2RSMA

Solution structure and sirna-mediated knockdown analysis of the mitochondrial disease-related protein c12orf65 (ict2)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
b'GSSGSSGKWGLRLQEKPALLFPGMAASTVQVAGRKDYPALLPLNESELEEQFVKGHGPGGQATNKTSNCVVLKHVPSGIVVKCHQTRSVDQNRKIARKVLQEKVDVFYNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable peptide chain release factor C12orf65 homolog, mito
molecule tags Translation
source organism Mus musculus
publication title Solution structure and siRNA-mediated knockdown analysis of the mitochondrial disease-related protein C12orf65.
pubmed doi rcsb
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rsmA00
1I94E 1XNRE 2UXDE 1J26A 2LUQA 1DI2A 4OX9E 4JI0E 4DR5E 3VYYA 2VQEE 1EKZA 2UU9E 1X49A 1WHNA 4DV7E 1N34E 2B3TB 1X48A 1QU6A 4NXME 4JI5E 4AQYE 2NA2A 4JI1E 2L33A 1IBLE 4DR4E 4DKKA 4JI7E 5LMUE 1XMQE 4B3RE 2B7TA 4LFAE 4DV5E 4X65E 2YT4A 2ZM6E 1GQEA 4M30A 4DV0E 4DR2E 1J5EE 4DUYE 4DV2E 2LRSA 4DV4E 4YY3E 4JYAE 4JI2E 3ADLA 3T1YE 1IBKE 2VQFE 3ADJA 2L2KB 4JI3E 2UUCE 1X47A 4YHHE 4DV3E 1FJGE 5IWAE 4OOGC 4DV1E 1HR0E 1XNQE 4B3ME 5LMNE 1UILA 2JY9A 4DV6E 1N32E 4DR6E 4KHPE 1WHQA 1N33E 2NUGA 2LTRA 2RSMA 2DMYA 2LJHA 1FKAE 1T4OA 4WYQB 2DIXA 1YYWA 2L3JA 4M2ZA 2IHR1 4LFCE 2N3GA 4NXNE 2NUEA 1N36E 2DB2A 4GKKE 2RTXA 2NUFA 2JVAA 4DR1E 1IBME 4X64E 1UHZA 3OTOE 4DUZE 4LF9E 4K0KE 2KHXA 5BR8E 4DR7E 4B3SE 4JI4E 1T4NA 1YZ9A 2UXBE 1O0WA 1ZBTA 3T1HE 2N3HA 4JI8E 2UUBE 4X8WA 1YYOA 1STUA 4LF4E 4LF7E 4X62E 3LLHA 2LBSB 2CPNA 1T4LB 1RC7A 1HNZE 4LFBE 2RS7A 4LF8E 1HNXE 2F4VE 2UXCE 5CFFE 2LUPB 4GKJE 3P1XA 2E5LE 2MDRA 3ADGA 2EZ6A 1XMOE 2B7VA 4X66E 4B3TE 4DR3E 3HTXA 3ADIA 1PKPA 4JI6E 1RQ0A 2UUAE 3C4TA 4LF5E 2L2NA 2HHHE 1YYKA 3VYXA 4LF6E 4WFTA 2L3CA 3J7Yp 4JV5E 3C4BA 2RS6A 2L2MA 2LTSA 1HNWE
chains in the Genus database with same CATH superfamily
1XNRE 1J26A 2UXDE 4NHRA 2EN1A 4HEIA 1X3CA 4GEQB 2PRTA 2YTPA 1PJQA 2EL4A 2EN6A 2V85A 1AH5A 2EM5A 2M4IA 4R2PA 4R03A 4AQYE 2M9AA 2MC5A 2V8QB 5A6JA 1IBLE 3HQ1A 4DR4E 4DKKA 2BB8A 1XMQE 2B7TA 3BBGA 2EMLA 2EOQA 1G2DC 4DV5E 4ZYGA 4X65E 2EM8A 4M30A 4DV0E 2EORA 2EN4A 1J5EE 1QNTA 4DV2E 3MHSC 4YY3E 2LT7A 2UUCE 4IJDA 4R2CA 1XNQE 4O5GA 2EM0A 1B69A 3K6QA 4F9BB 2ENCA 1FKAE 1L4SA 3THNA 3AUZA 4WYQB 2L3JA 3KZZA 4LFCE 2N3GA 4NXNE 2DB2A 1PDAA 4M9VC 4DR1E 2EPMX 3OTOE 4K0KE 2YZTA 2V88A 4DR7E 2JOXA 4FK5C 1T38A 3H09A 1O0WA 1EH7A 2HGHA 5AE3A 2EMAA 3T1HE 2N3HA 2N8XA 3DJWA 2M7QA 4O4KA 1SR9A 4X62E 2EPPA 2LJUA 4LF8E 2YWQA 2UXCE 2LUPB 2YTFA 2EMBA 3IWBA 3P1XA 2YSOA 2EOEA 2E5LE 2M1SA 2MDRA 4BS9A 4B3TE 2CTDA 3F6GA 5TSEA 1YUJA 3C4TA 2L2NA 2HHHE 3VYXA 5AC4A 4R2SA 1MEYC 4F6MA 2L2MA 2LTSA 3THOB 1HNWE 5IXMB 4TUGA 5KL6A 1EKZA 2EM6A 1X49A 2EM2A 5ADZA 1X48A 1UN6B 2KONA 5KL2A 3ZOQB 4O43A 1IQOA 3EPJA 2EM3A 2V86A 4JI5E 2VF1A 2JYAA 2YRKA 4LTYA 2EPCA 1A1IA 1DQ3A 4B3RE 4LFAE 2GHFA 1TF3A 3HPSA 5A2QC 2WCC3 4DR2E 4Q28A 4DUYE 2EOJA 2EMIA 2DLQA 3J81C 4JI2E 3ADLA 3MHHC 4DV1E 2ENHA 3HPZA 3ECRA 5LMNE 1TN9A 4IS1C 2JY9A 1Z1BA 4DR6E 1BBGA 1NCSA 2EM7A 2FTXB 1N33E 2LTRA 2RSMA 2EMCA 3RMPA 4O24A 2MKNA 2EMGA 2LVHA 1X6FA 2YU8A 2DIXA 4M2ZA 2NUEA 2EQ3A 4GKKE 3JTZA 2G7HA 2RTXA 4F6NA 3EPLA 2B9DA 2JVAA 2YTQA 4P78A 2EPOA 2EPAA 2EOFA 2YSPA 2EPXA 1UHZA 4LF9E 2KHXA 1A1HA 1YZ9A 5IT9C 1PJTA 2UXBE 2EE8A 2Q8UA 2UUBE 3J7AG 1AAYA 2EMFA 2EPLX 3KWRA 2YTOA 1STUA 4LF4E 3AV0A 3LLHA 5T6JA 5A6BA 2LV2A 2E1MA 5F3WA 1NEIA 1HNXE 4R8OA 2V83A 2ENAA 2EM9A 2VE7C 4WXDA 5KL5A 2MDGA 1LLMC 2RQLA 1RMDA 2WBSA 1X6EA 4N4RB 4DR3E 3BGHA 4ZYEA 2EPRA 4LF5E 1YYKA 2EM4A 1ZAAC 3F6HA 2JWOA 1G2FC 2BBGA 3BIDA 3EQ1A 3J7Yp 2YPNA 4JV5E 2RS6A 2DRPA 4L5NC 1YFHA 2JP9A 2LUQA 1IMUA 3QG5C 4DR5E 4F9CB 3L00A 5A6AA 2ELYA 2EL5A 1A1LA 1N34E 1WHNA 4DV7E 2B3TB 2EP3A 1X5WA 5KL3A 1QU6A 4NXME 2EOHA 2EOMA 2F8BA 5AC5A 2NA2A 2CSHA 5IV8B 2EOYA 1IQSA 4JI1E 2EN7A 3HXLA 4MLQA 5A6KA 4I8OA 5LMUE 2EQ0A 2YU5A 2JOBA 2EMKA 2HC5A 3VHTB 5KL7A 2ZM6E 2YT4A 2YTEA 5AE2A 2DMIA 4Q35B 1TF6A 2EOXA 1IBKE 1EH8A 2EPNA 1JK2A 4DV3E 1YUIA 5IWAE 2V89A 4TUIA 2EPZA 1HR0E 2L8TA 4DV6E 2YTGA 1N32E 1N3GA 4KHPE 1WHQA 4X9JA 1UBDC 4BCAA 2EL6A 4BBYA 2YRMA 2EN8A 1YYWA 1YPNA 2WBUA 2RSIA 2LMZA 1N36E 4BMJA 2NUFA 2I13A 4L8NA 1IBME 2LO3A 2EPKX 4KWYA 1EH6A 2EMXA 2YTJA 4B3SE 3KZYA 1A1FA 3C6KA 5DNYA 4JI8E 4X8WA 4F9AB 2J7JA 1KJKA 4MLVA 2EOOA 2ODRD 2GLIA 1T4LB 3LMLA 1SFEA 1HNZE 1WRJA 4LFBE 2A25A 1ZR9A 3DF6A 2F4VE 4ZYHA 4M0VA 4GKJE 4NZVA 2EMHA 3VK6A 2H36X 2GPIA 1P47A 2YTIA 2EZ6A 1XMOE 2B7VA 2EOSA 2FV4B 1T39A 3M99B 3ADIA 4JI6E 2UUAE 2NABA 4LF6E 4WFTA 2L3CA 2YTNA 4R2EA 1GTKA 1YSAC 2EQ1A 3EPHA 1X6HA 1I94E 2VRDA 4OX9E 1DI2A 4BHBA 4JI0E 3VYYA 2VQEE 2EMZA 2UU9E 1ZU1A 2EOZA 1BB8A 2JR1A 4P7DA 1WXRA 2WBTA 3JAMC 2HJJA 3JU0A 2V87A 4DMIA 2L33A 1A1KA 3FIGA 4HTGA 4JI7E 1ZBQA 1F2IG 2CT1A 2YRHA 2EN3A 5KL4A 1GQEA 2LCEA 2E72A 2D9HA 2EMWA 1KYQA 1JK1A 2DSYA 4DV4E 2LRSA 4GZNC 4F54A 5A69A 2MC6A 4JYAE 2YTDA 1PJSA 2EWLA 5A6BD 3T1YE 3J80C 5LLQA 2JPAA 2VQFE 1A1GA 3ADJA 2L2KB 1DGCA 4JI3E 1X47A 4YHHE 1FJGE 4OOGC 4B3ME 1WJPA 1UILA 4BHCA 2L92A 2NUGA 4J8ZA 2DMYA 2LJHA 2EN2A 1T4OA 3C6MA 5LL6R 2JXPA 4ZYDA 3EPKA 2IHR1 2EJ4A 3MSWA 5AE1A 3BF2A 4F2JC 4WSPA 4BC7A 4X64E 4DUZE 4WX9A 1A1JA 5BR8E 2L6MA 1MGTA 2RPCA 4RH8A 3TQMA 4JI4E 1T4NA 2I9IA 5FLXC 1ZBTA 2R1FA 2EMYA 2KOUA 2WZOA 4WXCA 3IWCA 2R76A 4WPYA 1YYOA 5AASA 1GZ6A 2ADRA 4LU9A 4LF7E 2LBSB 2CPNA 2LE2A 2DLKA 2ODRC 1RC7A 1BBOA 3UK3C 4KZSA 4R2DA 2RS7A 4R2QA 2ELZA 5CFFE 3OMLA 4RHBB 2FGGA 4WSGA 4R2RA 2DGCA 4BC9A 3ADGA 3IWDA 4X66E 2MKDA 4R2AA 3HTXA 2EOIA 1PKPA 1RQ0A 2K7IA 2K4VA 3C4BA 2EPUA
chains in the Genus database with same CATH topology
1I94E 1XNRE 2UXDE 1J26A 2LUQA 1DI2A 4OX9E 4JI0E 4TUGA 4DR5E 4F9CB 3VYYA 4GEQB 2VQEE 1EKZA 2UU9E 2V85A 1X49A 1WHNA 5ADZA 4DV7E 1N34E 2B3TB 2JR1A 1X48A 2KONA 4P7DA 2M4IA 3ZOQB 1WXRA 3JAMC 1QU6A 4NXME 2V86A 2F8BA 4R03A 4JI5E 4AQYE 2NA2A 3JU0A 2MC5A 2V87A 2VF1A 4DMIA 2V8QB 2L33A 4JI1E 3HXLA 3HQ1A 1IBLE 4DR4E 3FIGA 4LTYA 4DKKA 4JI7E 4I8OA 1ZBQA 5LMUE 1DQ3A 1XMQE 4B3RE 2B7TA 2JOBA 4LFAE 4DV5E 3HPSA 4X65E 2YT4A 5A2QC 1GQEA 4M30A 2ZM6E 4DV0E 4Q28A 4DR2E 1J5EE 5AE2A 4DUYE 2DSYA 4DV2E 2LRSA 4DV4E 4F54A 4YY3E 2MC6A 4JYAE 3J81C 4JI2E 2EWLA 3T1YE 1IBKE 3J80C 3ADLA 2VQFE 3ADJA 2L2KB 4JI3E 2UUCE 1X47A 4YHHE 4DV3E 1FJGE 5IWAE 4OOGC 2V89A 4TUIA 4DV1E 3HPZA 1HR0E 4B3ME 1XNQE 5LMNE 2L8TA 1UILA 2JY9A 4DV6E 1N32E 4DR6E 4KHPE 2L92A 3K6QA 1WHQA 2FTXB 4F9BB 1N33E 2NUGA 2LTRA 4J8ZA 2RSMA 2DMYA 3RMPA 2LJHA 4BCAA 1FKAE 1T4OA 4BBYA 5LL6R 3AUZA 4WYQB 2DIXA 1YYWA 2L3JA 4M2ZA 2IHR1 3MSWA 4LFCE 2N3GA 4NXNE 2LMZA 2NUEA 1N36E 2DB2A 4BMJA 3JTZA 2G7HA 2RTXA 5AE1A 2NUFA 4GKKE 4WSPA 2B9DA 2JVAA 4P78A 4BC7A 4L8NA 4DR1E 1IBME 4X64E 1UHZA 3OTOE 4DUZE 4LF9E 4K0KE 2YZTA 2KHXA 5BR8E 2V88A 2L6MA 4DR7E 4B3SE 4JI4E 2JOXA 1T4NA 1YZ9A 5IT9C 3H09A 1HNWE 1O0WA 1ZBTA 5DNYA 5FLXC 2UXBE 5AE3A 2KOUA 2WZOA 3T1HE 2N3HA 4JI8E 2UUBE 3J7AG 3KWRA 3DJWA 3IWCA 4WPYA 4X8WA 2M7QA 1YYOA 4F9AB 5AASA 1STUA 1GZ6A 1SR9A 4LF4E 4LU9A 3AV0A 2ODRD 4X62E 3LLHA 2LBSB 2CPNA 2LE2A 5T6JA 2ODRC 1T4LB 4LF7E 1RC7A 3LMLA 2E1MA 1HNZE 4KZSA 4LFBE 2RS7A 5F3WA 4LF8E 3DF6A 1HNXE 4R8OA 2F4VE 5CFFE 2LUPB 2V83A 2UXCE 4M0VA 4GKJE 2VE7C 3IWBA 3P1XA 3OMLA 2E5LE 3VK6A 2M1SA 2FGGA 2H36X 2MDRA 4BC9A 3ADGA 2EZ6A 1XMOE 2B7VA 2FV4B 3IWDA 4X66E 4BS9A 4B3TE 4DR3E 3F6GA 3HTXA 3ADIA 1PKPA 4JI6E 1RQ0A 2UUAE 3C4TA 4LF5E 2L2NA 2HHHE 1YYKA 3VYXA 3F6HA 4LF6E 2JWOA 4WFTA 2L3CA 3J7Yp 4JV5E 2K4VA 3C4BA 2RS6A 2L2MA 2LTSA 4L5NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 E;  1XNR E;  2UXD E;  1J26 A;  2LUQ A;  1DI2 A;  4OX9 E;  4JI0 E;  4DR5 E;  3VYY A;  2VQE E;  1EKZ A;  2UU9 E;  1X49 A;  1WHN A;  4DV7 E;  1N34 E;  2B3T B;  1X48 A;  1QU6 A;  4NXM E;  4JI5 E;  4AQY E;  2NA2 A;  4JI1 E;  2L33 A;  1IBL E;  4DR4 E;  4DKK A;  4JI7 E;  5LMU E;  1XMQ E;  4B3R E;  2B7T A;  4LFA E;  4DV5 E;  4X65 E;  2YT4 A;  2ZM6 E;  1GQE A;  4M30 A;  4DV0 E;  4DR2 E;  1J5E E;  4DUY E;  4DV2 E;  2LRS A;  4DV4 E;  4YY3 E;  4JYA E;  4JI2 E;  3ADL A;  3T1Y E;  1IBK E;  2VQF E;  3ADJ A;  2L2K B;  4JI3 E;  2UUC E;  1X47 A;  4YHH E;  4DV3 E;  1FJG E;  5IWA E;  4OOG C;  4DV1 E;  1HR0 E;  1XNQ E;  4B3M E;  5LMN E;  1UIL A;  2JY9 A;  4DV6 E;  1N32 E;  4DR6 E;  4KHP E;  1WHQ A;  1N33 E;  2NUG A;  2LTR A;  2RSM A;  2DMY A;  2LJH A;  1FKA E;  1T4O A;  4WYQ B;  2DIX A;  1YYW A;  2L3J A;  4M2Z A;  2IHR 1;  4LFC E;  2N3G A;  4NXN E;  2NUE A;  1N36 E;  2DB2 A;  4GKK E;  2RTX A;  2NUF A;  2JVA A;  4DR1 E;  1IBM E;  4X64 E;  1UHZ A;  3OTO E;  4DUZ E;  4LF9 E;  4K0K E;  2KHX A;  5BR8 E;  4DR7 E;  4B3S E;  4JI4 E;  1T4N A;  1YZ9 A;  2UXB E;  1O0W A;  1ZBT A;  3T1H E;  2N3H A;  4JI8 E;  2UUB E;  4X8W A;  1YYO A;  1STU A;  4LF4 E;  4LF7 E;  4X62 E;  3LLH A;  2LBS B;  2CPN A;  1T4L B;  1RC7 A;  1HNZ E;  4LFB E;  2RS7 A;  4LF8 E;  1HNX E;  2F4V E;  2UXC E;  5CFF E;  2LUP B;  4GKJ E;  3P1X A;  2E5L E;  2MDR A;  3ADG A;  2EZ6 A;  1XMO E;  2B7V A;  4X66 E;  4B3T E;  4DR3 E;  3HTX A;  3ADI A;  1PKP A;  4JI6 E;  1RQ0 A;  2UUA E;  3C4T A;  4LF5 E;  2L2N A;  2HHH E;  1YYK A;  3VYX A;  4LF6 E;  4WFT A;  2L3C A;  3J7Y p;  4JV5 E;  3C4B A;  2RS6 A;  2L2M A;  2LTS A;  1HNW E; 
#chains in the Genus database with same CATH topology
 1XNR E;  1J26 A;  2UXD E;  4NHR A;  2EN1 A;  4HEI A;  1X3C A;  4GEQ B;  2PRT A;  2YTP A;  1PJQ A;  2EL4 A;  2EN6 A;  2V85 A;  1AH5 A;  2EM5 A;  2M4I A;  4R2P A;  4R03 A;  4AQY E;  2M9A A;  2MC5 A;  2V8Q B;  5A6J A;  1IBL E;  3HQ1 A;  4DR4 E;  4DKK A;  2BB8 A;  1XMQ E;  2B7T A;  3BBG A;  2EML A;  2EOQ A;  1G2D C;  4DV5 E;  4ZYG A;  4X65 E;  2EM8 A;  4M30 A;  4DV0 E;  2EOR A;  2EN4 A;  1J5E E;  1QNT A;  4DV2 E;  3MHS C;  4YY3 E;  2LT7 A;  2UUC E;  4IJD A;  4R2C A;  1XNQ E;  4O5G A;  2EM0 A;  1B69 A;  3K6Q A;  4F9B B;  2ENC A;  1FKA E;  1L4S A;  3THN A;  3AUZ A;  4WYQ B;  2L3J A;  3KZZ A;  4LFC E;  2N3G A;  4NXN E;  2DB2 A;  1PDA A;  4M9V C;  4DR1 E;  2EPM X;  3OTO E;  4K0K E;  2YZT A;  2V88 A;  4DR7 E;  2JOX A;  4FK5 C;  1T38 A;  3H09 A;  1O0W A;  1EH7 A;  2HGH A;  5AE3 A;  2EMA A;  3T1H E;  2N3H A;  2N8X A;  3DJW A;  2M7Q A;  4O4K A;  1SR9 A;  4X62 E;  2EPP A;  2LJU A;  4LF8 E;  2YWQ A;  2UXC E;  2LUP B;  2YTF A;  2EMB A;  3IWB A;  3P1X A;  2YSO A;  2EOE A;  2E5L E;  2M1S A;  2MDR A;  4BS9 A;  4B3T E;  2CTD A;  3F6G A;  5TSE A;  1YUJ A;  3C4T A;  2L2N A;  2HHH E;  3VYX A;  5AC4 A;  4R2S A;  1MEY C;  4F6M A;  2L2M A;  2LTS A;  3THO B;  1HNW E;  5IXM B;  4TUG A;  5KL6 A;  1EKZ A;  2EM6 A;  1X49 A;  2EM2 A;  5ADZ A;  1X48 A;  1UN6 B;  2KON A;  5KL2 A;  3ZOQ B;  4O43 A;  1IQO A;  3EPJ A;  2EM3 A;  2V86 A;  4JI5 E;  2VF1 A;  2JYA A;  2YRK A;  4LTY A;  2EPC A;  1A1I A;  1DQ3 A;  4B3R E;  4LFA E;  2GHF A;  1TF3 A;  3HPS A;  5A2Q C;  2WCC 3;  4DR2 E;  4Q28 A;  4DUY E;  2EOJ A;  2EMI A;  2DLQ A;  3J81 C;  4JI2 E;  3ADL A;  3MHH C;  4DV1 E;  2ENH A;  3HPZ A;  3ECR A;  5LMN E;  1TN9 A;  4IS1 C;  2JY9 A;  1Z1B A;  4DR6 E;  1BBG A;  1NCS A;  2EM7 A;  2FTX B;  1N33 E;  2LTR A;  2RSM A;  2EMC A;  3RMP A;  4O24 A;  2MKN A;  2EMG A;  2LVH A;  1X6F A;  2YU8 A;  2DIX A;  4M2Z A;  2NUE A;  2EQ3 A;  4GKK E;  3JTZ A;  2G7H A;  2RTX A;  4F6N A;  3EPL A;  2B9D A;  2JVA A;  2YTQ A;  4P78 A;  2EPO A;  2EPA A;  2EOF A;  2YSP A;  2EPX A;  1UHZ A;  4LF9 E;  2KHX A;  1A1H A;  1YZ9 A;  5IT9 C;  1PJT A;  2UXB E;  2EE8 A;  2Q8U A;  2UUB E;  3J7A G;  1AAY A;  2EMF A;  2EPL X;  3KWR A;  2YTO A;  1STU A;  4LF4 E;  3AV0 A;  3LLH A;  5T6J A;  5A6B A;  2LV2 A;  2E1M A;  5F3W A;  1NEI A;  1HNX E;  4R8O A;  2V83 A;  2ENA A;  2EM9 A;  2VE7 C;  4WXD A;  5KL5 A;  2MDG A;  1LLM C;  2RQL A;  1RMD A;  2WBS A;  1X6E A;  4N4R B;  4DR3 E;  3BGH A;  4ZYE A;  2EPR A;  4LF5 E;  1YYK A;  2EM4 A;  1ZAA C;  3F6H A;  2JWO A;  1G2F C;  2BBG A;  3BID A;  3EQ1 A;  3J7Y p;  2YPN A;  4JV5 E;  2RS6 A;  2DRP A;  4L5N C;  1YFH A;  2JP9 A;  2LUQ A;  1IMU A;  3QG5 C;  4DR5 E;  4F9C B;  3L00 A;  5A6A A;  2ELY A;  2EL5 A;  1A1L A;  1N34 E;  1WHN A;  4DV7 E;  2B3T B;  2EP3 A;  1X5W A;  5KL3 A;  1QU6 A;  4NXM E;  2EOH A;  2EOM A;  2F8B A;  5AC5 A;  2NA2 A;  2CSH A;  5IV8 B;  2EOY A;  1IQS A;  4JI1 E;  2EN7 A;  3HXL A;  4MLQ A;  5A6K A;  4I8O A;  5LMU E;  2EQ0 A;  2YU5 A;  2JOB A;  2EMK A;  2HC5 A;  3VHT B;  5KL7 A;  2ZM6 E;  2YT4 A;  2YTE A;  5AE2 A;  2DMI A;  4Q35 B;  1TF6 A;  2EOX A;  1IBK E;  1EH8 A;  2EPN A;  1JK2 A;  4DV3 E;  1YUI A;  5IWA E;  2V89 A;  4TUI A;  2EPZ A;  1HR0 E;  2L8T A;  4DV6 E;  2YTG A;  1N32 E;  1N3G A;  4KHP E;  1WHQ A;  4X9J A;  1UBD C;  4BCA A;  2EL6 A;  4BBY A;  2YRM A;  2EN8 A;  1YYW A;  1YPN A;  2WBU A;  2RSI A;  2LMZ A;  1N36 E;  4BMJ A;  2NUF A;  2I13 A;  4L8N A;  1IBM E;  2LO3 A;  2EPK X;  4KWY A;  1EH6 A;  2EMX A;  2YTJ A;  4B3S E;  3KZY A;  1A1F A;  3C6K A;  5DNY A;  4JI8 E;  4X8W A;  4F9A B;  2J7J A;  1KJK A;  4MLV A;  2EOO A;  2ODR D;  2GLI A;  1T4L B;  3LML A;  1SFE A;  1HNZ E;  1WRJ A;  4LFB E;  2A25 A;  1ZR9 A;  3DF6 A;  2F4V E;  4ZYH A;  4M0V A;  4GKJ E;  4NZV A;  2EMH A;  3VK6 A;  2H36 X;  2GPI A;  1P47 A;  2YTI A;  2EZ6 A;  1XMO E;  2B7V A;  2EOS A;  2FV4 B;  1T39 A;  3M99 B;  3ADI A;  4JI6 E;  2UUA E;  2NAB A;  4LF6 E;  4WFT A;  2L3C A;  2YTN A;  4R2E A;  1GTK A;  1YSA C;  2EQ1 A;  3EPH A;  1X6H A;  1I94 E;  2VRD A;  4OX9 E;  1DI2 A;  4BHB A;  4JI0 E;  3VYY A;  2VQE E;  2EMZ A;  2UU9 E;  1ZU1 A;  2EOZ A;  1BB8 A;  2JR1 A;  4P7D A;  1WXR A;  2WBT A;  3JAM C;  2HJJ A;  3JU0 A;  2V87 A;  4DMI A;  2L33 A;  1A1K A;  3FIG A;  4HTG A;  4JI7 E;  1ZBQ A;  1F2I G;  2CT1 A;  2YRH A;  2EN3 A;  5KL4 A;  1GQE A;  2LCE A;  2E72 A;  2D9H A;  2EMW A;  1KYQ A;  1JK1 A;  2DSY A;  4DV4 E;  2LRS A;  4GZN C;  4F54 A;  5A69 A;  2MC6 A;  4JYA E;  2YTD A;  1PJS A;  2EWL A;  5A6B D;  3T1Y E;  3J80 C;  5LLQ A;  2JPA A;  2VQF E;  1A1G A;  3ADJ A;  2L2K B;  1DGC A;  4JI3 E;  1X47 A;  4YHH E;  1FJG E;  4OOG C;  4B3M E;  1WJP A;  1UIL A;  4BHC A;  2L92 A;  2NUG A;  4J8Z A;  2DMY A;  2LJH A;  2EN2 A;  1T4O A;  3C6M A;  5LL6 R;  2JXP A;  4ZYD A;  3EPK A;  2IHR 1;  2EJ4 A;  3MSW A;  5AE1 A;  3BF2 A;  4F2J C;  4WSP A;  4BC7 A;  4X64 E;  4DUZ E;  4WX9 A;  1A1J A;  5BR8 E;  2L6M A;  1MGT A;  2RPC A;  4RH8 A;  3TQM A;  4JI4 E;  1T4N A;  2I9I A;  5FLX C;  1ZBT A;  2R1F A;  2EMY A;  2KOU A;  2WZO A;  4WXC A;  3IWC A;  2R76 A;  4WPY A;  1YYO A;  5AAS A;  1GZ6 A;  2ADR A;  4LU9 A;  4LF7 E;  2LBS B;  2CPN A;  2LE2 A;  2DLK A;  2ODR C;  1RC7 A;  1BBO A;  3UK3 C;  4KZS A;  4R2D A;  2RS7 A;  4R2Q A;  2ELZ A;  5CFF E;  3OML A;  4RHB B;  2FGG A;  4WSG A;  4R2R A;  2DGC A;  4BC9 A;  3ADG A;  3IWD A;  4X66 E;  2MKD A;  4R2A A;  3HTX A;  2EOI A;  1PKP A;  1RQ0 A;  2K7I A;  2K4V A;  3C4B A;  2EPU A; 
#chains in the Genus database with same CATH homology
 1I94 E;  1XNR E;  2UXD E;  1J26 A;  2LUQ A;  1DI2 A;  4OX9 E;  4JI0 E;  4TUG A;  4DR5 E;  4F9C B;  3VYY A;  4GEQ B;  2VQE E;  1EKZ A;  2UU9 E;  2V85 A;  1X49 A;  1WHN A;  5ADZ A;  4DV7 E;  1N34 E;  2B3T B;  2JR1 A;  1X48 A;  2KON A;  4P7D A;  2M4I A;  3ZOQ B;  1WXR A;  3JAM C;  1QU6 A;  4NXM E;  2V86 A;  2F8B A;  4R03 A;  4JI5 E;  4AQY E;  2NA2 A;  3JU0 A;  2MC5 A;  2V87 A;  2VF1 A;  4DMI A;  2V8Q B;  2L33 A;  4JI1 E;  3HXL A;  3HQ1 A;  1IBL E;  4DR4 E;  3FIG A;  4LTY A;  4DKK A;  4JI7 E;  4I8O A;  1ZBQ A;  5LMU E;  1DQ3 A;  1XMQ E;  4B3R E;  2B7T A;  2JOB A;  4LFA E;  4DV5 E;  3HPS A;  4X65 E;  2YT4 A;  5A2Q C;  1GQE A;  4M30 A;  2ZM6 E;  4DV0 E;  4Q28 A;  4DR2 E;  1J5E E;  5AE2 A;  4DUY E;  2DSY A;  4DV2 E;  2LRS A;  4DV4 E;  4F54 A;  4YY3 E;  2MC6 A;  4JYA E;  3J81 C;  4JI2 E;  2EWL A;  3T1Y E;  1IBK E;  3J80 C;  3ADL A;  2VQF E;  3ADJ A;  2L2K B;  4JI3 E;  2UUC E;  1X47 A;  4YHH E;  4DV3 E;  1FJG E;  5IWA E;  4OOG C;  2V89 A;  4TUI A;  4DV1 E;  3HPZ A;  1HR0 E;  4B3M E;  1XNQ E;  5LMN E;  2L8T A;  1UIL A;  2JY9 A;  4DV6 E;  1N32 E;  4DR6 E;  4KHP E;  2L92 A;  3K6Q A;  1WHQ A;  2FTX B;  4F9B B;  1N33 E;  2NUG A;  2LTR A;  4J8Z A;  2RSM A;  2DMY A;  3RMP A;  2LJH A;  4BCA A;  1FKA E;  1T4O A;  4BBY A;  5LL6 R;  3AUZ A;  4WYQ B;  2DIX A;  1YYW A;  2L3J A;  4M2Z A;  2IHR 1;  3MSW A;  4LFC E;  2N3G A;  4NXN E;  2LMZ A;  2NUE A;  1N36 E;  2DB2 A;  4BMJ A;  3JTZ A;  2G7H A;  2RTX A;  5AE1 A;  2NUF A;  4GKK E;  4WSP A;  2B9D A;  2JVA A;  4P78 A;  4BC7 A;  4L8N A;  4DR1 E;  1IBM E;  4X64 E;  1UHZ A;  3OTO E;  4DUZ E;  4LF9 E;  4K0K E;  2YZT A;  2KHX A;  5BR8 E;  2V88 A;  2L6M A;  4DR7 E;  4B3S E;  4JI4 E;  2JOX A;  1T4N A;  1YZ9 A;  5IT9 C;  3H09 A;  1HNW E;  1O0W A;  1ZBT A;  5DNY A;  5FLX C;  2UXB E;  5AE3 A;  2KOU A;  2WZO A;  3T1H E;  2N3H A;  4JI8 E;  2UUB E;  3J7A G;  3KWR A;  3DJW A;  3IWC A;  4WPY A;  4X8W A;  2M7Q A;  1YYO A;  4F9A B;  5AAS A;  1STU A;  1GZ6 A;  1SR9 A;  4LF4 E;  4LU9 A;  3AV0 A;  2ODR D;  4X62 E;  3LLH A;  2LBS B;  2CPN A;  2LE2 A;  5T6J A;  2ODR C;  1T4L B;  4LF7 E;  1RC7 A;  3LML A;  2E1M A;  1HNZ E;  4KZS A;  4LFB E;  2RS7 A;  5F3W A;  4LF8 E;  3DF6 A;  1HNX E;  4R8O A;  2F4V E;  5CFF E;  2LUP B;  2V83 A;  2UXC E;  4M0V A;  4GKJ E;  2VE7 C;  3IWB A;  3P1X A;  3OML A;  2E5L E;  3VK6 A;  2M1S A;  2FGG A;  2H36 X;  2MDR A;  4BC9 A;  3ADG A;  2EZ6 A;  1XMO E;  2B7V A;  2FV4 B;  3IWD A;  4X66 E;  4BS9 A;  4B3T E;  4DR3 E;  3F6G A;  3HTX A;  3ADI A;  1PKP A;  4JI6 E;  1RQ0 A;  2UUA E;  3C4T A;  4LF5 E;  2L2N A;  2HHH E;  1YYK A;  3VYX A;  3F6H A;  4LF6 E;  2JWO A;  4WFT A;  2L3C A;  3J7Y p;  4JV5 E;  2K4V A;  3C4B A;  2RS6 A;  2L2M A;  2LTS A;  4L5N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...