2L2MA

Solution structure of the second dsrbd of hyl1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
LCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and RNA Interactions of the Plant MicroRNA Processing-Associated Protein HYL1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein, plant protein
molecule keywords Hyponastic leave 1
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l2mA00
1J26A 5CFFE 2UXDE 4K0KE 1HNZE 2LTRA 2NUGA 1N33E 2UUBE 4DV7E 1DI2A 2N3GA 1XNQE 4LF9E 1YZ9A 1N36E 4LF8E 1XNRE 3VYYA 2L2KB 2LJHA 4LFAE 2B7VA 1WHQA 2VQFE 2RS6A 4JI0E 2EZ6A 3HTXA 4DV2E 3LLHA 4X8WA 2B7TA 1X49A 1RQ0A 1T4LB 2NUEA 3OTOE 3ADLA 1XMOE 2UUCE 4LFCE 4AQYE 2MDRA 1UHZA 1XMQE 4JI2E 4DR1E 5IWAE 4DV5E 4JI5E 3VYXA 5BR8E 1J5EE 4B3ME 2F4VE 4DKKA 4NXNE 1N32E 3ADGA 3ADIA 1O0WA 2RTXA 1X47A 4X65E 5LMNE 2L3CA 1IBLE 1FKAE 4JV5E 4JI4E 2UXCE 4JI8E 1QU6A 2NA2A 1HNXE 4LFBE 1UILA 2UUAE 2LBSB 4B3SE 4DR2E 2LRSA 1PKPA 3T1YE 4DR5E 2L3JA 2LUPB 2VQEE 4WYQB 1GQEA 4DR4E 4OOGC 3J7Yp 2B3TB 2DB2A 2L33A 2YT4A 3C4TA 4LF4E 4X62E 1HR0E 4B3TE 4YY3E 4LF5E 4KHPE 4DV3E 2KHXA 2LTSA 1STUA 2JY9A 4JYAE 4WFTA 1RC7A 2HHHE 1WHNA 4YHHE 2L2MA 2UXBE 4M30A 3ADJA 1T4OA 3C4BA 3T1HE 2NUFA 4DR6E 1YYWA 2UU9E 4DR3E 2IHR1 4DV0E 1T4NA 4JI7E 4DUYE 4X64E 2RSMA 4DV1E 1IBME 4JI3E 2ZM6E 2E5LE 4LF6E 2L2NA 1N34E 2N3HA 4B3RE 4NXME 4DR7E 1YYKA 2DIXA 1ZBTA 4GKKE 5LMUE 4DV4E 4M2ZA 1FJGE 4JI1E 2LUQA 2CPNA 1EKZA 4DUZE 3P1XA 4OX9E 2RS7A 2JVAA 1X48A 4LF7E 1HNWE 4DV6E 1IBKE 4JI6E 1YYOA 4GKJE 2DMYA 1I94E 4X66E
chains in the Genus database with same CATH superfamily
4NZVA 2ENAA 1SFEA 3VHTB 3MSWA 1B69A 2GHFA 3ECRA 2EM5A 2NUGA 2VE7C 2A25A 2N3GA 4WX9A 4LF9E 2EOFA 2WBUA 2EOSA 2FGGA 3TQMA 4LFAE 2EOIA 1WHQA 4JI0E 3EPJA 2EL6A 3QG5C 4X8WA 1A1LA 2B7TA 2FV4B 3MHHC 4BS9A 3K6QA 4HTGA 1KJKA 1RQ0A 2YTEA 3J7AG 1UBDC 2NUEA 2ENHA 4HEIA 5AE2A 1GZ6A 2EN7A 1UHZA 4P78A 2V89A 4JI2E 5IWAE 2RQLA 4IJDA 5BR8E 1N32E 3ADIA 3J81C 2RTXA 3IWDA 2L3CA 1IBLE 1G2DC 2EORA 5IT9C 4JV5E 4JI8E 2NA2A 1HNXE 5AE1A 4DMIA 2UUAE 4B3SE 4KWYA 2EPXA 3T1YE 3AV0A 4GEQB 4L5NC 3VK6A 1A1GA 4OOGC 2B3TB 4R8OA 1BB8A 4B3TE 4KHPE 2YRMA 1ZR9A 2EOOA 2EMXA 2EM3A 3EPHA 2JY9A 2L8TA 3J80C 3EPLA 5F3WA 5T6JA 2EPZA 4YHHE 2UXBE 4M30A 5KL3A 2NUFA 2LMZA 2YWQA 2L6MA 2IHR1 2RSIA 3BGHA 3IWCA 4R2DA 2N8XA 2RSMA 4FK5C 3C6MA 2JPAA 3HQ1A 2LE2A 3IWBA 4B3RE 4NXME 1RMDA 2DIXA 1ZBTA 4R2SA 1TF6A 3HPZA 1NEIA 2CTDA 5LMUE 3AUZA 4RH8A 4DV4E 1Z1BA 1FJGE 2H36X 2LUQA 1A1IA 2VF1A 2CPNA 1LLMC 2MKNA 4DUZE 2WCC3 2EMLA 1X6FA 2RS7A 1HNWE 2ODRC 4LF7E 1T39A 4R2AA 4DV6E 1YYOA 2BBGA 3L00A 2EM4A 2YTPA 4K0KE 1PJTA 1X5WA 2NABA 3MHSC 3HXLA 4LTYA 4DV7E 1XNQE 2EPLX 1N36E 2EPCA 1XNRE 5KL6A 2I13A 2EN2A 2B7VA 1YSAC 2RS6A 2DRPA 4DV2E 3LLHA 1X49A 2YTJA 2HJJA 2YU8A 3ZOQB 3EQ1A 2DLQA 1A1HA 1XMOE 4WXDA 4I8OA 2EMCA 2EQ3A 1XMQE 2B9DA 2PRTA 4B3ME 5AC4A 2KONA 4P7DA 3ADGA 2GLIA 3JTZA 2EL5A 2EOMA 1X6HA 1QU6A 4LFBE 1PKPA 2WZOA 2EMWA 3BIDA 2V85A 2EOEA 2EE8A 2VQEE 1GQEA 4DR4E 4F6MA 3J7Yp 2DB2A 2L33A 2M1SA 4BBYA 2CT1A 4DV3E 2KHXA 2WBTA 2LTSA 1AH5A 2M7QA 2EMYA 5KL7A 1MEYC 1A1JA 4WFTA 3RMPA 1RC7A 2EOJA 2HHHE 1JK2A 2G7HA 2V87A 4DR6E 3C4BA 2EPRA 2EPMX 2UU9E 5IXMB 1IQOA 2EMKA 2MDGA 3JU0A 2DLKA 2FTXB 1T4NA 4WPYA 3OMLA 2EMBA 4JI7E 4F9AB 4X64E 4X9JA 1IBME 1SR9A 2ODRD 2E5LE 2HGHA 4LF6E 2N3HA 2YTGA 1PJSA 1YYKA 4MLVA 1BBOA 4JI1E 4R2CA 1QNTA 1IQSA 4ZYDA 1EKZA 4IS1C 5KL4A 2HC5A 2YRKA 1MGTA 2JVAA 2EMAA 4LU9A 1IBKE 4BMJA 2DMYA 1T4OA 4BC7A 1J26A 5A69A 5CFFE 4WXCA 4KZSA 1TF3A 4O24A 2LTRA 3KZZA 1ZU1A 1ZAAC 2E72A 2V86A 1KYQA 1A1KA 1YZ9A 2BB8A 2EPOA 3VYYA 5FLXC 2LJHA 2L2KB 2YSOA 2VQFE 3DJWA 1NCSA 2VRDA 3DF6A 3M99B 1WJPA 4TUIA 2LV2A 2EMIA 2YPNA 3H09A 2LT7A 2JXPA 1T4LB 3ADLA 1TN9A 4Q35B 1YUIA 2UUCE 2E1MA 2EMZA 2J7JA 4BHBA 4AQYE 2MDRA 4Q28A 1YFHA 5TSEA 4DV5E 1F2IG 4M9VC 1JK1A 1J5EE 2EPPA 2YTQA 2EM0A 4F2JC 4DKKA 4NXNE 2YTNA 1O0WA 4F6NA 5KL5A 1ZBQA 2WBSA 2EL4A 2K4VA 2EN8A 3FIGA 1IMUA 4WSGA 4DR2E 4ZYEA 2LJUA 4R2QA 2LUPB 1UN6B 4RHBB 4WYQB 4GZNC 2EMHA 3F6GA 4LF4E 5AASA 2EN3A 4R2EA 1GTKA 2EM7A 4JYAE 2MC5A 2V88A 1T38A 2V8QB 3UK3C 3ADJA 3T1HE 2CSHA 4DR3E 1N3GA 4L8NA 2K7IA 2JWOA 2V83A 5ADZA 3BBGA 5LL6R 5A2QC 4MLQA 2EOYA 4DUYE 2EPKX 1PJQA 2R1FA 4DV1E 2ELYA 2YTDA 4JI3E 2ZM6E 2DGCA 2ENCA 2YTFA 4M0VA 4DR7E 2EM2A 1WRJA 4GKKE 4O43A 2YSPA 4M2ZA 2YTOA 1DGCA 5AE3A 2D9HA 2RPCA 2DSYA 4OX9E 5A6KA 2EQ0A 1P47A 1X48A 1EH8A 2EM8A 2MC6A 5A6BA 4GKJE 1I94E 2YRHA 5A6AA 4J8ZA 2EP3A 1HNZE 1BBGA 3BF2A 4R2RA 1X6EA 1N33E 2UUBE 1YUJA 1DI2A 1G2FC 5A6JA 2EN1A 4LF8E 2LCEA 3JAMC 2EZ6A 3EPKA 2EOQA 3HTXA 2EQ1A 1PDAA 4F54A 2EOHA 5A6BD 2I9IA 2ELZA 2Q8UA 2EOZA 4R03A 3OTOE 2F8BA 2JOBA 3C6KA 4LFCE 4BCAA 4DR1E 5DNYA 4NHRA 4ZYGA 4JI5E 3VYXA 2EMFA 2JOXA 2F4VE 3THOB 4R2PA 2YU5A 4X66E 1X47A 2L92A 4X65E 5LMNE 1FKAE 2EWLA 4JI4E 2UXCE 5IV8B 1UILA 2EM6A 1EH6A 2EOXA 2LBSB 2LRSA 2JP9A 4DR5E 2L3JA 1WXRA 2UXDE 4BHCA 2YT4A 3C4TA 4X62E 1HR0E 4LF5E 4YY3E 2EM9A 2EPAA 3THNA 2MKDA 5AC5A 4WSPA 2KOUA 1STUA 5LLQA 2JR1A 2LO3A 1EH7A 1WHNA 2EN6A 2EPNA 2L2MA 4BC9A 1A1FA 1DQ3A 3KZYA 1YYWA 2GPIA 4O4KA 5KL2A 3LMLA 4DV0E 4O5GA 2EJ4A 2YTIA 1L4SA 4F9BB 2ADRA 2L2NA 1N34E 2EN4A 4TUGA 1AAYA 1X3CA 2JYAA 4N4RB 2M4IA 2R76A 3F6HA 2EPUA 3P1XA 2EMGA 2DMIA 2LVHA 2YZTA 4ZYHA 4JI6E 1YPNA 3KWRA 4F9CB 3HPSA 2M9AA
chains in the Genus database with same CATH topology
1J26A 4GKJE 5CFFE 2UXDE 4K0KE 4KZSA 4J8ZA 1HNZE 3MSWA 2LTRA 2NUGA 3HXLA 2VE7C 2V86A 1N33E 4LTYA 2UUBE 4DV7E 1DI2A 2N3GA 1XNQE 4LF9E 1YZ9A 1N36E 4LF8E 1XNRE 3VYYA 5FLXC 2FGGA 2LJHA 2L2KB 4LFAE 3JAMC 2B7VA 1WHQA 2VQFE 2RS6A 3DJWA 4JI0E 2EZ6A 3DF6A 3HTXA 4DV2E 4TUIA 3LLHA 4X8WA 1X49A 2B7TA 2FV4B 3H09A 4F54A 3J7Yp 4BS9A 3K6QA 1RQ0A 3J7AG 3ZOQB 1T4LB 4R03A 3OTOE 2NUEA 3ADLA 1XMOE 2F8BA 2JOBA 4I8OA 2UUCE 2E1MA 1GZ6A 5AE2A 4LFCE 4BCAA 2MDRA 4Q28A 1UHZA 4P78A 4AQYE 1XMQE 2V89A 4DR1E 5IWAE 4DV5E 5DNYA 4JI2E 2B9DA 4JI5E 3VYXA 5BR8E 2JOXA 1J5EE 4B3ME 2F4VE 2KONA 4DKKA 4NXNE 4P7DA 3ADGA 1N32E 3JTZA 3J81C 3ADIA 1O0WA 2RTXA 3IWDA 1ZBQA 1X47A 2L92A 4X65E 2L3CA 5LMNE 2EWLA 5IT9C 1IBLE 1FKAE 4JV5E 2UXBE 4JI4E 2UXCE 4JI8E 1QU6A 2NA2A 5AE1A 1HNXE 1UILA 4LFBE 4DMIA 2UUAE 2K4VA 3FIGA 2LBSB 4B3SE 4DR2E 2LRSA 1PKPA 3T1YE 3AV0A 2WZOA 4GEQB 4L5NC 2V85A 3VK6A 2L3JA 4DR5E 2LUPB 4WYQB 1WXRA 1GQEA 2VQEE 4LF4E 4DR4E 3F6GA 4OOGC 2B3TB 2DB2A 2L33A 2M1SA 2YT4A 3C4TA 4R8OA 4X62E 4BBYA 4YY3E 1HR0E 4B3TE 4DV3E 4LF5E 2KHXA 5AASA 4KHPE 2LTSA 4WSPA 2M7QA 2KOUA 1STUA 2JY9A 4JYAE 2MC5A 4WFTA 3RMPA 2L8TA 2JR1A 2V88A 3J80C 1RC7A 5F3WA 5T6JA 2HHHE 2V8QB 1WHNA 2G7HA 2L2MA 2V87A 4YHHE 1T4OA 3ADJA 4M30A 3C4BA 4BC9A 3T1HE 2NUFA 4DR6E 1DQ3A 1YYWA 2LMZA 2UU9E 4DR3E 3LMLA 4L8NA 2L6MA 2JWOA 2IHR1 2V83A 3IWCA 5ADZA 3JU0A 4DV0E 5LL6R 2FTXB 1T4NA 4WPYA 5A2QC 3OMLA 4JI7E 4F9AB 4BC7A 4DUYE 4X64E 2RSMA 4DV1E 1IBME 1SR9A 4JI3E 2ODRD 2ZM6E 3HQ1A 2E5LE 4LF6E 4F9BB 2L2NA 2LE2A 2N3HA 3IWBA 1N34E 4NXME 4M0VA 4TUGA 4B3RE 4DR7E 1YYKA 2DIXA 1ZBTA 3HPZA 4GKKE 5LMUE 2M4IA 3AUZA 4DV4E 4JI1E 4M2ZA 2H36X 1FJGE 2LUQA 2VF1A 2CPNA 5AE3A 3F6HA 1I94E 1EKZA 4DUZE 2DSYA 3P1XA 4OX9E 2RS7A 2YZTA 2JVAA 1X48A 2ODRC 4LU9A 4LF7E 2MC6A 4DV6E 1HNWE 1IBKE 3KWRA 1YYOA 4JI6E 4BMJA 4F9CB 2DMYA 3HPSA 4X66E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J26 A;  5CFF E;  2UXD E;  4K0K E;  1HNZ E;  2LTR A;  2NUG A;  1N33 E;  2UUB E;  4DV7 E;  1DI2 A;  2N3G A;  1XNQ E;  4LF9 E;  1YZ9 A;  1N36 E;  4LF8 E;  1XNR E;  3VYY A;  2L2K B;  2LJH A;  4LFA E;  2B7V A;  1WHQ A;  2VQF E;  2RS6 A;  4JI0 E;  2EZ6 A;  3HTX A;  4DV2 E;  3LLH A;  4X8W A;  2B7T A;  1X49 A;  1RQ0 A;  1T4L B;  2NUE A;  3OTO E;  3ADL A;  1XMO E;  2UUC E;  4LFC E;  4AQY E;  2MDR A;  1UHZ A;  1XMQ E;  4JI2 E;  4DR1 E;  5IWA E;  4DV5 E;  4JI5 E;  3VYX A;  5BR8 E;  1J5E E;  4B3M E;  2F4V E;  4DKK A;  4NXN E;  1N32 E;  3ADG A;  3ADI A;  1O0W A;  2RTX A;  1X47 A;  4X65 E;  5LMN E;  2L3C A;  1IBL E;  1FKA E;  4JV5 E;  4JI4 E;  2UXC E;  4JI8 E;  1QU6 A;  2NA2 A;  1HNX E;  4LFB E;  1UIL A;  2UUA E;  2LBS B;  4B3S E;  4DR2 E;  2LRS A;  1PKP A;  3T1Y E;  4DR5 E;  2L3J A;  2LUP B;  2VQE E;  4WYQ B;  1GQE A;  4DR4 E;  4OOG C;  3J7Y p;  2B3T B;  2DB2 A;  2L33 A;  2YT4 A;  3C4T A;  4LF4 E;  4X62 E;  1HR0 E;  4B3T E;  4YY3 E;  4LF5 E;  4KHP E;  4DV3 E;  2KHX A;  2LTS A;  1STU A;  2JY9 A;  4JYA E;  4WFT A;  1RC7 A;  2HHH E;  1WHN A;  4YHH E;  2L2M A;  2UXB E;  4M30 A;  3ADJ A;  1T4O A;  3C4B A;  3T1H E;  2NUF A;  4DR6 E;  1YYW A;  2UU9 E;  4DR3 E;  2IHR 1;  4DV0 E;  1T4N A;  4JI7 E;  4DUY E;  4X64 E;  2RSM A;  4DV1 E;  1IBM E;  4JI3 E;  2ZM6 E;  2E5L E;  4LF6 E;  2L2N A;  1N34 E;  2N3H A;  4B3R E;  4NXM E;  4DR7 E;  1YYK A;  2DIX A;  1ZBT A;  4GKK E;  5LMU E;  4DV4 E;  4M2Z A;  1FJG E;  4JI1 E;  2LUQ A;  2CPN A;  1EKZ A;  4DUZ E;  3P1X A;  4OX9 E;  2RS7 A;  2JVA A;  1X48 A;  4LF7 E;  1HNW E;  4DV6 E;  1IBK E;  4JI6 E;  1YYO A;  4GKJ E;  2DMY A;  1I94 E;  4X66 E; 
#chains in the Genus database with same CATH topology
 4NZV A;  2ENA A;  1SFE A;  3VHT B;  3MSW A;  1B69 A;  2GHF A;  3ECR A;  2EM5 A;  2NUG A;  2VE7 C;  2A25 A;  2N3G A;  4WX9 A;  4LF9 E;  2EOF A;  2WBU A;  2EOS A;  2FGG A;  3TQM A;  4LFA E;  2EOI A;  1WHQ A;  4JI0 E;  3EPJ A;  2EL6 A;  3QG5 C;  4X8W A;  1A1L A;  2B7T A;  2FV4 B;  3MHH C;  4BS9 A;  3K6Q A;  4HTG A;  1KJK A;  1RQ0 A;  2YTE A;  3J7A G;  1UBD C;  2NUE A;  2ENH A;  4HEI A;  5AE2 A;  1GZ6 A;  2EN7 A;  1UHZ A;  4P78 A;  2V89 A;  4JI2 E;  5IWA E;  2RQL A;  4IJD A;  5BR8 E;  1N32 E;  3ADI A;  3J81 C;  2RTX A;  3IWD A;  2L3C A;  1IBL E;  1G2D C;  2EOR A;  5IT9 C;  4JV5 E;  4JI8 E;  2NA2 A;  1HNX E;  5AE1 A;  4DMI A;  2UUA E;  4B3S E;  4KWY A;  2EPX A;  3T1Y E;  3AV0 A;  4GEQ B;  4L5N C;  3VK6 A;  1A1G A;  4OOG C;  2B3T B;  4R8O A;  1BB8 A;  4B3T E;  4KHP E;  2YRM A;  1ZR9 A;  2EOO A;  2EMX A;  2EM3 A;  3EPH A;  2JY9 A;  2L8T A;  3J80 C;  3EPL A;  5F3W A;  5T6J A;  2EPZ A;  4YHH E;  2UXB E;  4M30 A;  5KL3 A;  2NUF A;  2LMZ A;  2YWQ A;  2L6M A;  2IHR 1;  2RSI A;  3BGH A;  3IWC A;  4R2D A;  2N8X A;  2RSM A;  4FK5 C;  3C6M A;  2JPA A;  3HQ1 A;  2LE2 A;  3IWB A;  4B3R E;  4NXM E;  1RMD A;  2DIX A;  1ZBT A;  4R2S A;  1TF6 A;  3HPZ A;  1NEI A;  2CTD A;  5LMU E;  3AUZ A;  4RH8 A;  4DV4 E;  1Z1B A;  1FJG E;  2H36 X;  2LUQ A;  1A1I A;  2VF1 A;  2CPN A;  1LLM C;  2MKN A;  4DUZ E;  2WCC 3;  2EML A;  1X6F A;  2RS7 A;  1HNW E;  2ODR C;  4LF7 E;  1T39 A;  4R2A A;  4DV6 E;  1YYO A;  2BBG A;  3L00 A;  2EM4 A;  2YTP A;  4K0K E;  1PJT A;  1X5W A;  2NAB A;  3MHS C;  3HXL A;  4LTY A;  4DV7 E;  1XNQ E;  2EPL X;  1N36 E;  2EPC A;  1XNR E;  5KL6 A;  2I13 A;  2EN2 A;  2B7V A;  1YSA C;  2RS6 A;  2DRP A;  4DV2 E;  3LLH A;  1X49 A;  2YTJ A;  2HJJ A;  2YU8 A;  3ZOQ B;  3EQ1 A;  2DLQ A;  1A1H A;  1XMO E;  4WXD A;  4I8O A;  2EMC A;  2EQ3 A;  1XMQ E;  2B9D A;  2PRT A;  4B3M E;  5AC4 A;  2KON A;  4P7D A;  3ADG A;  2GLI A;  3JTZ A;  2EL5 A;  2EOM A;  1X6H A;  1QU6 A;  4LFB E;  1PKP A;  2WZO A;  2EMW A;  3BID A;  2V85 A;  2EOE A;  2EE8 A;  2VQE E;  1GQE A;  4DR4 E;  4F6M A;  3J7Y p;  2DB2 A;  2L33 A;  2M1S A;  4BBY A;  2CT1 A;  4DV3 E;  2KHX A;  2WBT A;  2LTS A;  1AH5 A;  2M7Q A;  2EMY A;  5KL7 A;  1MEY C;  1A1J A;  4WFT A;  3RMP A;  1RC7 A;  2EOJ A;  2HHH E;  1JK2 A;  2G7H A;  2V87 A;  4DR6 E;  3C4B A;  2EPR A;  2EPM X;  2UU9 E;  5IXM B;  1IQO A;  2EMK A;  2MDG A;  3JU0 A;  2DLK A;  2FTX B;  1T4N A;  4WPY A;  3OML A;  2EMB A;  4JI7 E;  4F9A B;  4X64 E;  4X9J A;  1IBM E;  1SR9 A;  2ODR D;  2E5L E;  2HGH A;  4LF6 E;  2N3H A;  2YTG A;  1PJS A;  1YYK A;  4MLV A;  1BBO A;  4JI1 E;  4R2C A;  1QNT A;  1IQS A;  4ZYD A;  1EKZ A;  4IS1 C;  5KL4 A;  2HC5 A;  2YRK A;  1MGT A;  2JVA A;  2EMA A;  4LU9 A;  1IBK E;  4BMJ A;  2DMY A;  1T4O A;  4BC7 A;  1J26 A;  5A69 A;  5CFF E;  4WXC A;  4KZS A;  1TF3 A;  4O24 A;  2LTR A;  3KZZ A;  1ZU1 A;  1ZAA C;  2E72 A;  2V86 A;  1KYQ A;  1A1K A;  1YZ9 A;  2BB8 A;  2EPO A;  3VYY A;  5FLX C;  2LJH A;  2L2K B;  2YSO A;  2VQF E;  3DJW A;  1NCS A;  2VRD A;  3DF6 A;  3M99 B;  1WJP A;  4TUI A;  2LV2 A;  2EMI A;  2YPN A;  3H09 A;  2LT7 A;  2JXP A;  1T4L B;  3ADL A;  1TN9 A;  4Q35 B;  1YUI A;  2UUC E;  2E1M A;  2EMZ A;  2J7J A;  4BHB A;  4AQY E;  2MDR A;  4Q28 A;  1YFH A;  5TSE A;  4DV5 E;  1F2I G;  4M9V C;  1JK1 A;  1J5E E;  2EPP A;  2YTQ A;  2EM0 A;  4F2J C;  4DKK A;  4NXN E;  2YTN A;  1O0W A;  4F6N A;  5KL5 A;  1ZBQ A;  2WBS A;  2EL4 A;  2K4V A;  2EN8 A;  3FIG A;  1IMU A;  4WSG A;  4DR2 E;  4ZYE A;  2LJU A;  4R2Q A;  2LUP B;  1UN6 B;  4RHB B;  4WYQ B;  4GZN C;  2EMH A;  3F6G A;  4LF4 E;  5AAS A;  2EN3 A;  4R2E A;  1GTK A;  2EM7 A;  4JYA E;  2MC5 A;  2V88 A;  1T38 A;  2V8Q B;  3UK3 C;  3ADJ A;  3T1H E;  2CSH A;  4DR3 E;  1N3G A;  4L8N A;  2K7I A;  2JWO A;  2V83 A;  5ADZ A;  3BBG A;  5LL6 R;  5A2Q C;  4MLQ A;  2EOY A;  4DUY E;  2EPK X;  1PJQ A;  2R1F A;  4DV1 E;  2ELY A;  2YTD A;  4JI3 E;  2ZM6 E;  2DGC A;  2ENC A;  2YTF A;  4M0V A;  4DR7 E;  2EM2 A;  1WRJ A;  4GKK E;  4O43 A;  2YSP A;  4M2Z A;  2YTO A;  1DGC A;  5AE3 A;  2D9H A;  2RPC A;  2DSY A;  4OX9 E;  5A6K A;  2EQ0 A;  1P47 A;  1X48 A;  1EH8 A;  2EM8 A;  2MC6 A;  5A6B A;  4GKJ E;  1I94 E;  2YRH A;  5A6A A;  4J8Z A;  2EP3 A;  1HNZ E;  1BBG A;  3BF2 A;  4R2R A;  1X6E A;  1N33 E;  2UUB E;  1YUJ A;  1DI2 A;  1G2F C;  5A6J A;  2EN1 A;  4LF8 E;  2LCE A;  3JAM C;  2EZ6 A;  3EPK A;  2EOQ A;  3HTX A;  2EQ1 A;  1PDA A;  4F54 A;  2EOH A;  5A6B D;  2I9I A;  2ELZ A;  2Q8U A;  2EOZ A;  4R03 A;  3OTO E;  2F8B A;  2JOB A;  3C6K A;  4LFC E;  4BCA A;  4DR1 E;  5DNY A;  4NHR A;  4ZYG A;  4JI5 E;  3VYX A;  2EMF A;  2JOX A;  2F4V E;  3THO B;  4R2P A;  2YU5 A;  4X66 E;  1X47 A;  2L92 A;  4X65 E;  5LMN E;  1FKA E;  2EWL A;  4JI4 E;  2UXC E;  5IV8 B;  1UIL A;  2EM6 A;  1EH6 A;  2EOX A;  2LBS B;  2LRS A;  2JP9 A;  4DR5 E;  2L3J A;  1WXR A;  2UXD E;  4BHC A;  2YT4 A;  3C4T A;  4X62 E;  1HR0 E;  4LF5 E;  4YY3 E;  2EM9 A;  2EPA A;  3THN A;  2MKD A;  5AC5 A;  4WSP A;  2KOU A;  1STU A;  5LLQ A;  2JR1 A;  2LO3 A;  1EH7 A;  1WHN A;  2EN6 A;  2EPN A;  2L2M A;  4BC9 A;  1A1F A;  1DQ3 A;  3KZY A;  1YYW A;  2GPI A;  4O4K A;  5KL2 A;  3LML A;  4DV0 E;  4O5G A;  2EJ4 A;  2YTI A;  1L4S A;  4F9B B;  2ADR A;  2L2N A;  1N34 E;  2EN4 A;  4TUG A;  1AAY A;  1X3C A;  2JYA A;  4N4R B;  2M4I A;  2R76 A;  3F6H A;  2EPU A;  3P1X A;  2EMG A;  2DMI A;  2LVH A;  2YZT A;  4ZYH A;  4JI6 E;  1YPN A;  3KWR A;  4F9C B;  3HPS A;  2M9A A; 
#chains in the Genus database with same CATH homology
 1J26 A;  4GKJ E;  5CFF E;  2UXD E;  4K0K E;  4KZS A;  4J8Z A;  1HNZ E;  3MSW A;  2LTR A;  2NUG A;  3HXL A;  2VE7 C;  2V86 A;  1N33 E;  4LTY A;  2UUB E;  4DV7 E;  1DI2 A;  2N3G A;  1XNQ E;  4LF9 E;  1YZ9 A;  1N36 E;  4LF8 E;  1XNR E;  3VYY A;  5FLX C;  2FGG A;  2LJH A;  2L2K B;  4LFA E;  3JAM C;  2B7V A;  1WHQ A;  2VQF E;  2RS6 A;  3DJW A;  4JI0 E;  2EZ6 A;  3DF6 A;  3HTX A;  4DV2 E;  4TUI A;  3LLH A;  4X8W A;  1X49 A;  2B7T A;  2FV4 B;  3H09 A;  4F54 A;  3J7Y p;  4BS9 A;  3K6Q A;  1RQ0 A;  3J7A G;  3ZOQ B;  1T4L B;  4R03 A;  3OTO E;  2NUE A;  3ADL A;  1XMO E;  2F8B A;  2JOB A;  4I8O A;  2UUC E;  2E1M A;  1GZ6 A;  5AE2 A;  4LFC E;  4BCA A;  2MDR A;  4Q28 A;  1UHZ A;  4P78 A;  4AQY E;  1XMQ E;  2V89 A;  4DR1 E;  5IWA E;  4DV5 E;  5DNY A;  4JI2 E;  2B9D A;  4JI5 E;  3VYX A;  5BR8 E;  2JOX A;  1J5E E;  4B3M E;  2F4V E;  2KON A;  4DKK A;  4NXN E;  4P7D A;  3ADG A;  1N32 E;  3JTZ A;  3J81 C;  3ADI A;  1O0W A;  2RTX A;  3IWD A;  1ZBQ A;  1X47 A;  2L92 A;  4X65 E;  2L3C A;  5LMN E;  2EWL A;  5IT9 C;  1IBL E;  1FKA E;  4JV5 E;  2UXB E;  4JI4 E;  2UXC E;  4JI8 E;  1QU6 A;  2NA2 A;  5AE1 A;  1HNX E;  1UIL A;  4LFB E;  4DMI A;  2UUA E;  2K4V A;  3FIG A;  2LBS B;  4B3S E;  4DR2 E;  2LRS A;  1PKP A;  3T1Y E;  3AV0 A;  2WZO A;  4GEQ B;  4L5N C;  2V85 A;  3VK6 A;  2L3J A;  4DR5 E;  2LUP B;  4WYQ B;  1WXR A;  1GQE A;  2VQE E;  4LF4 E;  4DR4 E;  3F6G A;  4OOG C;  2B3T B;  2DB2 A;  2L33 A;  2M1S A;  2YT4 A;  3C4T A;  4R8O A;  4X62 E;  4BBY A;  4YY3 E;  1HR0 E;  4B3T E;  4DV3 E;  4LF5 E;  2KHX A;  5AAS A;  4KHP E;  2LTS A;  4WSP A;  2M7Q A;  2KOU A;  1STU A;  2JY9 A;  4JYA E;  2MC5 A;  4WFT A;  3RMP A;  2L8T A;  2JR1 A;  2V88 A;  3J80 C;  1RC7 A;  5F3W A;  5T6J A;  2HHH E;  2V8Q B;  1WHN A;  2G7H A;  2L2M A;  2V87 A;  4YHH E;  1T4O A;  3ADJ A;  4M30 A;  3C4B A;  4BC9 A;  3T1H E;  2NUF A;  4DR6 E;  1DQ3 A;  1YYW A;  2LMZ A;  2UU9 E;  4DR3 E;  3LML A;  4L8N A;  2L6M A;  2JWO A;  2IHR 1;  2V83 A;  3IWC A;  5ADZ A;  3JU0 A;  4DV0 E;  5LL6 R;  2FTX B;  1T4N A;  4WPY A;  5A2Q C;  3OML A;  4JI7 E;  4F9A B;  4BC7 A;  4DUY E;  4X64 E;  2RSM A;  4DV1 E;  1IBM E;  1SR9 A;  4JI3 E;  2ODR D;  2ZM6 E;  3HQ1 A;  2E5L E;  4LF6 E;  4F9B B;  2L2N A;  2LE2 A;  2N3H A;  3IWB A;  1N34 E;  4NXM E;  4M0V A;  4TUG A;  4B3R E;  4DR7 E;  1YYK A;  2DIX A;  1ZBT A;  3HPZ A;  4GKK E;  5LMU E;  2M4I A;  3AUZ A;  4DV4 E;  4JI1 E;  4M2Z A;  2H36 X;  1FJG E;  2LUQ A;  2VF1 A;  2CPN A;  5AE3 A;  3F6H A;  1I94 E;  1EKZ A;  4DUZ E;  2DSY A;  3P1X A;  4OX9 E;  2RS7 A;  2YZT A;  2JVA A;  1X48 A;  2ODR C;  4LU9 A;  4LF7 E;  2MC6 A;  4DV6 E;  1HNW E;  1IBK E;  3KWR A;  1YYO A;  4JI6 E;  4BMJ A;  4F9C B;  2DMY A;  3HPS A;  4X66 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...