR 1;  2DIX A;  2NAB A;  1DI2 A;  5A2Q C;  2EOZ A;  2HJJ A;  3EPL A;  3BGH A;  2JXP A;  4JI2 E;  1N32 E;  5F3W A;  1N33 E;  2EM2 A;  3T1Y E;  2L92 A;  2EP3 A;  4JI6 E;  3BF2 A;  4Q28 A;  4IJD A;  2EQ3 A;  1O0W A;  2FV4 B;  2UUC E;  2EPU A;  1PJQ A;  2YZT A;  4R2C A;  3EPH A;  1MEY C;  1WJP A;  4BCA A;  1DQ3 A;  2EE8 A;  2EN7 A;  4AQY E;  4DR6 E;  2B7T A;  2E1M A;  4F9A B;  2N3G A;  3TQM A;  1G2F C;  3KZZ A;  1AH5 A;  4WFT A;  2F8B A;  5AE1 A;  2L3C A;  4DMI A;  1PJS A;  3OML A;  2EPM X;  2EM5 A;  4DR2 E;  4LFC E;  1JK1 A;  3T1H E;  1IBL E;  1UBD C;  1T4N A;  2K4V A;  4TUI A;  1FKA E;  4DR3 E;  2EPX A;  1WHN A;  2WCC 3;  2RS6 A;  1BBG A;  2WBU A;  2DMY A;  3LLH A;  1BB8 A;  5A69 A;  2JWO A;  5KL5 A;  2EOO A;  2EL5 A;  2D9H A;  2ENC A;  1YYO A;  4LTY A;  1QU6 A;  1I94 E;  3FIG A;  1NCS A;  2EM9 A;  1F2I G;  2YU8 A;  4F54 A;  2EL6 A;  1HNZ E;  2LT7 A;  2K7I A;  2L33 A;  1A1L A;  2ENA A;  5FLX C;  1STU A;  2RS7 A;  2YWQ A;  3HQ1 A;  3P1X A;  5AE3 A;  1HR0 E;  4YY3 E;  1NEI A;  4GKJ E;  4DV6 E;  4DR7 E;  2YTO A;  4KZS A;  4R2A A;  3ZOQ B;  2LRS A;  4X64 E;  2EPZ A;  2V8Q B;  4RHB B;  1SFE A;  3THO B;  2HHH E;  3VK6 A;  2VE7 C;  2J7J A;  2EL4 A;  2ODR D;  4WSP A;  4JI5 E;  3EPK A;  2CSH A;  1YSA C;  3J7A G;  4GEQ B;  2EOY A;  2EMB A;  4DR1 E;  2EZ6 A;  1J5E E;  2UXD E;  1ZBQ A;  3C4T A;  2EOE A;  2V85 A;  4R8O A;  2JYA A;  2UUA E;  1YUI A;  1X5W A;  2V83 A;  4M30 A;  3J80 C;  4J8Z A;  4LF7 E;  5AC5 A;  4ZYG A;  4NHR A;  2EWL A;  2DMI A;  4M2Z A;  2LJU A;  1GTK A;  4M0V A;  2L8T A;  3IWB A;  5T6J A;  2YT4 A;  4L8N A;  5KL7 A;  3F6H A;  2EPK X;  2YTG A;  5LMN E;  2DGC A;  1WHQ A;  2YRK A;  1SR9 A;  1JK2 A;  2YTD A;  4WPY A;  4WSG A;  2EOX A;  2N3H A;  3M99 B;  4B3M E;  1PJT A;  2EMC A;  2EPP A;  4HEI A;  1EH7 A;  4R2E A;  2HC5 A;  4BS9 A;  2EMW A;  2HGH A;  1YYK A;  4DV0 E;  2EPA A;  3HPS A;  4JV5 E;  2MKN A;  2EN4 A;  2YRM A;  4JI3 E;  1XMO E;  1TF3 A;  2EOS A;  2EN6 A;  1N34 E;  2V89 A;  3KWR A;  2EM6 A;  2YTP A;  4LU9 A;  1WXR A;  2M9A A;  2NUG A;  1TF6 A;  4LFA E;  4BC7 A;  1WRJ A;  1Z1B A;  4M9V C;  2EOQ A;  3C6M A;  2ZM6 E;  1IBM E;  4DUZ E;  2VQE E;  4JI1 E;  4K0K E;  4NXM E;  4B3R E;  5IT9 C;  1X6E A;  4DR5 E;  2WBS A;  2LVH A;  2EMA A;  4IS1 C;  2JP9 A;  1HNW E;  2EN8 A;  4DUY E;  5LLQ A;  5A6J A;  1GZ6 A;  2MDG A;  4O43 A;  4BBY A;  4DV5 E;  2GPI A;  2JY9 A;  3IWC A;  4R03 A;  5AE2 A;  2VF1 A;  4WXD A;  3AV0 A;  2I13 A;  2EPL X;  4LF5 E;  1ZU1 A;  1XMQ E;  2MKD A;  4P7D A;  1T4O A;  1A1I A;  2FGG A;  2LE2 A;  5DNY A;  4I8O A;  4YHH E;  2UXC E;  4DV1 E;  5AC4 A;  4TUG A;  4MLV A;  2DSY A;  2EOR A;  2JVA A;  2MDR A;  2YRH A;  2LV2 A;  2ODR C;  4P78 A;  4O24 A;  1B69 A;  2YSP A;  2DLQ A;  1YYW A;  2CTD A;  3OTO E;  3VYX A;  2LTR A;  2EOI A;  4X8W A;  5A6A A;  2R76 A;  4X62 E;  3VYY A;  4JYA E;  2F4V E;  5IXM B;  1KYQ A;  5ADZ A;  4WYQ B;  4DV7 E;  4JI8 E;  2N8X A;  1X48 A;  2VQF E;  1HNX E;  3THN A;  2YSO A;  2KON A;  4LF4 E;  2EN3 A;  3MHS C;  4O5G A;  5IV8 B;  2YTN A;  1RQ0 A;  1UN6 B;  2YU5 A;  2LO3 A;  2KOU A;  4WX9 A;  3IWD A;  3DF6 A;  2DRP A;  2EPO A;  3BBG A;  2MC5 A;  3JAM C;  4BC9 A;  4OX9 E;  2KHX A;  4JI4 E;  2V86 A;  4DKK A;  1UIL A;  1X3C A;  4BMJ A;  5KL6 A;  4R2D A;  2NUE A;  4L5N C;  2LJH A;  4DV2 E;  2EMZ A;  2EM7 A;  2EQ1 A;  4NZV A;  1T38 A;  1ZAA C;  2EMH A;  5LMU E;  3DJW A;  2WZO A;  4KWY A;  4GZN C;  1LLM C;  1DGC A;  1J26 A;  2UU9 E;  2E72 A;  1UHZ A;  4O4K A;  2EPN A;  5AAS A;  2V88 A;  1EH6 A;  4DV4 E;  3L00 A;  2UXB E;  4ZYE A;  2V87 A;  2A25 A;  3F6G A;  5KL2 A;  4JI0 E;  1EH8 A;  2L6M A;  2R1F A;  2EMY A;  3MSW A;  4ZYD A;  3KZY A;  4LF8 E;  2WBT A;  5A6B A;  2EM3 A;  1N3G A;  2EPR A;  2YTE A;  1QNT A;  4KHP E;  2RQL A;  2EM0 A;  2BBG A;  1PDA A;  4Q35 B;  4LF6 E;  1ZBT A;  4X65 E;  3ADL A;  2B9D A;  1ZR9 A;  4WXC A;  2M1S A;  1T4L B;  2RTX A;  2H36 X;  2YTF A;  1A1H A;  4LF9 E;  2EOH A;  3C4B A;  2RSI A;  1IQS A;  4F6M A;  2EOM A;  1AAY A;  2LUP B;  1XNR E;  2L2N A;  3ADJ A;  5LL6 R;  4DR4 E;  1EKZ A;  3H09 A;  2GLI A;  2ELZ A;  2E5L E;  1T39 A;  2EM4 A;  2L2K B;  2FTX B;  4F2J C;  2EMX A;  4R2Q A;  2LBS B;  2JOB A;  4R2S A;  4B3T E;  1X6H A;  2EJ4 A;  4RH8 A;  5KL4 A;  3AUZ A;  2EOJ A;  1X49 A;  3HTX A;  2LTS A;  1YZ9 A;  4MLQ A;  2JR1 A;  3J81 C;  4DV3 E;  3MHH C;  2B7V A;  5TSE A;  4BHB A;  4X66 E;  2LMZ A;  2JPA A;  1X47 A;  2JOX A;  1MGT A;  4OOG C;  2UUB E;  2GHF A;  2LCE A;  4X9J A;  2M7Q A;  1A1K A;  2EN2 A;  1YPN A;  1PKP A;  2B3T B;  2CT1 A;  4GKK E;  3EQ1 A;  2YTJ A; 
#chains in the Genus database with same CATH homology
 3JU0 A;  4LU9 A;  2K4V A;  5IWA E;  4TUI A;  1FKA E;  2MC6 A;  1WXR A;  5LMU E;  4DR3 E;  2NUG A;  1WHN A;  3DJW A;  2RS6 A;  4LFA E;  4BC7 A;  2WZO A;  2DMY A;  3LLH A;  3J7Y p;  2CPN A;  2NA2 A;  4F9B B;  2ZM6 E;  4NXN E;  2JWO A;  1IBM E;  4DUZ E;  1J26 A;  2VQE E;  1YYO A;  4JI1 E;  2UU9 E;  2G7H A;  1QU6 A;  1UHZ A;  4LTY A;  1I94 E;  4K0K E;  3FIG A;  2L3J A;  4NXM E;  3ADI A;  3ADG A;  5IT9 C;  4F54 A;  3VYX A;  4B3R E;  1HNZ E;  2L33 A;  5AAS A;  4F9C B;  5BR8 E;  5CFF E;  4DR5 E;  5FLX C;  2V88 A;  1STU A;  4DV4 E;  2RS7 A;  3HQ1 A;  3K6Q A;  3P1X A;  5AE3 A;  1HR0 E;  4YY3 E;  2UXB E;  2V87 A;  1HNW E;  4GKJ E;  3F6G A;  4JI0 E;  2L6M A;  4DV6 E;  3HXL A;  4DUY E;  4DR7 E;  4JYA E;  4KZS A;  1FJG E;  3MSW A;  1GZ6 A;  1GQE A;  3ZOQ B;  2LRS A;  4X64 E;  4LF8 E;  4BBY A;  4DV5 E;  2JY9 A;  3IWC A;  4R03 A;  2V8Q B;  5AE2 A;  2VF1 A;  3AV0 A;  1IBL E;  4KHP E;  2HHH E;  4LF5 E;  3RMP A;  1XMQ E;  3JTZ A;  4P7D A;  4LF6 E;  1T4O A;  3VK6 A;  2VE7 C;  1ZBT A;  2ODR D;  4X65 E;  4WSP A;  4JI5 E;  3ADL A;  2FGG A;  2LE2 A;  5DNY A;  4I8O A;  2B9D A;  4YHH E;  1IBK E;  2L2M A;  2M4I A;  3J7A G;  4GEQ B;  2UXC E;  2M1S A;  4DV1 E;  4DR1 E;  1T4L B;  2EZ6 A;  1J5E E;  1XNQ E;  4TUG A;  1N34 E;  2UXD E;  2RTX A;  1ZBQ A;  2H36 X;  3C4T A;  2RSM A;  2DSY A;  2V85 A;  1RC7 A;  4LF9 E;  2LUQ A;  4R8O A;  4JI7 E;  2UUA E;  3LML A;  3C4B A;  4L5N C;  2JVA A;  4DV2 E;  2V83 A;  4M30 A;  3J80 C;  2MDR A;  4J8Z A;  4B3S E;  4LF7 E;  2ODR C;  4P78 A;  2LUP B;  1XNR E;  2L2N A;  2DB2 A;  2EWL A;  3ADJ A;  5LL6 R;  2NUF A;  1YYW A;  1EKZ A;  4DR4 E;  3OTO E;  1N36 E;  2LTR A;  4M2Z A;  4X8W A;  3H09 A;  3VYY A;  4M0V A;  4X62 E;  2E5L E;  2L8T A;  3HPZ A;  3IWB A;  5T6J A;  2FTX B;  2YT4 A;  2L2K B;  2IHR 1;  4L8N A;  2F4V E;  2LBS B;  2DIX A;  3F6H A;  5LMN E;  1DI2 A;  2JOB A;  5A2Q C;  4B3T E;  1WHQ A;  1SR9 A;  5ADZ A;  4JI2 E;  3AUZ A;  1N32 E;  5F3W A;  1X49 A;  3HTX A;  4LFB E;  1N33 E;  4WYQ B;  4WPY A;  3T1Y E;  2LTS A;  2L92 A;  4DV7 E;  4JI6 E;  4JI8 E;  1YZ9 A;  4Q28 A;  2N3H A;  4B3M E;  1X48 A;  2VQF E;  1O0W A;  1HNX E;  2FV4 B;  2UUC E;  2KON A;  2JR1 A;  3J81 C;  4DV3 E;  4LF4 E;  2YZT A;  2B7V A;  1RQ0 A;  2KOU A;  4BCA A;  4BS9 A;  3IWD A;  1DQ3 A;  4X66 E;  3DF6 A;  4AQY E;  1YYK A;  2LMZ A;  4DV0 E;  4DR6 E;  2B7T A;  2MC5 A;  1X47 A;  2E1M A;  3HPS A;  3JAM C;  4JV5 E;  2JOX A;  2N3G A;  4F9A B;  4BC9 A;  4OOG C;  4OX9 E;  2KHX A;  2F8B A;  4WFT A;  5AE1 A;  2UUB E;  2L3C A;  4JI4 E;  4DMI A;  4JI3 E;  3OML A;  2V86 A;  4DKK A;  1XMO E;  2M7Q A;  1UIL A;  4DR2 E;  4BMJ A;  4LFC E;  1PKP A;  2B3T B;  3T1H E;  4GKK E;  2NUE A;  2LJH A;  2V89 A;  1T4N A;  3KWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...