2L2MA

Solution structure of the second dsrbd of hyl1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
LCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hyponastic leave 1
publication title Structure and RNA Interactions of the Plant MicroRNA Processing-Associated Protein HYL1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein, plant protein
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l2mA00
4DV4E 2NUGA 4LF4E 1FJGE 1XMOE 4X64E 4LF8E 3J7Yp 1RC7A 4LF5E 2NUEA 1N33E 2KHXA 3T1YE 1X48A 2N3HA 2LRSA 5LMUE 5IWAE 4LF7E 1XNQE 1T4OA 1UHZA 2DMYA 4LF9E 4JV5E 4OOGC 1X47A 2RSMA 4M2ZA 2RS6A 4X65E 1EKZA 4LFAE 2JY9A 2L2KB 1YYOA 1IBKE 2L2MA 4JI8E 1YYKA 3VYXA 4DR6E 2IHR1 2NA2A 3LLHA 2UUAE 2F4VE 4JI6E 2UXBE 1UILA 2N3GA 2B3TB 1HNXE 1YYWA 2YT4A 3HTXA 4DR7E 1O0WA 2RS7A 4DV2E 4WFTA 4LFBE 4YHHE 4JI4E 2LUQA 2LJHA 1HR0E 5CFFE 3ADJA 1XMQE 3ADGA 4X8WA 2VQEE 4DR4E 4NXME 1WHQA 3T1HE 4K0KE 2CPNA 2UUBE 3P1XA 4DV6E 4WYQB 2LTSA 1J5EE 1HNWE 1YZ9A 4JI0E 1WHNA 2UXCE 2L33A 4GKJE 2DB2A 1PKPA 5BR8E 4JI3E 4B3SE 4DUYE 2JVAA 2DIXA 4JI5E 2UUCE 4JI7E 1X49A 1RQ0A 2LUPB 4OX9E 1J26A 2L3CA 5LMNE 2L3JA 2ZM6E 4X66E 1XNRE 2B7VA 1N36E 4JI1E 1I94E 3C4BA 1IBLE 4KHPE 4DUZE 1T4LB 4DV5E 3C4TA 3OTOE 1HNZE 2MDRA 2HHHE 4LFCE 4LF6E 2B7TA 2UXDE 2NUFA 4NXNE 1STUA 4M30A 1N32E 2LTRA 1GQEA 2E5LE 4DR5E 4X62E 1N34E 1IBME 2UU9E 4DV1E 4DR2E 4DR3E 1QU6A 1ZBTA 2RTXA 3ADLA 4DV7E 4YY3E 2L2NA 1FKAE 4JI2E 4JYAE 4B3RE 4DR1E 2EZ6A 4GKKE 4DV3E 1DI2A 4B3TE 1T4NA 4AQYE 4B3ME 2VQFE 3VYYA 4DKKA 2LBSB 3ADIA 4DV0E
chains in the Genus database with same CATH superfamily
4DV4E 4LF4E 5IXMB 1XMOE 5T6JA 4TUGA 2NUEA 2YTJA 4F6NA 2CTDA 2N3HA 1SFEA 3JTZA 1XNQE 1TN9A 2EQ0A 2EWLA 4R2AA 1T4OA 1UHZA 3AUZA 2YTNA 2EQ1A 2EL4A 2RS6A 4X65E 2KONA 2BBGA 1IBKE 2L2MA 4JI8E 4WX9A 2EMCA 2VRDA 3MSWA 2FGGA 2NA2A 2UUAE 2NABA 3IWCA 4LU9A 3DF6A 4P78A 1HNXE 2ENCA 3HTXA 2EPPA 4F9CB 2YTFA 4RHBB 5AE3A 2LUQA 3EPJA 2YSPA 5CFFE 2EMIA 4ZYDA 4DR4E 2YWQA 4NXME 3T1HE 4K0KE 1QNTA 4F2JC 4O4KA 2YTDA 1YZ9A 4JI0E 1WHNA 1WJPA 2V88A 4KZSA 5BR8E 2E1MA 2WBUA 4JI3E 2JVAA 4F9BB 5AE2A 2UUCE 2EMLA 2ODRC 1GTKA 5A6BA 1J26A 1F2IG 2L3JA 2FV4B 2EPMX 5A2QC 5LL6R 2EM6A 2YTQA 2V86A 3BBGA 1I94E 2EOSA 3C4BA 2DRPA 4R8OA 1EH7A 2JPAA 3QG5C 1A1JA 4X9JA 2EL5A 4P7DA 2M1SA 5KL7A 1KJKA 3H09A 3F6HA 2LCEA 1N32E 2UU9E 4DR3E 1QU6A 1L4SA 4DV7E 2EMBA 4DR1E 4DV3E 3JU0A 1T4NA 2A25A 3AV0A 1ZU1A 4AQYE 2MKNA 2EOHA 2EOMA 4RH8A 1ZR9A 4DKKA 3ADIA 2NUGA 4X64E 4WSGA 2EOEA 2LRSA 5LMUE 5AE1A 4LF9E 2EPNA 2L6MA 1T39A 4M2ZA 2YTOA 2K4VA 2ENAA 4F9AB 1LLMC 1A1KA 1UN6B 4LFAE 2EM4A 2EJ4A 2JY9A 1YYKA 2I9IA 2DLQA 3LLHA 2N3GA 4FK5C 2B3TB 1YUIA 2EN3A 1X6EA 2RS7A 2LV2A 4DV2E 1MEYC 1YSAC 4LFBE 4JI4E 2ENHA 2VE7C 2M4IA 2VF1A 2VQEE 1DGCA 3HPSA 2CPNA 2RPCA 1Z1BA 2EN7A 4WYQB 4R2CA 4M0VA 1J5EE 4M9VC 2UXCE 2EP3A 4I8OA 2HGHA 4GEQB 2EM3A 4JI7E 1G2FC 1X49A 1TF6A 1BBGA 2LUPB 2EORA 3C6KA 1NCSA 5FLXC 5A6BD 2ZM6E 4X66E 3EPKA 2JP9A 1A1HA 1PJQA 2FTXB 2MDGA 1N36E 4JI1E 4BMJA 2EM9A 3EPHA 2LO3A 2JOBA 4BC7A 2EPOA 2EOZA 5KL2A 4IS1C 3L00A 1A1GA 1HNZE 2EM0A 3VHTB 2LVHA 1TF3A 2V8QB 4KWYA 2M7QA 4LFCE 2YZTA 3IWBA 5A6JA 4BHBA 3J81C 2EMZA 2ADRA 2EPLX 2EM7A 2UXDE 2EN4A 2MKDA 5KL4A 3LMLA 4X62E 2YTPA 4DV1E 4HEIA 1ZBTA 2EMXA 3HPZA 1X3CA 3ADLA 4WSPA 2V89A 2WZOA 3BF2A 4R2EA 1MGTA 4JYAE 4B3RE 2EZ6A 2EOOA 4R2SA 1DI2A 4B3TE 2GPIA 1GZ6A 2V87A 4B3ME 2PRTA 2DMIA 3VYYA 2LBSB 2EMGA 2I13A 4DV0E 1FJGE 1KYQA 3J7Yp 1RC7A 2LJUA 4WXCA 1X48A 2JYAA 5IWAE 4LF7E 2YSOA 2RQLA 2EOJA 2V85A 2EL6A 2EMYA 1EKZA 2L2KB 2EPXA 2GLIA 4IJDA 4DR6E 2IHR1 2F4VE 4NHRA 5KL5A 4R03A 2LE2A 2EOQA 3J80C 2YT4A 4DR7E 1O0WA 1T38A 2EN6A 1DQ3A 5KL3A 1ZAAC 1BB8A 4LTYA 1HR0E 5A69A 1XMQE 3ADGA 4X8WA 1YPNA 5A6AA 2YTIA 4WPYA 3THNA 4R2QA 3EQ1A 2DGCA 4DV6E 2Q8UA 2EOFA 2EPCA 4BC9A 4F6MA 1N3GA 2JR1A 4GKJE 3DJWA 2YTEA 5DNYA 2DB2A 3RMPA 1PKPA 2EOYA 1YUJA 2EM2A 1BBOA 4B3SE 4DUYE 2ELZA 2B9DA 1PJTA 4BCAA 2DIXA 4O24A 4JI5E 4L5NC 2YPNA 1EH8A 3OMLA 4WXDA 2D9HA 1XNRE 2EQ3A 2JXPA 3VK6A 1G2DC 3UK3C 1IBLE 1IMUA 4KHPE 2YU8A 1RMDA 4DUZE 1T4LB 4DV5E 2WCC3 5ADZA 1SR9A 4O43A 4GZNC 3JAMC 1IQOA 4LF6E 2L8TA 2B7TA 2EPAA 3F6GA 4NXNE 4M30A 1GQEA 2EPZA 4DR5E 5LLQA 2BB8A 4DR2E 1PJSA 3KWRA 2EN8A 3THOB 4BS9A 2RTXA 4YY3E 2L2NA 4JI2E 5AASA 2R76A 2HC5A 4F54A 2YRHA 1NEIA 3MHHC 2KOUA 1A1IA 2YRKA 3M99B 2EM8A 1WXRA 2WBSA 4LF8E 1N33E 2HJJA 4LF5E 2KHXA 3T1YE 4Q28A 4BBYA 4J8ZA 2EMKA 3K6QA 2DMYA 5IV8B 4R2RA 4JV5E 4Q35B 4OOGC 2V83A 1X47A 2RSMA 4TUIA 1AAYA 5A6KA 4ZYHA 3MHSC 3ECRA 1YYOA 3VYXA 4MLQA 2UXBE 2CSHA 4JI6E 2J7JA 1UILA 1YYWA 1PDAA 4DMIA 4WFTA 5TSEA 4YHHE 3HQ1A 2LMZA 2LJHA 3ADJA 3BIDA 2RSIA 1WHQA 2DSYA 3TQMA 2JOXA 2UUBE 2GHFA 3P1XA 2LTSA 1HNWE 2YTGA 2ODRD 2EMAA 2K7IA 1X5WA 3KZYA 2EM5A 2EPRA 2L33A 2EPUA 2EOIA 2YU5A 2EMFA 2YRMA 4MLVA 3ZOQB 1UBDC 4ZYGA 1RQ0A 3HXLA 4OX9E 2EE8A 2H36X 2MC5A 3IWDA 2N8XA 2L3CA 5LMNE 1P47A 2EMWA 5AC4A 2B7VA 2EN2A 2R1FA 5IT9C 4R2PA 1ZBQA 1YFHA 3KZZA 1JK1A 3C4TA 2F8BA 3OTOE 1X6HA 2JWOA 3EPLA 2EPKX 2CT1A 4L8NA 5AC5A 4N4RB 2MDRA 2HHHE 2E72A 2EMHA 1X6FA 1EH6A 4R2DA 1B69A 3C6MA 3FIGA 4NZVA 2NUFA 2EN1A 2ELYA 1STUA 2DLKA 2LTRA 2E5LE 2LT7A 1N34E 1IBME 1IQSA 1AH5A 3J7AG 1WRJA 3BGHA 1A1FA 1A1LA 4O5GA 2WBTA 5KL6A 1JK2A 1FKAE 4HTGA 2M9AA 4GKKE 2MC6A 4ZYEA 5F3WA 2EOXA 2G7HA 2VQFE 2L92A 4BHCA
chains in the Genus database with same CATH topology
4DV4E 2NUGA 4LF4E 1FJGE 1XMOE 5T6JA 4X64E 4TUGA 3J7Yp 1RC7A 4LF5E 4LF8E 2NUEA 2KHXA 3T1YE 1X48A 1N33E 4Q28A 2N3HA 2LRSA 4BBYA 5LMUE 3JTZA 4J8ZA 5IWAE 4LF7E 1XNQE 3K6QA 2EWLA 5AE1A 1T4OA 1UHZA 2DMYA 3AUZA 4LF9E 4JV5E 2L6MA 4OOGC 2V83A 1X47A 2RSMA 2V85A 4TUIA 4M2ZA 2K4VA 4F9AB 2RS6A 4X65E 4DV0E 2KONA 1EKZA 4LFAE 2JY9A 2L2KB 1YYOA 1IBKE 2L2MA 4JI8E 1YYKA 3MSWA 3VYXA 4DR6E 2FGGA 2IHR1 2NA2A 3LLHA 2UUAE 2F4VE 4JI6E 2UXBE 3IWCA 4R03A 1UILA 2N3GA 2LE2A 2B3TB 3DF6A 4LU9A 2YT4A 4P78A 3J80C 1O0WA 2RS7A 4DMIA 4F9CB 4DV2E 4WFTA 3HTXA 4LFBE 4YHHE 4JI4E 3HQ1A 1DQ3A 2LMZA 2LUQA 5AE3A 2LJHA 4LTYA 1HR0E 4DR7E 5CFFE 3ADJA 1XMQE 2VE7C 3ADGA 4X8WA 2M4IA 2VF1A 2VQEE 4DR4E 4NXME 1WHQA 3T1HE 4K0KE 3HPSA 2DSYA 2CPNA 4WPYA 1HNXE 2JOXA 2UUBE 3P1XA 4DV6E 4WYQB 2LTSA 4M0VA 4BC9A 1J5EE 1HNWE 1YZ9A 2ODRD 4JI0E 1WHNA 2JR1A 2UXCE 2L33A 2V88A 4GKJE 3DJWA 5DNYA 2DB2A 4KZSA 1PKPA 5BR8E 2E1MA 3RMPA 1YYWA 4JI3E 4B3SE 4DUYE 3ZOQB 4I8OA 2JVAA 4GEQB 4F9BB 2B9DA 4BCAA 5AE2A 2DIXA 4JI5E 2UUCE 4JI7E 4L5NC 1X49A 2ODRC 1RQ0A 2LUPB 3HXLA 4OX9E 3OMLA 1J26A 2H36X 2MC5A 3IWDA 2L3CA 2L3JA 5LMNE 5FLXC 2FV4B 2ZM6E 4X66E 5A2QC 5LL6R 1XNRE 2FTXB 2B7VA 5IT9C 2V86A 3VK6A 1N36E 4JI1E 4BMJA 1I94E 3C4BA 1IBLE 1ZBQA 4R8OA 4KHPE 2JOBA 4BC7A 4DUZE 1T4LB 4DV5E 3C4TA 2F8BA 3OTOE 5ADZA 1HNZE 2JWOA 1SR9A 4L8NA 3JAMC 2MDRA 2HHHE 2V8QB 2M7QA 4LFCE 4LF6E 2L8TA 2YZTA 3IWBA 2B7TA 3J81C 4P7DA 3F6GA 2M1SA 3FIGA 2UXDE 2NUFA 3H09A 4NXNE 3F6HA 1STUA 4M30A 1N32E 2LTRA 1GQEA 2E5LE 3LMLA 4DR5E 4X62E 1N34E 1IBME 2UU9E 4DV1E 4DR2E 3J7AG 4DR3E 3KWRA 1QU6A 1ZBTA 4BS9A 2RTXA 3HPZA 3ADLA 4DV7E 4WSPA 2L2NA 2V89A 2WZOA 4YY3E 1FKAE 4JI2E 5AASA 4JYAE 4B3RE 4DR1E 4F54A 2EZ6A 4GKKE 4DV3E 3JU0A 4B3TE 1DI2A 2MC6A 1T4NA 5F3WA 1GZ6A 2G7HA 2V87A 3AV0A 4AQYE 2VQFE 4B3ME 2KOUA 2L92A 3VYYA 4DKKA 2LBSB 3ADIA 1WXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 E;  2NUG A;  4LF4 E;  1FJG E;  1XMO E;  4X64 E;  4LF8 E;  3J7Y p;  1RC7 A;  4LF5 E;  2NUE A;  1N33 E;  2KHX A;  3T1Y E;  1X48 A;  2N3H A;  2LRS A;  5LMU E;  5IWA E;  4LF7 E;  1XNQ E;  1T4O A;  1UHZ A;  2DMY A;  4LF9 E;  4JV5 E;  4OOG C;  1X47 A;  2RSM A;  4M2Z A;  2RS6 A;  4X65 E;  1EKZ A;  4LFA E;  2JY9 A;  2L2K B;  1YYO A;  1IBK E;  2L2M A;  4JI8 E;  1YYK A;  3VYX A;  4DR6 E;  2IHR 1;  2NA2 A;  3LLH A;  2UUA E;  2F4V E;  4JI6 E;  2UXB E;  1UIL A;  2N3G A;  2B3T B;  1HNX E;  1YYW A;  2YT4 A;  3HTX A;  4DR7 E;  1O0W A;  2RS7 A;  4DV2 E;  4WFT A;  4LFB E;  4YHH E;  4JI4 E;  2LUQ A;  2LJH A;  1HR0 E;  5CFF E;  3ADJ A;  1XMQ E;  3ADG A;  4X8W A;  2VQE E;  4DR4 E;  4NXM E;  1WHQ A;  3T1H E;  4K0K E;  2CPN A;  2UUB E;  3P1X A;  4DV6 E;  4WYQ B;  2LTS A;  1J5E E;  1HNW E;  1YZ9 A;  4JI0 E;  1WHN A;  2UXC E;  2L33 A;  4GKJ E;  2DB2 A;  1PKP A;  5BR8 E;  4JI3 E;  4B3S E;  4DUY E;  2JVA A;  2DIX A;  4JI5 E;  2UUC E;  4JI7 E;  1X49 A;  1RQ0 A;  2LUP B;  4OX9 E;  1J26 A;  2L3C A;  5LMN E;  2L3J A;  2ZM6 E;  4X66 E;  1XNR E;  2B7V A;  1N36 E;  4JI1 E;  1I94 E;  3C4B A;  1IBL E;  4KHP E;  4DUZ E;  1T4L B;  4DV5 E;  3C4T A;  3OTO E;  1HNZ E;  2MDR A;  2HHH E;  4LFC E;  4LF6 E;  2B7T A;  2UXD E;  2NUF A;  4NXN E;  1STU A;  4M30 A;  1N32 E;  2LTR A;  1GQE A;  2E5L E;  4DR5 E;  4X62 E;  1N34 E;  1IBM E;  2UU9 E;  4DV1 E;  4DR2 E;  4DR3 E;  1QU6 A;  1ZBT A;  2RTX A;  3ADL A;  4DV7 E;  4YY3 E;  2L2N A;  1FKA E;  4JI2 E;  4JYA E;  4B3R E;  4DR1 E;  2EZ6 A;  4GKK E;  4DV3 E;  1DI2 A;  4B3T E;  1T4N A;  4AQY E;  4B3M E;  2VQF E;  3VYY A;  4DKK A;  2LBS B;  3ADI A;  4DV0 E; 
#chains in the Genus database with same CATH topology
 4DV4 E;  4LF4 E;  5IXM B;  1XMO E;  5T6J A;  4TUG A;  2NUE A;  2YTJ A;  4F6N A;  2CTD A;  2N3H A;  1SFE A;  3JTZ A;  1XNQ E;  1TN9 A;  2EQ0 A;  2EWL A;  4R2A A;  1T4O A;  1UHZ A;  3AUZ A;  2YTN A;  2EQ1 A;  2EL4 A;  2RS6 A;  4X65 E;  2KON A;  2BBG A;  1IBK E;  2L2M A;  4JI8 E;  4WX9 A;  2EMC A;  2VRD A;  3MSW A;  2FGG A;  2NA2 A;  2UUA E;  2NAB A;  3IWC A;  4LU9 A;  3DF6 A;  4P78 A;  1HNX E;  2ENC A;  3HTX A;  2EPP A;  4F9C B;  2YTF A;  4RHB B;  5AE3 A;  2LUQ A;  3EPJ A;  2YSP A;  5CFF E;  2EMI A;  4ZYD A;  4DR4 E;  2YWQ A;  4NXM E;  3T1H E;  4K0K E;  1QNT A;  4F2J C;  4O4K A;  2YTD A;  1YZ9 A;  4JI0 E;  1WHN A;  1WJP A;  2V88 A;  4KZS A;  5BR8 E;  2E1M A;  2WBU A;  4JI3 E;  2JVA A;  4F9B B;  5AE2 A;  2UUC E;  2EML A;  2ODR C;  1GTK A;  5A6B A;  1J26 A;  1F2I G;  2L3J A;  2FV4 B;  2EPM X;  5A2Q C;  5LL6 R;  2EM6 A;  2YTQ A;  2V86 A;  3BBG A;  1I94 E;  2EOS A;  3C4B A;  2DRP A;  4R8O A;  1EH7 A;  2JPA A;  3QG5 C;  1A1J A;  4X9J A;  2EL5 A;  4P7D A;  2M1S A;  5KL7 A;  1KJK A;  3H09 A;  3F6H A;  2LCE A;  1N32 E;  2UU9 E;  4DR3 E;  1QU6 A;  1L4S A;  4DV7 E;  2EMB A;  4DR1 E;  4DV3 E;  3JU0 A;  1T4N A;  2A25 A;  3AV0 A;  1ZU1 A;  4AQY E;  2MKN A;  2EOH A;  2EOM A;  4RH8 A;  1ZR9 A;  4DKK A;  3ADI A;  2NUG A;  4X64 E;  4WSG A;  2EOE A;  2LRS A;  5LMU E;  5AE1 A;  4LF9 E;  2EPN A;  2L6M A;  1T39 A;  4M2Z A;  2YTO A;  2K4V A;  2ENA A;  4F9A B;  1LLM C;  1A1K A;  1UN6 B;  4LFA E;  2EM4 A;  2EJ4 A;  2JY9 A;  1YYK A;  2I9I A;  2DLQ A;  3LLH A;  2N3G A;  4FK5 C;  2B3T B;  1YUI A;  2EN3 A;  1X6E A;  2RS7 A;  2LV2 A;  4DV2 E;  1MEY C;  1YSA C;  4LFB E;  4JI4 E;  2ENH A;  2VE7 C;  2M4I A;  2VF1 A;  2VQE E;  1DGC A;  3HPS A;  2CPN A;  2RPC A;  1Z1B A;  2EN7 A;  4WYQ B;  4R2C A;  4M0V A;  1J5E E;  4M9V C;  2UXC E;  2EP3 A;  4I8O A;  2HGH A;  4GEQ B;  2EM3 A;  4JI7 E;  1G2F C;  1X49 A;  1TF6 A;  1BBG A;  2LUP B;  2EOR A;  3C6K A;  1NCS A;  5FLX C;  5A6B D;  2ZM6 E;  4X66 E;  3EPK A;  2JP9 A;  1A1H A;  1PJQ A;  2FTX B;  2MDG A;  1N36 E;  4JI1 E;  4BMJ A;  2EM9 A;  3EPH A;  2LO3 A;  2JOB A;  4BC7 A;  2EPO A;  2EOZ A;  5KL2 A;  4IS1 C;  3L00 A;  1A1G A;  1HNZ E;  2EM0 A;  3VHT B;  2LVH A;  1TF3 A;  2V8Q B;  4KWY A;  2M7Q A;  4LFC E;  2YZT A;  3IWB A;  5A6J A;  4BHB A;  3J81 C;  2EMZ A;  2ADR A;  2EPL X;  2EM7 A;  2UXD E;  2EN4 A;  2MKD A;  5KL4 A;  3LML A;  4X62 E;  2YTP A;  4DV1 E;  4HEI A;  1ZBT A;  2EMX A;  3HPZ A;  1X3C A;  3ADL A;  4WSP A;  2V89 A;  2WZO A;  3BF2 A;  4R2E A;  1MGT A;  4JYA E;  4B3R E;  2EZ6 A;  2EOO A;  4R2S A;  1DI2 A;  4B3T E;  2GPI A;  1GZ6 A;  2V87 A;  4B3M E;  2PRT A;  2DMI A;  3VYY A;  2LBS B;  2EMG A;  2I13 A;  4DV0 E;  1FJG E;  1KYQ A;  3J7Y p;  1RC7 A;  2LJU A;  4WXC A;  1X48 A;  2JYA A;  5IWA E;  4LF7 E;  2YSO A;  2RQL A;  2EOJ A;  2V85 A;  2EL6 A;  2EMY A;  1EKZ A;  2L2K B;  2EPX A;  2GLI A;  4IJD A;  4DR6 E;  2IHR 1;  2F4V E;  4NHR A;  5KL5 A;  4R03 A;  2LE2 A;  2EOQ A;  3J80 C;  2YT4 A;  4DR7 E;  1O0W A;  1T38 A;  2EN6 A;  1DQ3 A;  5KL3 A;  1ZAA C;  1BB8 A;  4LTY A;  1HR0 E;  5A69 A;  1XMQ E;  3ADG A;  4X8W A;  1YPN A;  5A6A A;  2YTI A;  4WPY A;  3THN A;  4R2Q A;  3EQ1 A;  2DGC A;  4DV6 E;  2Q8U A;  2EOF A;  2EPC A;  4BC9 A;  4F6M A;  1N3G A;  2JR1 A;  4GKJ E;  3DJW A;  2YTE A;  5DNY A;  2DB2 A;  3RMP A;  1PKP A;  2EOY A;  1YUJ A;  2EM2 A;  1BBO A;  4B3S E;  4DUY E;  2ELZ A;  2B9D A;  1PJT A;  4BCA A;  2DIX A;  4O24 A;  4JI5 E;  4L5N C;  2YPN A;  1EH8 A;  3OML A;  4WXD A;  2D9H A;  1XNR E;  2EQ3 A;  2JXP A;  3VK6 A;  1G2D C;  3UK3 C;  1IBL E;  1IMU A;  4KHP E;  2YU8 A;  1RMD A;  4DUZ E;  1T4L B;  4DV5 E;  2WCC 3;  5ADZ A;  1SR9 A;  4O43 A;  4GZN C;  3JAM C;  1IQO A;  4LF6 E;  2L8T A;  2B7T A;  2EPA A;  3F6G A;  4NXN E;  4M30 A;  1GQE A;  2EPZ A;  4DR5 E;  5LLQ A;  2BB8 A;  4DR2 E;  1PJS A;  3KWR A;  2EN8 A;  3THO B;  4BS9 A;  2RTX A;  4YY3 E;  2L2N A;  4JI2 E;  5AAS A;  2R76 A;  2HC5 A;  4F54 A;  2YRH A;  1NEI A;  3MHH C;  2KOU A;  1A1I A;  2YRK A;  3M99 B;  2EM8 A;  1WXR A;  2WBS A;  4LF8 E;  1N33 E;  2HJJ A;  4LF5 E;  2KHX A;  3T1Y E;  4Q28 A;  4BBY A;  4J8Z A;  2EMK A;  3K6Q A;  2DMY A;  5IV8 B;  4R2R A;  4JV5 E;  4Q35 B;  4OOG C;  2V83 A;  1X47 A;  2RSM A;  4TUI A;  1AAY A;  5A6K A;  4ZYH A;  3MHS C;  3ECR A;  1YYO A;  3VYX A;  4MLQ A;  2UXB E;  2CSH A;  4JI6 E;  2J7J A;  1UIL A;  1YYW A;  1PDA A;  4DMI A;  4WFT A;  5TSE A;  4YHH E;  3HQ1 A;  2LMZ A;  2LJH A;  3ADJ A;  3BID A;  2RSI A;  1WHQ A;  2DSY A;  3TQM A;  2JOX A;  2UUB E;  2GHF A;  3P1X A;  2LTS A;  1HNW E;  2YTG A;  2ODR D;  2EMA A;  2K7I A;  1X5W A;  3KZY A;  2EM5 A;  2EPR A;  2L33 A;  2EPU A;  2EOI A;  2YU5 A;  2EMF A;  2YRM A;  4MLV A;  3ZOQ B;  1UBD C;  4ZYG A;  1RQ0 A;  3HXL A;  4OX9 E;  2EE8 A;  2H36 X;  2MC5 A;  3IWD A;  2N8X A;  2L3C A;  5LMN E;  1P47 A;  2EMW A;  5AC4 A;  2B7V A;  2EN2 A;  2R1F A;  5IT9 C;  4R2P A;  1ZBQ A;  1YFH A;  3KZZ A;  1JK1 A;  3C4T A;  2F8B A;  3OTO E;  1X6H A;  2JWO A;  3EPL A;  2EPK X;  2CT1 A;  4L8N A;  5AC5 A;  4N4R B;  2MDR A;  2HHH E;  2E72 A;  2EMH A;  1X6F A;  1EH6 A;  4R2D A;  1B69 A;  3C6M A;  3FIG A;  4NZV A;  2NUF A;  2EN1 A;  2ELY A;  1STU A;  2DLK A;  2LTR A;  2E5L E;  2LT7 A;  1N34 E;  1IBM E;  1IQS A;  1AH5 A;  3J7A G;  1WRJ A;  3BGH A;  1A1F A;  1A1L A;  4O5G A;  2WBT A;  5KL6 A;  1JK2 A;  1FKA E;  4HTG A;  2M9A A;  4GKK E;  2MC6 A;  4ZYE A;  5F3W A;  2EOX A;  2G7H A;  2VQF E;  2L92 A;  4BHC A; 
#chains in the Genus database with same CATH homology
 4DV4 E;  2NUG A;  4LF4 E;  1FJG E;  1XMO E;  5T6J A;  4X64 E;  4TUG A;  3J7Y p;  1RC7 A;  4LF5 E;  4LF8 E;  2NUE A;  2KHX A;  3T1Y E;  1X48 A;  1N33 E;  4Q28 A;  2N3H A;  2LRS A;  4BBY A;  5LMU E;  3JTZ A;  4J8Z A;  5IWA E;  4LF7 E;  1XNQ E;  3K6Q A;  2EWL A;  5AE1 A;  1T4O A;  1UHZ A;  2DMY A;  3AUZ A;  4LF9 E;  4JV5 E;  2L6M A;  4OOG C;  2V83 A;  1X47 A;  2RSM A;  2V85 A;  4TUI A;  4M2Z A;  2K4V A;  4F9A B;  2RS6 A;  4X65 E;  4DV0 E;  2KON A;  1EKZ A;  4LFA E;  2JY9 A;  2L2K B;  1YYO A;  1IBK E;  2L2M A;  4JI8 E;  1YYK A;  3MSW A;  3VYX A;  4DR6 E;  2FGG A;  2IHR 1;  2NA2 A;  3LLH A;  2UUA E;  2F4V E;  4JI6 E;  2UXB E;  3IWC A;  4R03 A;  1UIL A;  2N3G A;  2LE2 A;  2B3T B;  3DF6 A;  4LU9 A;  2YT4 A;  4P78 A;  3J80 C;  1O0W A;  2RS7 A;  4DMI A;  4F9C B;  4DV2 E;  4WFT A;  3HTX A;  4LFB E;  4YHH E;  4JI4 E;  3HQ1 A;  1DQ3 A;  2LMZ A;  2LUQ A;  5AE3 A;  2LJH A;  4LTY A;  1HR0 E;  4DR7 E;  5CFF E;  3ADJ A;  1XMQ E;  2VE7 C;  3ADG A;  4X8W A;  2M4I A;  2VF1 A;  2VQE E;  4DR4 E;  4NXM E;  1WHQ A;  3T1H E;  4K0K E;  3HPS A;  2DSY A;  2CPN A;  4WPY A;  1HNX E;  2JOX A;  2UUB E;  3P1X A;  4DV6 E;  4WYQ B;  2LTS A;  4M0V A;  4BC9 A;  1J5E E;  1HNW E;  1YZ9 A;  2ODR D;  4JI0 E;  1WHN A;  2JR1 A;  2UXC E;  2L33 A;  2V88 A;  4GKJ E;  3DJW A;  5DNY A;  2DB2 A;  4KZS A;  1PKP A;  5BR8 E;  2E1M A;  3RMP A;  1YYW A;  4JI3 E;  4B3S E;  4DUY E;  3ZOQ B;  4I8O A;  2JVA A;  4GEQ B;  4F9B B;  2B9D A;  4BCA A;  5AE2 A;  2DIX A;  4JI5 E;  2UUC E;  4JI7 E;  4L5N C;  1X49 A;  2ODR C;  1RQ0 A;  2LUP B;  3HXL A;  4OX9 E;  3OML A;  1J26 A;  2H36 X;  2MC5 A;  3IWD A;  2L3C A;  2L3J A;  5LMN E;  5FLX C;  2FV4 B;  2ZM6 E;  4X66 E;  5A2Q C;  5LL6 R;  1XNR E;  2FTX B;  2B7V A;  5IT9 C;  2V86 A;  3VK6 A;  1N36 E;  4JI1 E;  4BMJ A;  1I94 E;  3C4B A;  1IBL E;  1ZBQ A;  4R8O A;  4KHP E;  2JOB A;  4BC7 A;  4DUZ E;  1T4L B;  4DV5 E;  3C4T A;  2F8B A;  3OTO E;  5ADZ A;  1HNZ E;  2JWO A;  1SR9 A;  4L8N A;  3JAM C;  2MDR A;  2HHH E;  2V8Q B;  2M7Q A;  4LFC E;  4LF6 E;  2L8T A;  2YZT A;  3IWB A;  2B7T A;  3J81 C;  4P7D A;  3F6G A;  2M1S A;  3FIG A;  2UXD E;  2NUF A;  3H09 A;  4NXN E;  3F6H A;  1STU A;  4M30 A;  1N32 E;  2LTR A;  1GQE A;  2E5L E;  3LML A;  4DR5 E;  4X62 E;  1N34 E;  1IBM E;  2UU9 E;  4DV1 E;  4DR2 E;  3J7A G;  4DR3 E;  3KWR A;  1QU6 A;  1ZBT A;  4BS9 A;  2RTX A;  3HPZ A;  3ADL A;  4DV7 E;  4WSP A;  2L2N A;  2V89 A;  2WZO A;  4YY3 E;  1FKA E;  4JI2 E;  5AAS A;  4JYA E;  4B3R E;  4DR1 E;  4F54 A;  2EZ6 A;  4GKK E;  4DV3 E;  3JU0 A;  4B3T E;  1DI2 A;  2MC6 A;  1T4N A;  5F3W A;  1GZ6 A;  2G7H A;  2V87 A;  3AV0 A;  4AQY E;  2VQF E;  4B3M E;  2KOU A;  2L92 A;  3VYY A;  4DKK A;  2LBS B;  3ADI A;  1WXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...