2L2MA

Solution structure of the second dsrbd of hyl1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
LCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein, plant protein
molecule keywords Hyponastic leave 1
publication title Structure and RNA Interactions of the Plant MicroRNA Processing-Associated Protein HYL1.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l2mA00
1HR0E 4JI1E 3OTOE 1EKZA 4DUYE 1J5EE 1X47A 1QU6A 1XNQE 2LTRA 1ZBTA 1XMQE 2L2KB 4WFTA 2B7VA 4DR3E 1UHZA 5IWAE 1N32E 4B3RE 4LFBE 2UUCE 3ADIA 2RS6A 1N36E 4NXNE 4LF9E 2JY9A 1FJGE 2B7TA 1YYOA 2EZ6A 4DR5E 4KHPE 4JI3E 2YT4A 1XMOE 1HNXE 4DR4E 2DIXA 2JVAA 2L2NA 4JI4E 4X64E 2NA2A 2N3GA 2UU9E 2RSMA 2LRSA 2UXCE 1GQEA 2HHHE 2UUAE 1YYWA 1YYKA 4OOGC 4JI0E 4DV6E 1DI2A 3LLHA 1N33E 4JI5E 2N3HA 4DV1E 1YZ9A 1X48A 1UILA 5LMNE 2NUGA 4LF6E 4LFCE 1X49A 2L3CA 4GKJE 1FKAE 4DR7E 4X66E 4DR2E 2UUBE 1HNZE 4X65E 4K0KE 2DMYA 3P1XA 4JI7E 4JI2E 1WHNA 4LF5E 2LBSB 4DR1E 2RTXA 2NUFA 4DR6E 5BR8E 4JI6E 2B3TB 2L2MA 4JI8E 3ADJA 4LF7E 4YHHE 4DV3E 1T4OA 5LMUE 4YY3E 3T1YE 1PKPA 2L33A 3C4TA 2LJHA 3ADLA 4JYAE 1RQ0A 3J7Yp 2CPNA 4AQYE 3T1HE 2LTSA 4DV2E 4M2ZA 2MDRA 1HNWE 4DV7E 1T4LB 1I94E 2KHXA 2F4VE 2UXBE 3HTXA 4LF8E 2LUQA 4X8WA 2UXDE 4M30A 1O0WA 2IHR1 2ZM6E 1N34E 4DUZE 4DKKA 1STUA 1IBKE 3VYXA 1XNRE 4DV4E 2VQEE 2LUPB 2L3JA 4OX9E 1IBLE 1J26A 2NUEA 1T4NA 4LFAE 4B3ME 1RC7A 3C4BA 1WHQA 4B3SE 4B3TE 5CFFE 3VYYA 2VQFE 4NXME 4DV0E 1IBME 4DV5E 4GKKE 4JV5E 3ADGA 2E5LE 4X62E 2DB2A 4LF4E 2RS7A 4WYQB
chains in the Genus database with same CATH superfamily
1EKZA 1BB8A 2DSYA 3ZOQB 1QU6A 2EOJA 2MC6A 1QNTA 5T6JA 2L2KB 2EORA 4WSPA 2V8QB 3KWRA 1G2FC 4DR3E 2V86A 1UHZA 2EE8A 2FTXB 4R2CA 2JXPA 4L5NC 1T39A 2EN7A 2HGHA 2JY9A 2N8XA 1FJGE 4WX9A 4IS1C 4DR5E 2YT4A 1ZR9A 3J81C 2JVAA 2L2NA 4RHBB 4X64E 2CSHA 3QG5C 4O43A 5KL5A 1YYWA 1DI2A 2EQ0A 1A1HA 1ZBQA 4KWYA 1YZ9A 1X48A 4P78A 2YZTA 2NUGA 4LFCE 4GKJE 1N3GA 2V85A 5A6BA 1ZU1A 2UUBE 1HNZE 2DMYA 4F6NA 2F8BA 4JI2E 2YTDA 2YU5A 3KZYA 1YSAC 2RTXA 3ADJA 5TSEA 1JK2A 4WXDA 1T4OA 2HC5A 2BBGA 2YTOA 2EOOA 1PKPA 2LV2A 2EN4A 2M9AA 4BBYA 4NZVA 2K4VA 3HPZA 2YPNA 4AQYE 1IQSA 2BB8A 2J7JA 2YTEA 4M2ZA 3BBGA 4F9BB 2F4VE 2DMIA 2UXBE 5LLQA 2EM0A 1BBOA 2RPCA 2EN8A 4M30A 3KZZA 2ENAA 1N34E 2WBTA 4BHCA 1IBKE 1X5WA 2GPIA 4R8OA 2VQEE 2DGCA 2L3JA 3UK3C 2NUEA 4LFAE 3AUZA 2MKDA 3VHTB 1SFEA 3C4BA 1UBDC 2EPMX 4DMIA 1IBME 2EOFA 4JV5E 1IQOA 3ADGA 3BF2A 2DB2A 2RS7A 4X9JA 3DF6A 4DUYE 1X47A 1ZBTA 2EMHA 2EMYA 3JTZA 2YWQA 2YTJA 2B7VA 1SR9A 2EOHA 3THOB 2EQ1A 4LFBE 2FGGA 3MHSC 4Q35B 5A6AA 4NXNE 2EPNA 1AH5A 5KL2A 3EPKA 2YSPA 2B7TA 3MHHC 1YYOA 3F6HA 4JI3E 4WXCA 1HNXE 2EMFA 1PJSA 2ADRA 2EWLA 2LRSA 1GQEA 3M99B 2HHHE 1A1GA 2EPUA 2LE2A 4TUIA 1YYKA 2EMAA 2YTNA 2M7QA 4DV6E 2JP9A 4TUGA 1X6EA 4WPYA 2ELZA 2N3HA 1UILA 1YPNA 2CTDA 4O4KA 5LMNE 1Z1BA 2EOQA 3EPHA 5IXMB 4X66E 4BHBA 2EPRA 2JOXA 2EL5A 1JK1A 1WHNA 4N4RB 2JPAA 3DJWA 4WSGA 1WXRA 1X6FA 2EM6A 1LLMC 5BR8E 4ZYDA 4JI6E 2L2MA 4LF7E 4YHHE 5LMUE 4YY3E 3C6MA 2JWOA 1T38A 4F54A 3J7Yp 2LTSA 2EL6A 3TQMA 2MDRA 1X3CA 1T4LB 1A1JA 2EMIA 2EN1A 2EOMA 4F2JC 2EPLX 4BMJA 4KZSA 2WBUA 1B69A 1EH7A 2R1FA 2EOIA 5KL4A 1X6HA 4DKKA 1STUA 3VYXA 1A1IA 5KL7A 3K6QA 4BS9A 3EQ1A 3BIDA 2K7IA 3HQ1A 4FK5C 2EOZA 5AE3A 5LL6R 4DV0E 5AC5A 4GKKE 1PJTA 2VE7C 5AASA 2RQLA 1EH8A 4R2AA 2WBSA 4RH8A 3HPSA 4JI1E 3OTOE 4R2SA 5DNYA 1TF3A 4L8NA 2YRKA 2EM2A 1XNQE 2LTRA 5IV8B 2EN2A 1BBGA 5IT9C 5IWAE 4B3RE 2Q8UA 2LO3A 2EOXA 2RS6A 2UUCE 2V87A 1N36E 4ZYGA 2VRDA 2L92A 2EZ6A 2LMZA 3IWCA 4R03A 1NCSA 2YTFA 1XMOE 2YTIA 4DR4E 4JI4E 2N3GA 2NA2A 2UXCE 2RSMA 1TF6A 5AE2A 3MSWA 3THNA 3J80C 1ZAAC 4JI0E 3LLHA 1WRJA 4LF6E 1X49A 2RSIA 2EMZA 2YTPA 1FKAE 2EPZA 1KJKA 4DR2E 3RMPA 2LJUA 2EL4A 4X65E 4K0KE 2DRPA 1MGTA 2ENCA 2NABA 4IJDA 4M0VA 4JI7E 2GLIA 2D9HA 4LF5E 4NHRA 5KL6A 1DGCA 2V89A 5AE1A 1EH6A 4BCAA 2B3TB 4JI8E 4R2DA 2EOEA 2EN6A 1NEIA 3T1YE 2L33A 3C4TA 2LJHA 3ADLA 2I13A 1P47A 2EMLA 2CPNA 3T1HE 3ECRA 2H36X 2YTQA 2G7HA 4DV7E 4GZNC 1HNWE 2ENHA 1I94E 2KHXA 2MKNA 1G2DC 2B9DA 2DLKA 3HTXA 2EM5A 2KOUA 4LF8E 3IWDA 4X8WA 1L4SA 3F6GA 2UXDE 2E1MA 2YRHA 4F9AB 2EPOA 2IHR1 4DUZE 3JAMC 1XNRE 2ELYA 4OX9E 2LUPB 1TN9A 2EOYA 2JOBA 2EMKA 1IBLE 2EJ4A 1A1LA 2EPCA 4J8ZA 2LVHA 2ODRC 1RC7A 2EP3A 1WJPA 4BC7A 5FLXC 4B3SE 2M1SA 4R2PA 2L6MA 5KL3A 2EN3A 4DV5E 3EPJA 2YSOA 2EMGA 1MEYC 4LF4E 2WZOA 2EMBA 2DLQA 2FV4B 1HR0E 4R2RA 2VF1A 4MLQA 2I9IA 1PJQA 1J5EE 1YUJA 1A1FA 1RMDA 2GHFA 2EPKX 1XMQE 4WFTA 4P7DA 2EM8A 1F2IG 1N32E 2JYAA 4LU9A 2YRMA 3ADIA 2EPXA 4F6MA 4LF9E 4KHPE 1YFHA 1GTKA 4BC9A 3FIGA 2DIXA 2MDGA 2PRTA 2UU9E 3J7AG 2UUAE 4M9VC 1DQ3A 4OOGC 2EQ3A 1N33E 4JI5E 4DV1E 2JR1A 3AV0A 3BGHA 1IMUA 5A6KA 4LTYA 5A6JA 3C6KA 2YTGA 2L3CA 2KONA 4DR7E 3VK6A 2E72A 5A69A 1PDAA 2EMCA 3P1XA 4MLVA 4Q28A 2LBSB 4HEIA 1YUIA 2EM4A 4DR1E 2EM9A 2NUFA 2LCEA 4DR6E 2YU8A 2ODRD 1KYQA 4DV3E 4F9CB 3LMLA 5AC4A 4JYAE 4I8OA 3EPLA 1GZ6A 1RQ0A 2EPAA 2EPPA 1A1KA 4DV2E 2EOSA 2EM7A 3IWBA 2CT1A 2V83A 4R2QA 2HJJA 4ZYEA 4R2EA 3OMLA 2LUQA 3H09A 5ADZA 2LT7A 1O0WA 2ZM6E 4O5GA 5F3WA 2V88A 4DV4E 1J26A 4ZYHA 1T4NA 4B3ME 2M4IA 4O24A 1WHQA 2EM3A 5A6BD 4B3TE 5CFFE 4HTGA 3VYYA 2VQFE 4NXME 2A25A 2R76A 1UN6B 2EMWA 2WCC3 3JU0A 1AAYA 4GEQB 2E5LE 5A2QC 2EMXA 2MC5A 3HXLA 3L00A 4X62E 2L8TA 4WYQB
chains in the Genus database with same CATH topology
2FV4B 1HR0E 4JI1E 2VF1A 3DF6A 3OTOE 4DUYE 5DNYA 1EKZA 2DSYA 1X47A 4L8NA 1QU6A 3ZOQB 1J5EE 1XNQE 2LTRA 1ZBTA 2MC6A 3JTZA 1XMQE 5T6JA 2L2KB 4WSPA 4WFTA 2B7VA 1SR9A 2V8QB 3KWRA 4P7DA 2V86A 1UHZA 5IWAE 4DR3E 5IT9C 1N32E 4B3RE 2FTXB 4LU9A 4LFBE 2UUCE 2FGGA 2RS6A 3ADIA 2V87A 1N36E 4NXNE 4LF9E 4L5NC 2L92A 2JY9A 1FJGE 2B7TA 1YYOA 2EZ6A 4DR5E 4KHPE 3F6HA 2LMZA 2YT4A 3IWCA 4R03A 4JI3E 1XMOE 1HNXE 3J81C 4BC9A 3FIGA 2DIXA 2JVAA 2L2NA 4JI4E 4DR4E 4X64E 2N3GA 2NA2A 2EWLA 2RSMA 2LRSA 2UU9E 2UXCE 1GQEA 2HHHE 3J7AG 5AE2A 2UUAE 1YYWA 1DQ3A 2LE2A 3MSWA 4TUIA 1YYKA 4OOGC 2M7QA 3J80C 4DV6E 3LLHA 4TUGA 4WPYA 1ZBQA 4JI0E 1DI2A 1N33E 4JI5E 2N3HA 4DV1E 2JR1A 1X48A 1UILA 3AV0A 1YZ9A 4P78A 2YZTA 4LTYA 5LMNE 4LF6E 4LFCE 2NUGA 1X49A 2L3CA 4GKJE 2KONA 1FKAE 4DR7E 2V85A 3VK6A 4X66E 4DR2E 2UUBE 3RMPA 1HNZE 2JOXA 4X65E 4K0KE 2DMYA 3P1XA 4M0VA 2F8BA 4JI7E 4JI2E 1WHNA 4Q28A 3DJWA 2LBSB 4LF5E 1WXRA 4DR1E 2RTXA 2NUFA 2V89A 5AE1A 4DR6E 5BR8E 4BCAA 4JI6E 2B3TB 2L2MA 4JI8E 3ADJA 4LF7E 4YHHE 2ODRD 1T4OA 4DV3E 5LMUE 4YY3E 3T1YE 4F9CB 3LMLA 1PKPA 2L33A 3C4TA 2LJHA 2JWOA 3ADLA 4I8OA 4BBYA 4JYAE 2K4VA 3HPZA 4F54A 1GZ6A 1RQ0A 3J7Yp 2CPNA 4AQYE 3T1HE 2LTSA 4DV2E 4M2ZA 2H36X 2MDRA 1HNWE 2G7HA 4DV7E 1T4LB 4F9BB 1I94E 2KHXA 3IWBA 2F4VE 2V83A 2UXBE 2B9DA 3HTXA 3OMLA 2KOUA 4LF8E 2LUQA 4BMJA 3IWDA 4KZSA 4X8WA 3F6GA 3H09A 5ADZA 2UXDE 2E1MA 4M30A 4F9AB 1O0WA 2IHR1 2ZM6E 1N34E 4DUZE 4DKKA 1STUA 3JAMC 5F3WA 1IBKE 2V88A 1XNRE 3VYXA 4R8OA 4DV4E 2VQEE 2LUPB 2L3JA 3K6QA 2JOBA 1IBLE 4BS9A 4OX9E 1J26A 2NUEA 1T4NA 4LFAE 3AUZA 4J8ZA 4B3ME 2M4IA 2ODRC 3C4BA 1WHQA 1RC7A 4BC7A 5FLXC 4B3SE 4B3TE 5CFFE 3HQ1A 3VYYA 2M1SA 2VQFE 4NXME 2L6MA 5AE3A 4DMIA 5LL6R 4DV0E 4DV5E 1IBME 3JU0A 4GKKE 2VE7C 4JV5E 3ADGA 5AASA 4GEQB 2E5LE 5A2QC 2MC5A 3HXLA 4X62E 2DB2A 2L8TA 2RS7A 4LF4E 2WZOA 4WYQB 3HPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 E;  4JI1 E;  3OTO E;  1EKZ A;  4DUY E;  1J5E E;  1X47 A;  1QU6 A;  1XNQ E;  2LTR A;  1ZBT A;  1XMQ E;  2L2K B;  4WFT A;  2B7V A;  4DR3 E;  1UHZ A;  5IWA E;  1N32 E;  4B3R E;  4LFB E;  2UUC E;  3ADI A;  2RS6 A;  1N36 E;  4NXN E;  4LF9 E;  2JY9 A;  1FJG E;  2B7T A;  1YYO A;  2EZ6 A;  4DR5 E;  4KHP E;  4JI3 E;  2YT4 A;  1XMO E;  1HNX E;  4DR4 E;  2DIX A;  2JVA A;  2L2N A;  4JI4 E;  4X64 E;  2NA2 A;  2N3G A;  2UU9 E;  2RSM A;  2LRS A;  2UXC E;  1GQE A;  2HHH E;  2UUA E;  1YYW A;  1YYK A;  4OOG C;  4JI0 E;  4DV6 E;  1DI2 A;  3LLH A;  1N33 E;  4JI5 E;  2N3H A;  4DV1 E;  1YZ9 A;  1X48 A;  1UIL A;  5LMN E;  2NUG A;  4LF6 E;  4LFC E;  1X49 A;  2L3C A;  4GKJ E;  1FKA E;  4DR7 E;  4X66 E;  4DR2 E;  2UUB E;  1HNZ E;  4X65 E;  4K0K E;  2DMY A;  3P1X A;  4JI7 E;  4JI2 E;  1WHN A;  4LF5 E;  2LBS B;  4DR1 E;  2RTX A;  2NUF A;  4DR6 E;  5BR8 E;  4JI6 E;  2B3T B;  2L2M A;  4JI8 E;  3ADJ A;  4LF7 E;  4YHH E;  4DV3 E;  1T4O A;  5LMU E;  4YY3 E;  3T1Y E;  1PKP A;  2L33 A;  3C4T A;  2LJH A;  3ADL A;  4JYA E;  1RQ0 A;  3J7Y p;  2CPN A;  4AQY E;  3T1H E;  2LTS A;  4DV2 E;  4M2Z A;  2MDR A;  1HNW E;  4DV7 E;  1T4L B;  1I94 E;  2KHX A;  2F4V E;  2UXB E;  3HTX A;  4LF8 E;  2LUQ A;  4X8W A;  2UXD E;  4M30 A;  1O0W A;  2IHR 1;  2ZM6 E;  1N34 E;  4DUZ E;  4DKK A;  1STU A;  1IBK E;  3VYX A;  1XNR E;  4DV4 E;  2VQE E;  2LUP B;  2L3J A;  4OX9 E;  1IBL E;  1J26 A;  2NUE A;  1T4N A;  4LFA E;  4B3M E;  1RC7 A;  3C4B A;  1WHQ A;  4B3S E;  4B3T E;  5CFF E;  3VYY A;  2VQF E;  4NXM E;  4DV0 E;  1IBM E;  4DV5 E;  4GKK E;  4JV5 E;  3ADG A;  2E5L E;  4X62 E;  2DB2 A;  4LF4 E;  2RS7 A;  4WYQ B; 
#chains in the Genus database with same CATH topology
 1EKZ A;  1BB8 A;  2DSY A;  3ZOQ B;  1QU6 A;  2EOJ A;  2MC6 A;  1QNT A;  5T6J A;  2L2K B;  2EOR A;  4WSP A;  2V8Q B;  3KWR A;  1G2F C;  4DR3 E;  2V86 A;  1UHZ A;  2EE8 A;  2FTX B;  4R2C A;  2JXP A;  4L5N C;  1T39 A;  2EN7 A;  2HGH A;  2JY9 A;  2N8X A;  1FJG E;  4WX9 A;  4IS1 C;  4DR5 E;  2YT4 A;  1ZR9 A;  3J81 C;  2JVA A;  2L2N A;  4RHB B;  4X64 E;  2CSH A;  3QG5 C;  4O43 A;  5KL5 A;  1YYW A;  1DI2 A;  2EQ0 A;  1A1H A;  1ZBQ A;  4KWY A;  1YZ9 A;  1X48 A;  4P78 A;  2YZT A;  2NUG A;  4LFC E;  4GKJ E;  1N3G A;  2V85 A;  5A6B A;  1ZU1 A;  2UUB E;  1HNZ E;  2DMY A;  4F6N A;  2F8B A;  4JI2 E;  2YTD A;  2YU5 A;  3KZY A;  1YSA C;  2RTX A;  3ADJ A;  5TSE A;  1JK2 A;  4WXD A;  1T4O A;  2HC5 A;  2BBG A;  2YTO A;  2EOO A;  1PKP A;  2LV2 A;  2EN4 A;  2M9A A;  4BBY A;  4NZV A;  2K4V A;  3HPZ A;  2YPN A;  4AQY E;  1IQS A;  2BB8 A;  2J7J A;  2YTE A;  4M2Z A;  3BBG A;  4F9B B;  2F4V E;  2DMI A;  2UXB E;  5LLQ A;  2EM0 A;  1BBO A;  2RPC A;  2EN8 A;  4M30 A;  3KZZ A;  2ENA A;  1N34 E;  2WBT A;  4BHC A;  1IBK E;  1X5W A;  2GPI A;  4R8O A;  2VQE E;  2DGC A;  2L3J A;  3UK3 C;  2NUE A;  4LFA E;  3AUZ A;  2MKD A;  3VHT B;  1SFE A;  3C4B A;  1UBD C;  2EPM X;  4DMI A;  1IBM E;  2EOF A;  4JV5 E;  1IQO A;  3ADG A;  3BF2 A;  2DB2 A;  2RS7 A;  4X9J A;  3DF6 A;  4DUY E;  1X47 A;  1ZBT A;  2EMH A;  2EMY A;  3JTZ A;  2YWQ A;  2YTJ A;  2B7V A;  1SR9 A;  2EOH A;  3THO B;  2EQ1 A;  4LFB E;  2FGG A;  3MHS C;  4Q35 B;  5A6A A;  4NXN E;  2EPN A;  1AH5 A;  5KL2 A;  3EPK A;  2YSP A;  2B7T A;  3MHH C;  1YYO A;  3F6H A;  4JI3 E;  4WXC A;  1HNX E;  2EMF A;  1PJS A;  2ADR A;  2EWL A;  2LRS A;  1GQE A;  3M99 B;  2HHH E;  1A1G A;  2EPU A;  2LE2 A;  4TUI A;  1YYK A;  2EMA A;  2YTN A;  2M7Q A;  4DV6 E;  2JP9 A;  4TUG A;  1X6E A;  4WPY A;  2ELZ A;  2N3H A;  1UIL A;  1YPN A;  2CTD A;  4O4K A;  5LMN E;  1Z1B A;  2EOQ A;  3EPH A;  5IXM B;  4X66 E;  4BHB A;  2EPR A;  2JOX A;  2EL5 A;  1JK1 A;  1WHN A;  4N4R B;  2JPA A;  3DJW A;  4WSG A;  1WXR A;  1X6F A;  2EM6 A;  1LLM C;  5BR8 E;  4ZYD A;  4JI6 E;  2L2M A;  4LF7 E;  4YHH E;  5LMU E;  4YY3 E;  3C6M A;  2JWO A;  1T38 A;  4F54 A;  3J7Y p;  2LTS A;  2EL6 A;  3TQM A;  2MDR A;  1X3C A;  1T4L B;  1A1J A;  2EMI A;  2EN1 A;  2EOM A;  4F2J C;  2EPL X;  4BMJ A;  4KZS A;  2WBU A;  1B69 A;  1EH7 A;  2R1F A;  2EOI A;  5KL4 A;  1X6H A;  4DKK A;  1STU A;  3VYX A;  1A1I A;  5KL7 A;  3K6Q A;  4BS9 A;  3EQ1 A;  3BID A;  2K7I A;  3HQ1 A;  4FK5 C;  2EOZ A;  5AE3 A;  5LL6 R;  4DV0 E;  5AC5 A;  4GKK E;  1PJT A;  2VE7 C;  5AAS A;  2RQL A;  1EH8 A;  4R2A A;  2WBS A;  4RH8 A;  3HPS A;  4JI1 E;  3OTO E;  4R2S A;  5DNY A;  1TF3 A;  4L8N A;  2YRK A;  2EM2 A;  1XNQ E;  2LTR A;  5IV8 B;  2EN2 A;  1BBG A;  5IT9 C;  5IWA E;  4B3R E;  2Q8U A;  2LO3 A;  2EOX A;  2RS6 A;  2UUC E;  2V87 A;  1N36 E;  4ZYG A;  2VRD A;  2L92 A;  2EZ6 A;  2LMZ A;  3IWC A;  4R03 A;  1NCS A;  2YTF A;  1XMO E;  2YTI A;  4DR4 E;  4JI4 E;  2N3G A;  2NA2 A;  2UXC E;  2RSM A;  1TF6 A;  5AE2 A;  3MSW A;  3THN A;  3J80 C;  1ZAA C;  4JI0 E;  3LLH A;  1WRJ A;  4LF6 E;  1X49 A;  2RSI A;  2EMZ A;  2YTP A;  1FKA E;  2EPZ A;  1KJK A;  4DR2 E;  3RMP A;  2LJU A;  2EL4 A;  4X65 E;  4K0K E;  2DRP A;  1MGT A;  2ENC A;  2NAB A;  4IJD A;  4M0V A;  4JI7 E;  2GLI A;  2D9H A;  4LF5 E;  4NHR A;  5KL6 A;  1DGC A;  2V89 A;  5AE1 A;  1EH6 A;  4BCA A;  2B3T B;  4JI8 E;  4R2D A;  2EOE A;  2EN6 A;  1NEI A;  3T1Y E;  2L33 A;  3C4T A;  2LJH A;  3ADL A;  2I13 A;  1P47 A;  2EML A;  2CPN A;  3T1H E;  3ECR A;  2H36 X;  2YTQ A;  2G7H A;  4DV7 E;  4GZN C;  1HNW E;  2ENH A;  1I94 E;  2KHX A;  2MKN A;  1G2D C;  2B9D A;  2DLK A;  3HTX A;  2EM5 A;  2KOU A;  4LF8 E;  3IWD A;  4X8W A;  1L4S A;  3F6G A;  2UXD E;  2E1M A;  2YRH A;  4F9A B;  2EPO A;  2IHR 1;  4DUZ E;  3JAM C;  1XNR E;  2ELY A;  4OX9 E;  2LUP B;  1TN9 A;  2EOY A;  2JOB A;  2EMK A;  1IBL E;  2EJ4 A;  1A1L A;  2EPC A;  4J8Z A;  2LVH A;  2ODR C;  1RC7 A;  2EP3 A;  1WJP A;  4BC7 A;  5FLX C;  4B3S E;  2M1S A;  4R2P A;  2L6M A;  5KL3 A;  2EN3 A;  4DV5 E;  3EPJ A;  2YSO A;  2EMG A;  1MEY C;  4LF4 E;  2WZO A;  2EMB A;  2DLQ A;  2FV4 B;  1HR0 E;  4R2R A;  2VF1 A;  4MLQ A;  2I9I A;  1PJQ A;  1J5E E;  1YUJ A;  1A1F A;  1RMD A;  2GHF A;  2EPK X;  1XMQ E;  4WFT A;  4P7D A;  2EM8 A;  1F2I G;  1N32 E;  2JYA A;  4LU9 A;  2YRM A;  3ADI A;  2EPX A;  4F6M A;  4LF9 E;  4KHP E;  1YFH A;  1GTK A;  4BC9 A;  3FIG A;  2DIX A;  2MDG A;  2PRT A;  2UU9 E;  3J7A G;  2UUA E;  4M9V C;  1DQ3 A;  4OOG C;  2EQ3 A;  1N33 E;  4JI5 E;  4DV1 E;  2JR1 A;  3AV0 A;  3BGH A;  1IMU A;  5A6K A;  4LTY A;  5A6J A;  3C6K A;  2YTG A;  2L3C A;  2KON A;  4DR7 E;  3VK6 A;  2E72 A;  5A69 A;  1PDA A;  2EMC A;  3P1X A;  4MLV A;  4Q28 A;  2LBS B;  4HEI A;  1YUI A;  2EM4 A;  4DR1 E;  2EM9 A;  2NUF A;  2LCE A;  4DR6 E;  2YU8 A;  2ODR D;  1KYQ A;  4DV3 E;  4F9C B;  3LML A;  5AC4 A;  4JYA E;  4I8O A;  3EPL A;  1GZ6 A;  1RQ0 A;  2EPA A;  2EPP A;  1A1K A;  4DV2 E;  2EOS A;  2EM7 A;  3IWB A;  2CT1 A;  2V83 A;  4R2Q A;  2HJJ A;  4ZYE A;  4R2E A;  3OML A;  2LUQ A;  3H09 A;  5ADZ A;  2LT7 A;  1O0W A;  2ZM6 E;  4O5G A;  5F3W A;  2V88 A;  4DV4 E;  1J26 A;  4ZYH A;  1T4N A;  4B3M E;  2M4I A;  4O24 A;  1WHQ A;  2EM3 A;  5A6B D;  4B3T E;  5CFF E;  4HTG A;  3VYY A;  2VQF E;  4NXM E;  2A25 A;  2R76 A;  1UN6 B;  2EMW A;  2WCC 3;  3JU0 A;  1AAY A;  4GEQ B;  2E5L E;  5A2Q C;  2EMX A;  2MC5 A;  3HXL A;  3L00 A;  4X62 E;  2L8T A;  4WYQ B; 
#chains in the Genus database with same CATH homology
 2FV4 B;  1HR0 E;  4JI1 E;  2VF1 A;  3DF6 A;  3OTO E;  4DUY E;  5DNY A;  1EKZ A;  2DSY A;  1X47 A;  4L8N A;  1QU6 A;  3ZOQ B;  1J5E E;  1XNQ E;  2LTR A;  1ZBT A;  2MC6 A;  3JTZ A;  1XMQ E;  5T6J A;  2L2K B;  4WSP A;  4WFT A;  2B7V A;  1SR9 A;  2V8Q B;  3KWR A;  4P7D A;  2V86 A;  1UHZ A;  5IWA E;  4DR3 E;  5IT9 C;  1N32 E;  4B3R E;  2FTX B;  4LU9 A;  4LFB E;  2UUC E;  2FGG A;  2RS6 A;  3ADI A;  2V87 A;  1N36 E;  4NXN E;  4LF9 E;  4L5N C;  2L92 A;  2JY9 A;  1FJG E;  2B7T A;  1YYO A;  2EZ6 A;  4DR5 E;  4KHP E;  3F6H A;  2LMZ A;  2YT4 A;  3IWC A;  4R03 A;  4JI3 E;  1XMO E;  1HNX E;  3J81 C;  4BC9 A;  3FIG A;  2DIX A;  2JVA A;  2L2N A;  4JI4 E;  4DR4 E;  4X64 E;  2N3G A;  2NA2 A;  2EWL A;  2RSM A;  2LRS A;  2UU9 E;  2UXC E;  1GQE A;  2HHH E;  3J7A G;  5AE2 A;  2UUA E;  1YYW A;  1DQ3 A;  2LE2 A;  3MSW A;  4TUI A;  1YYK A;  4OOG C;  2M7Q A;  3J80 C;  4DV6 E;  3LLH A;  4TUG A;  4WPY A;  1ZBQ A;  4JI0 E;  1DI2 A;  1N33 E;  4JI5 E;  2N3H A;  4DV1 E;  2JR1 A;  1X48 A;  1UIL A;  3AV0 A;  1YZ9 A;  4P78 A;  2YZT A;  4LTY A;  5LMN E;  4LF6 E;  4LFC E;  2NUG A;  1X49 A;  2L3C A;  4GKJ E;  2KON A;  1FKA E;  4DR7 E;  2V85 A;  3VK6 A;  4X66 E;  4DR2 E;  2UUB E;  3RMP A;  1HNZ E;  2JOX A;  4X65 E;  4K0K E;  2DMY A;  3P1X A;  4M0V A;  2F8B A;  4JI7 E;  4JI2 E;  1WHN A;  4Q28 A;  3DJW A;  2LBS B;  4LF5 E;  1WXR A;  4DR1 E;  2RTX A;  2NUF A;  2V89 A;  5AE1 A;  4DR6 E;  5BR8 E;  4BCA A;  4JI6 E;  2B3T B;  2L2M A;  4JI8 E;  3ADJ A;  4LF7 E;  4YHH E;  2ODR D;  1T4O A;  4DV3 E;  5LMU E;  4YY3 E;  3T1Y E;  4F9C B;  3LML A;  1PKP A;  2L33 A;  3C4T A;  2LJH A;  2JWO A;  3ADL A;  4I8O A;  4BBY A;  4JYA E;  2K4V A;  3HPZ A;  4F54 A;  1GZ6 A;  1RQ0 A;  3J7Y p;  2CPN A;  4AQY E;  3T1H E;  2LTS A;  4DV2 E;  4M2Z A;  2H36 X;  2MDR A;  1HNW E;  2G7H A;  4DV7 E;  1T4L B;  4F9B B;  1I94 E;  2KHX A;  3IWB A;  2F4V E;  2V83 A;  2UXB E;  2B9D A;  3HTX A;  3OML A;  2KOU A;  4LF8 E;  2LUQ A;  4BMJ A;  3IWD A;  4KZS A;  4X8W A;  3F6G A;  3H09 A;  5ADZ A;  2UXD E;  2E1M A;  4M30 A;  4F9A B;  1O0W A;  2IHR 1;  2ZM6 E;  1N34 E;  4DUZ E;  4DKK A;  1STU A;  3JAM C;  5F3W A;  1IBK E;  2V88 A;  1XNR E;  3VYX A;  4R8O A;  4DV4 E;  2VQE E;  2LUP B;  2L3J A;  3K6Q A;  2JOB A;  1IBL E;  4BS9 A;  4OX9 E;  1J26 A;  2NUE A;  1T4N A;  4LFA E;  3AUZ A;  4J8Z A;  4B3M E;  2M4I A;  2ODR C;  3C4B A;  1WHQ A;  1RC7 A;  4BC7 A;  5FLX C;  4B3S E;  4B3T E;  5CFF E;  3HQ1 A;  3VYY A;  2M1S A;  2VQF E;  4NXM E;  2L6M A;  5AE3 A;  4DMI A;  5LL6 R;  4DV0 E;  4DV5 E;  1IBM E;  3JU0 A;  4GKK E;  2VE7 C;  4JV5 E;  3ADG A;  5AAS A;  4GEQ B;  2E5L E;  5A2Q C;  2MC5 A;  3HXL A;  4X62 E;  2DB2 A;  2L8T A;  2RS7 A;  4LF4 E;  2WZO A;  4WYQ B;  3HPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...