2RSMA

Solution structure and sirna-mediated knockdown analysis of the mitochondrial disease-related protein c12orf65 (ict2)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
GSSGSSGKWGLRLQEKPALLFPGMAASTVQVAGRKDYPALLPLNESELEEQFVKGHGPGGQATNKTSNCVVLKHVPSGIVVKCHQTRSVDQNRKIARKVLQEKVDVFYNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Probable peptide chain release factor C12orf65 homolog, mito
publication title Solution structure and siRNA-mediated knockdown analysis of the mitochondrial disease-related protein C12orf65.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rsmA00
2UXDE 1N34E 1T4LB 1FJGE 4DV3E 1O0WA 1XMOE 1PKPA 2L33A 2JY9A 4JYAE 1UHZA 1T4NA 1J26A 5LMNE 5BR8E 4JI8E 2UUAE 2L2MA 5LMUE 4JI0E 1YYKA 4LF6E 2LJHA 4LF4E 4LF7E 2L2KB 4B3TE 1HR0E 4OX9E 4DV4E 1N32E 4DV0E 1XNQE 2F4VE 1HNWE 2RS7A 4AQYE 4NXNE 2L3CA 2UXCE 3ADJA 4X8WA 2MDRA 4B3ME 1I94E 2NUFA 2NUGA 3OTOE 4DUYE 3J7Yp 4NXME 4JI7E 2N3HA 3C4TA 3T1HE 2UU9E 1WHNA 3ADIA 1EKZA 1J5EE 2NA2A 1IBKE 4JI5E 4M30A 2UUCE 4YHHE 1YZ9A 4K0KE 2JVAA 4DR4E 1YYOA 4LFBE 3P1XA 2LRSA 2L3JA 1RQ0A 2VQEE 4LF8E 2RS6A 2B7TA 4DV6E 4LFAE 2B7VA 1N33E 4JI3E 2LUPB 4DR5E 1HNZE 1X47A 4WFTA 2UUBE 4JI4E 2DMYA 2VQFE 1DI2A 4B3SE 2L2NA 4LF5E 2YT4A 2EZ6A 3ADLA 4JV5E 2KHXA 1N36E 4X62E 1ZBTA 1RC7A 2LTSA 4X65E 4X66E 2RTXA 1YYWA 4X64E 4DV5E 2N3GA 3VYYA 3LLHA 2IHR1 4DV7E 2RSMA 4DV2E 2ZM6E 2E5LE 3VYXA 4DR2E 4DKKA 2LTRA 4KHPE 2LUQA 1IBLE 2NUEA 2HHHE 1X48A 4GKJE 1XMQE 1FKAE 2DB2A 1X49A 1STUA 2LBSB 2B3TB 4DR1E 4JI2E 1WHQA 4LF9E 2DIXA 1UILA 4JI6E 3C4BA 4OOGC 4LFCE 4DUZE 1XNRE 4YY3E 4JI1E 4M2ZA 3ADGA 4DV1E 4DR3E 2UXBE 1IBME 5CFFE 1HNXE 4B3RE 4DR7E 1T4OA 1GQEA 5IWAE 3HTXA 4DR6E 2CPNA 4GKKE 1QU6A 3T1YE 4WYQB
chains in the Genus database with same CATH superfamily
1O0WA 1PKPA 4BCAA 2JY9A 1UHZA 5AC5A 1L4SA 4L5NC 3DJWA 1A1GA 5DNYA 1PJTA 2EN7A 3HPZA 4F9CB 3VHTB 5T6JA 3AV0A 2YTIA 1RMDA 2EOIA 4ZYGA 2H36X 2MDRA 4F2JC 1I94E 2JOBA 2NUGA 3OTOE 3J7Yp 5AE3A 4JI7E 3ADIA 2EM2A 2EMZA 1GTKA 2WCC3 1Z1BA 2EM6A 2EE8A 4YHHE 1T38A 4F9BB 4R2CA 4WPYA 2M7QA 3EPHA 2EOJA 3IWDA 2EL4A 4R2QA 2YTEA 2EPAA 5KL4A 2VQEE 1ZR9A 2EMYA 2PRTA 1AAYA 1N33E 2EQ0A 1GZ6A 3HPSA 1X47A 2HGHA 2EL6A 2E72A 4LU9A 4B3SE 2EZ6A 4R2DA 1B69A 3HQ1A 3JAMC 1RC7A 2BB8A 1X3CA 4O4KA 3KZZA 2EMHA 1IMUA 4KZSA 2EWLA 2N3GA 3VYYA 2IHR1 4DV7E 1ZAAC 4NZVA 1LLMC 2ZM6E 2MC6A 4RH8A 2WBUA 4DR2E 2LUQA 2MDGA 4NHRA 5KL3A 2EM4A 2FTXB 2LO3A 1PDAA 1X48A 4GKJE 2EM3A 2LBSB 1WRJA 2D9HA 1TN9A 2Q8UA 1WHQA 2L6MA 2LCEA 2DIXA 2R1FA 5KL6A 2MC5A 1X6HA 2EPPA 4HTGA 2EMKA 5LL6R 4OOGC 4BC9A 4DUZE 2ENHA 2YRKA 4JI1E 4DV1E 2EM5A 1A1IA 1HNXE 4BS9A 2DSYA 1T4OA 2EN1A 2YU5A 2LE2A 1YUJA 1X5WA 2YTJA 1YUIA 3KWRA 1A1LA 3T1YE 3BGHA 1SFEA 2EN4A 2EN3A 1T4LB 1N34E 3L00A 4DV3E 1XMOE 2YRHA 1P47A 1T4NA 2EOEA 2EM8A 2N8XA 2EPUA 4ZYHA 2L2KB 1HR0E 4DV0E 2RS7A 2V87A 2EMXA 3ADJA 2JWOA 4B3ME 1IQOA 2EN8A 5A69A 2EOOA 4DUYE 5IV8B 3T1HE 2UU9E 5AC4A 4GEQB 5A6KA 3THOB 4JI5E 2VRDA 4R2AA 4M30A 2UUCE 2EMBA 4X9JA 3ZOQB 1NCSA 2V85A 4DR4E 4LFBE 3H09A 3RMPA 3P1XA 2LRSA 1EH8A 2YSPA 1F2IG 1AH5A 2A25A 5IXMB 3HXLA 2RS6A 2B7TA 4JI3E 4IJDA 3EPJA 4WFTA 1NEIA 2DMYA 2VE7C 2EMCA 2VQFE 4ZYDA 2F8BA 4JV5E 2KHXA 1N36E 4P78A 3BBGA 4MLVA 2R76A 4O5GA 4X66E 4F6NA 2RTXA 2WBTA 2YTGA 2DMIA 2EPXA 2B9DA 4X64E 3C6MA 2V8QB 4FK5C 2V83A 4DV5E 4GZNC 4DV2E 2DGCA 2E5LE 4R2EA 3VYXA 2RQLA 4KHPE 5IT9C 2MKNA 3F6GA 2YTFA 2NUEA 3IWCA 4LTYA 2DB2A 2EQ3A 1X49A 2EOXA 2B3TB 2JP9A 5AASA 1A1HA 5A6BD 2KONA 2EOSA 1UILA 2JPAA 2EPOA 2EM7A 4F54A 4YY3E 1PJQA 4WSGA 2CT1A 3ADGA 4TUGA 2G7HA 4DR3E 2EM0A 1IBME 5CFFE 2EPCA 5AE2A 1MGTA 2FGGA 1GQEA 2EPRA 4R2RA 2CPNA 2UXDE 2EOHA 2V86A 3KZYA 2JOXA 2M9AA 1QNTA 5LMNE 5BR8E 3EQ1A 4WX9A 3JU0A 2UUAE 5LMUE 2DRPA 1YPNA 2LJHA 4LF4E 4LF7E 1JK1A 4B3TE 2ODRD 4OX9E 3BF2A 1N32E 2ODRC 1XNQE 2F4VE 4AQYE 1HNWE 1BBOA 1DQ3A 3MSWA 4X8WA 5KL5A 3K6QA 2ENAA 1IQSA 4I8OA 2EPMX 4R2SA 2NA2A 4BHCA 4WSPA 1YFHA 1IBKE 1YZ9A 4K0KE 2EP3A 1SR9A 2EOFA 3LMLA 2L3JA 2EPLX 4Q35B 1RQ0A 4RHBB 4LFAE 5AE1A 4BC7A 2B7VA 5LLQA 3QG5C 1HNZE 2UUBE 1DGCA 2EN6A 1DI2A 3J81C 2YZTA 2V88A 1A1JA 2GPIA 1WJPA 4LF5E 3ADLA 1JK2A 2LJUA 2EMAA 4X62E 2LTSA 4X65E 2FV4B 2I13A 4BMJA 1YYWA 2MKDA 1ZBQA 4R8OA 1A1KA 3MHSC 2EOQA 2HC5A 5TSEA 2WZOA 2YTQA 1KJKA 2JXPA 2LV2A 1IBLE 3EPKA 4KWYA 1EH7A 2HHHE 2M1SA 4M9VC 2EMFA 1FKAE 1MEYC 1STUA 1WXRA 2CTDA 4JI2E 2YTNA 2DLKA 4LF9E 2YWQA 2JYAA 1UN6B 4JI6E 3C4BA 1ZU1A 2M4IA 2LMZA 5A6AA 2EOZA 2K7IA 2EM9A 2EJ4A 3TQMA 2EN2A 2UXBE 1N3GA 2E1MA 4B3RE 3DF6A 2ELYA 2EPKX 3ECRA 5IWAE 2L8TA 2YRMA 4DR6E 4GKKE 1QU6A 4WYQB 2YTOA 2ENCA 3F6HA 4BBYA 2K4VA 1FJGE 2ELZA 2L33A 2GLIA 2V89A 4JYAE 1J26A 2DLQA 2EOMA 4O24A 2VF1A 5A6BA 1X6FA 2ADRA 4JI8E 2L2MA 2LVHA 4JI0E 1YYKA 2RPCA 4LF6E 4M0VA 4DV4E 2EL5A 2EQ1A 4NXNE 2L3CA 2UXCE 3JTZA 2NUFA 4NXME 2N3HA 3IWBA 3C4TA 1PJSA 1WHNA 2EORA 2JR1A 4R03A 5KL7A 2KOUA 1EKZA 1J5EE 3M99B 4BHBA 2JVAA 3UK3C 1YYOA 3BIDA 3THNA 2GHFA 3AUZA 1X6EA 4Q28A 4LF8E 4DV6E 3OMLA 2LUPB 5A2QC 4DR5E 4J8ZA 5FLXC 2CSHA 4JI4E 3EPLA 3J7AG 4WXDA 4L8NA 2L2NA 3C6KA 2L92A 3MHHC 2YT4A 2EMGA 3VK6A 1ZBTA 3FIGA 2EPZA 4TUIA 4IS1C 2EMWA 2WBSA 4DMIA 4N4RB 4F9AB 4F6MA 4MLQA 3LLHA 1KYQA 4WXCA 2RSMA 1BB8A 1T39A 5ADZA 2EMLA 2HJJA 4HEIA 2LTRA 4DKKA 2BBGA 4P7DA 1YSAC 2YPNA 2EPNA 4O43A 1XMQE 4DR1E 2YSOA 2RSIA 2YTDA 1BBGA 4ZYEA 5F3WA 2J7JA 4LFCE 2NABA 1XNRE 1G2FC 1EH6A 5A6JA 4R2PA 2I9IA 5KL2A 4M2ZA 1TF6A 1A1FA 2LT7A 2EMIA 2YTPA 2YU8A 4DR7E 1G2DC 1UBDC 1TF3A 3HTXA 2EOYA 3J80C
chains in the Genus database with same CATH topology
2UXDE 1N34E 2V86A 3F6HA 4BBYA 1T4LB 2K4VA 1FJGE 4DV3E 1O0WA 2JOXA 1XMOE 1PKPA 2L33A 4BCAA 2JY9A 2V89A 4JYAE 1UHZA 1T4NA 1J26A 5LMNE 5BR8E 4L5NC 3DJWA 5DNYA 3HPZA 2VF1A 4F9CB 3JU0A 4JI8E 2UUAE 2L2MA 5LMUE 4JI0E 4B3ME 1YYKA 4LF6E 2NUGA 2LJHA 4LF4E 4LF7E 4M0VA 5T6JA 3AV0A 2L2KB 2ODRD 1HR0E 4B3TE 4OX9E 4DV4E 1N32E 4DV0E 2ODRC 1XNQE 2F4VE 2RS7A 2V87A 4AQYE 1HNWE 4NXNE 1DQ3A 2L3CA 2UXCE 3MSWA 3ADJA 2JWOA 4X8WA 2H36X 2MDRA 3JTZA 3K6QA 2JOBA 1I94E 2NUFA 3OTOE 4DUYE 4I8OA 5AE3A 2N3HA 3IWBA 4JI7E 3C4TA 3J7Yp 3T1HE 2UU9E 4NXME 1WHNA 2JR1A 3ADIA 4R03A 2KOUA 4GEQB 1J5EE 1EKZA 2NA2A 1IBKE 4WSPA 4JI5E 4M30A 2UUCE 4YHHE 1YZ9A 4F9BB 4K0KE 2JVAA 3ZOQB 2V85A 4WPYA 4DR4E 1SR9A 1YYOA 2M7QA 4LFBE 3H09A 3IWDA 3LMLA 3P1XA 2LRSA 2L3JA 3RMPA 3AUZA 4Q28A 1RQ0A 2VQEE 3HXLA 2RS6A 2B7TA 5AE1A 3OMLA 2B7VA 4BC7A 4DV6E 4JI3E 4LFAE 1N33E 1GZ6A 3HPSA 5A2QC 4DR5E 4J8ZA 1X47A 4WFTA 5FLXC 2LUPB 1HNZE 2UUBE 4JI4E 2DMYA 3J7AG 2VE7C 4LF8E 2VQFE 4L8NA 4LU9A 3J81C 2YZTA 2F8BA 4B3SE 1DI2A 2L2NA 2L92A 2V88A 4LF5E 2YT4A 2EZ6A 3ADLA 4JV5E 2KHXA 1N36E 4X62E 3VK6A 1ZBTA 3FIGA 3HQ1A 4P78A 3JAMC 1RC7A 2LTSA 4X65E 2FV4B 4TUIA 4X66E 2RTXA 4BMJA 4DMIA 1YYWA 4F9AB 4X64E 2B9DA 2EWLA 4KZSA 1ZBQA 2N3GA 2V83A 2IHR1 2V8QB 3LLHA 4R8OA 3VYYA 4DV5E 4DV7E 2RSMA 4DV2E 5ADZA 2ZM6E 2MC6A 2E5LE 2WZOA 3VYXA 4DR2E 4DKKA 2LTRA 5IT9C 4P7DA 3F6GA 4KHPE 2LUQA 1IBLE 2FTXB 2NUEA 2HHHE 2M1SA 1X48A 4GKJE 3IWCA 4LTYA 2DB2A 1XMQE 1X49A 1FKAE 1STUA 1WXRA 2LBSB 2B3TB 4DR1E 4JI2E 5AASA 1WHQA 4LF9E 2L6MA 2KONA 2DIXA 1UILA 2MC5A 4JI6E 5F3WA 5LL6R 3C4BA 2M4IA 4OOGC 4BC9A 2LMZA 4LFCE 4DUZE 1XNRE 4F54A 4YY3E 4JI1E 4M2ZA 3ADGA 4TUGA 4DV1E 2G7HA 4DR3E 2UXBE 1IBME 5CFFE 1HNXE 2E1MA 4B3RE 3DF6A 5AE2A 2FGGA 2DSYA 4BS9A 4DR7E 1T4OA 1GQEA 2LE2A 5IWAE 3HTXA 2L8TA 4DR6E 2CPNA 3KWRA 4GKKE 1QU6A 3T1YE 4WYQB 3J80C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD E;  1N34 E;  1T4L B;  1FJG E;  4DV3 E;  1O0W A;  1XMO E;  1PKP A;  2L33 A;  2JY9 A;  4JYA E;  1UHZ A;  1T4N A;  1J26 A;  5LMN E;  5BR8 E;  4JI8 E;  2UUA E;  2L2M A;  5LMU E;  4JI0 E;  1YYK A;  4LF6 E;  2LJH A;  4LF4 E;  4LF7 E;  2L2K B;  4B3T E;  1HR0 E;  4OX9 E;  4DV4 E;  1N32 E;  4DV0 E;  1XNQ E;  2F4V E;  1HNW E;  2RS7 A;  4AQY E;  4NXN E;  2L3C A;  2UXC E;  3ADJ A;  4X8W A;  2MDR A;  4B3M E;  1I94 E;  2NUF A;  2NUG A;  3OTO E;  4DUY E;  3J7Y p;  4NXM E;  4JI7 E;  2N3H A;  3C4T A;  3T1H E;  2UU9 E;  1WHN A;  3ADI A;  1EKZ A;  1J5E E;  2NA2 A;  1IBK E;  4JI5 E;  4M30 A;  2UUC E;  4YHH E;  1YZ9 A;  4K0K E;  2JVA A;  4DR4 E;  1YYO A;  4LFB E;  3P1X A;  2LRS A;  2L3J A;  1RQ0 A;  2VQE E;  4LF8 E;  2RS6 A;  2B7T A;  4DV6 E;  4LFA E;  2B7V A;  1N33 E;  4JI3 E;  2LUP B;  4DR5 E;  1HNZ E;  1X47 A;  4WFT A;  2UUB E;  4JI4 E;  2DMY A;  2VQF E;  1DI2 A;  4B3S E;  2L2N A;  4LF5 E;  2YT4 A;  2EZ6 A;  3ADL A;  4JV5 E;  2KHX A;  1N36 E;  4X62 E;  1ZBT A;  1RC7 A;  2LTS A;  4X65 E;  4X66 E;  2RTX A;  1YYW A;  4X64 E;  4DV5 E;  2N3G A;  3VYY A;  3LLH A;  2IHR 1;  4DV7 E;  2RSM A;  4DV2 E;  2ZM6 E;  2E5L E;  3VYX A;  4DR2 E;  4DKK A;  2LTR A;  4KHP E;  2LUQ A;  1IBL E;  2NUE A;  2HHH E;  1X48 A;  4GKJ E;  1XMQ E;  1FKA E;  2DB2 A;  1X49 A;  1STU A;  2LBS B;  2B3T B;  4DR1 E;  4JI2 E;  1WHQ A;  4LF9 E;  2DIX A;  1UIL A;  4JI6 E;  3C4B A;  4OOG C;  4LFC E;  4DUZ E;  1XNR E;  4YY3 E;  4JI1 E;  4M2Z A;  3ADG A;  4DV1 E;  4DR3 E;  2UXB E;  1IBM E;  5CFF E;  1HNX E;  4B3R E;  4DR7 E;  1T4O A;  1GQE A;  5IWA E;  3HTX A;  4DR6 E;  2CPN A;  4GKK E;  1QU6 A;  3T1Y E;  4WYQ B; 
#chains in the Genus database with same CATH topology
 1O0W A;  1PKP A;  4BCA A;  2JY9 A;  1UHZ A;  5AC5 A;  1L4S A;  4L5N C;  3DJW A;  1A1G A;  5DNY A;  1PJT A;  2EN7 A;  3HPZ A;  4F9C B;  3VHT B;  5T6J A;  3AV0 A;  2YTI A;  1RMD A;  2EOI A;  4ZYG A;  2H36 X;  2MDR A;  4F2J C;  1I94 E;  2JOB A;  2NUG A;  3OTO E;  3J7Y p;  5AE3 A;  4JI7 E;  3ADI A;  2EM2 A;  2EMZ A;  1GTK A;  2WCC 3;  1Z1B A;  2EM6 A;  2EE8 A;  4YHH E;  1T38 A;  4F9B B;  4R2C A;  4WPY A;  2M7Q A;  3EPH A;  2EOJ A;  3IWD A;  2EL4 A;  4R2Q A;  2YTE A;  2EPA A;  5KL4 A;  2VQE E;  1ZR9 A;  2EMY A;  2PRT A;  1AAY A;  1N33 E;  2EQ0 A;  1GZ6 A;  3HPS A;  1X47 A;  2HGH A;  2EL6 A;  2E72 A;  4LU9 A;  4B3S E;  2EZ6 A;  4R2D A;  1B69 A;  3HQ1 A;  3JAM C;  1RC7 A;  2BB8 A;  1X3C A;  4O4K A;  3KZZ A;  2EMH A;  1IMU A;  4KZS A;  2EWL A;  2N3G A;  3VYY A;  2IHR 1;  4DV7 E;  1ZAA C;  4NZV A;  1LLM C;  2ZM6 E;  2MC6 A;  4RH8 A;  2WBU A;  4DR2 E;  2LUQ A;  2MDG A;  4NHR A;  5KL3 A;  2EM4 A;  2FTX B;  2LO3 A;  1PDA A;  1X48 A;  4GKJ E;  2EM3 A;  2LBS B;  1WRJ A;  2D9H A;  1TN9 A;  2Q8U A;  1WHQ A;  2L6M A;  2LCE A;  2DIX A;  2R1F A;  5KL6 A;  2MC5 A;  1X6H A;  2EPP A;  4HTG A;  2EMK A;  5LL6 R;  4OOG C;  4BC9 A;  4DUZ E;  2ENH A;  2YRK A;  4JI1 E;  4DV1 E;  2EM5 A;  1A1I A;  1HNX E;  4BS9 A;  2DSY A;  1T4O A;  2EN1 A;  2YU5 A;  2LE2 A;  1YUJ A;  1X5W A;  2YTJ A;  1YUI A;  3KWR A;  1A1L A;  3T1Y E;  3BGH A;  1SFE A;  2EN4 A;  2EN3 A;  1T4L B;  1N34 E;  3L00 A;  4DV3 E;  1XMO E;  2YRH A;  1P47 A;  1T4N A;  2EOE A;  2EM8 A;  2N8X A;  2EPU A;  4ZYH A;  2L2K B;  1HR0 E;  4DV0 E;  2RS7 A;  2V87 A;  2EMX A;  3ADJ A;  2JWO A;  4B3M E;  1IQO A;  2EN8 A;  5A69 A;  2EOO A;  4DUY E;  5IV8 B;  3T1H E;  2UU9 E;  5AC4 A;  4GEQ B;  5A6K A;  3THO B;  4JI5 E;  2VRD A;  4R2A A;  4M30 A;  2UUC E;  2EMB A;  4X9J A;  3ZOQ B;  1NCS A;  2V85 A;  4DR4 E;  4LFB E;  3H09 A;  3RMP A;  3P1X A;  2LRS A;  1EH8 A;  2YSP A;  1F2I G;  1AH5 A;  2A25 A;  5IXM B;  3HXL A;  2RS6 A;  2B7T A;  4JI3 E;  4IJD A;  3EPJ A;  4WFT A;  1NEI A;  2DMY A;  2VE7 C;  2EMC A;  2VQF E;  4ZYD A;  2F8B A;  4JV5 E;  2KHX A;  1N36 E;  4P78 A;  3BBG A;  4MLV A;  2R76 A;  4O5G A;  4X66 E;  4F6N A;  2RTX A;  2WBT A;  2YTG A;  2DMI A;  2EPX A;  2B9D A;  4X64 E;  3C6M A;  2V8Q B;  4FK5 C;  2V83 A;  4DV5 E;  4GZN C;  4DV2 E;  2DGC A;  2E5L E;  4R2E A;  3VYX A;  2RQL A;  4KHP E;  5IT9 C;  2MKN A;  3F6G A;  2YTF A;  2NUE A;  3IWC A;  4LTY A;  2DB2 A;  2EQ3 A;  1X49 A;  2EOX A;  2B3T B;  2JP9 A;  5AAS A;  1A1H A;  5A6B D;  2KON A;  2EOS A;  1UIL A;  2JPA A;  2EPO A;  2EM7 A;  4F54 A;  4YY3 E;  1PJQ A;  4WSG A;  2CT1 A;  3ADG A;  4TUG A;  2G7H A;  4DR3 E;  2EM0 A;  1IBM E;  5CFF E;  2EPC A;  5AE2 A;  1MGT A;  2FGG A;  1GQE A;  2EPR A;  4R2R A;  2CPN A;  2UXD E;  2EOH A;  2V86 A;  3KZY A;  2JOX A;  2M9A A;  1QNT A;  5LMN E;  5BR8 E;  3EQ1 A;  4WX9 A;  3JU0 A;  2UUA E;  5LMU E;  2DRP A;  1YPN A;  2LJH A;  4LF4 E;  4LF7 E;  1JK1 A;  4B3T E;  2ODR D;  4OX9 E;  3BF2 A;  1N32 E;  2ODR C;  1XNQ E;  2F4V E;  4AQY E;  1HNW E;  1BBO A;  1DQ3 A;  3MSW A;  4X8W A;  5KL5 A;  3K6Q A;  2ENA A;  1IQS A;  4I8O A;  2EPM X;  4R2S A;  2NA2 A;  4BHC A;  4WSP A;  1YFH A;  1IBK E;  1YZ9 A;  4K0K E;  2EP3 A;  1SR9 A;  2EOF A;  3LML A;  2L3J A;  2EPL X;  4Q35 B;  1RQ0 A;  4RHB B;  4LFA E;  5AE1 A;  4BC7 A;  2B7V A;  5LLQ A;  3QG5 C;  1HNZ E;  2UUB E;  1DGC A;  2EN6 A;  1DI2 A;  3J81 C;  2YZT A;  2V88 A;  1A1J A;  2GPI A;  1WJP A;  4LF5 E;  3ADL A;  1JK2 A;  2LJU A;  2EMA A;  4X62 E;  2LTS A;  4X65 E;  2FV4 B;  2I13 A;  4BMJ A;  1YYW A;  2MKD A;  1ZBQ A;  4R8O A;  1A1K A;  3MHS C;  2EOQ A;  2HC5 A;  5TSE A;  2WZO A;  2YTQ A;  1KJK A;  2JXP A;  2LV2 A;  1IBL E;  3EPK A;  4KWY A;  1EH7 A;  2HHH E;  2M1S A;  4M9V C;  2EMF A;  1FKA E;  1MEY C;  1STU A;  1WXR A;  2CTD A;  4JI2 E;  2YTN A;  2DLK A;  4LF9 E;  2YWQ A;  2JYA A;  1UN6 B;  4JI6 E;  3C4B A;  1ZU1 A;  2M4I A;  2LMZ A;  5A6A A;  2EOZ A;  2K7I A;  2EM9 A;  2EJ4 A;  3TQM A;  2EN2 A;  2UXB E;  1N3G A;  2E1M A;  4B3R E;  3DF6 A;  2ELY A;  2EPK X;  3ECR A;  5IWA E;  2L8T A;  2YRM A;  4DR6 E;  4GKK E;  1QU6 A;  4WYQ B;  2YTO A;  2ENC A;  3F6H A;  4BBY A;  2K4V A;  1FJG E;  2ELZ A;  2L33 A;  2GLI A;  2V89 A;  4JYA E;  1J26 A;  2DLQ A;  2EOM A;  4O24 A;  2VF1 A;  5A6B A;  1X6F A;  2ADR A;  4JI8 E;  2L2M A;  2LVH A;  4JI0 E;  1YYK A;  2RPC A;  4LF6 E;  4M0V A;  4DV4 E;  2EL5 A;  2EQ1 A;  4NXN E;  2L3C A;  2UXC E;  3JTZ A;  2NUF A;  4NXM E;  2N3H A;  3IWB A;  3C4T A;  1PJS A;  1WHN A;  2EOR A;  2JR1 A;  4R03 A;  5KL7 A;  2KOU A;  1EKZ A;  1J5E E;  3M99 B;  4BHB A;  2JVA A;  3UK3 C;  1YYO A;  3BID A;  3THN A;  2GHF A;  3AUZ A;  1X6E A;  4Q28 A;  4LF8 E;  4DV6 E;  3OML A;  2LUP B;  5A2Q C;  4DR5 E;  4J8Z A;  5FLX C;  2CSH A;  4JI4 E;  3EPL A;  3J7A G;  4WXD A;  4L8N A;  2L2N A;  3C6K A;  2L92 A;  3MHH C;  2YT4 A;  2EMG A;  3VK6 A;  1ZBT A;  3FIG A;  2EPZ A;  4TUI A;  4IS1 C;  2EMW A;  2WBS A;  4DMI A;  4N4R B;  4F9A B;  4F6M A;  4MLQ A;  3LLH A;  1KYQ A;  4WXC A;  2RSM A;  1BB8 A;  1T39 A;  5ADZ A;  2EML A;  2HJJ A;  4HEI A;  2LTR A;  4DKK A;  2BBG A;  4P7D A;  1YSA C;  2YPN A;  2EPN A;  4O43 A;  1XMQ E;  4DR1 E;  2YSO A;  2RSI A;  2YTD A;  1BBG A;  4ZYE A;  5F3W A;  2J7J A;  4LFC E;  2NAB A;  1XNR E;  1G2F C;  1EH6 A;  5A6J A;  4R2P A;  2I9I A;  5KL2 A;  4M2Z A;  1TF6 A;  1A1F A;  2LT7 A;  2EMI A;  2YTP A;  2YU8 A;  4DR7 E;  1G2D C;  1UBD C;  1TF3 A;  3HTX A;  2EOY A;  3J80 C; 
#chains in the Genus database with same CATH homology
 2UXD E;  1N34 E;  2V86 A;  3F6H A;  4BBY A;  1T4L B;  2K4V A;  1FJG E;  4DV3 E;  1O0W A;  2JOX A;  1XMO E;  1PKP A;  2L33 A;  4BCA A;  2JY9 A;  2V89 A;  4JYA E;  1UHZ A;  1T4N A;  1J26 A;  5LMN E;  5BR8 E;  4L5N C;  3DJW A;  5DNY A;  3HPZ A;  2VF1 A;  4F9C B;  3JU0 A;  4JI8 E;  2UUA E;  2L2M A;  5LMU E;  4JI0 E;  4B3M E;  1YYK A;  4LF6 E;  2NUG A;  2LJH A;  4LF4 E;  4LF7 E;  4M0V A;  5T6J A;  3AV0 A;  2L2K B;  2ODR D;  1HR0 E;  4B3T E;  4OX9 E;  4DV4 E;  1N32 E;  4DV0 E;  2ODR C;  1XNQ E;  2F4V E;  2RS7 A;  2V87 A;  4AQY E;  1HNW E;  4NXN E;  1DQ3 A;  2L3C A;  2UXC E;  3MSW A;  3ADJ A;  2JWO A;  4X8W A;  2H36 X;  2MDR A;  3JTZ A;  3K6Q A;  2JOB A;  1I94 E;  2NUF A;  3OTO E;  4DUY E;  4I8O A;  5AE3 A;  2N3H A;  3IWB A;  4JI7 E;  3C4T A;  3J7Y p;  3T1H E;  2UU9 E;  4NXM E;  1WHN A;  2JR1 A;  3ADI A;  4R03 A;  2KOU A;  4GEQ B;  1J5E E;  1EKZ A;  2NA2 A;  1IBK E;  4WSP A;  4JI5 E;  4M30 A;  2UUC E;  4YHH E;  1YZ9 A;  4F9B B;  4K0K E;  2JVA A;  3ZOQ B;  2V85 A;  4WPY A;  4DR4 E;  1SR9 A;  1YYO A;  2M7Q A;  4LFB E;  3H09 A;  3IWD A;  3LML A;  3P1X A;  2LRS A;  2L3J A;  3RMP A;  3AUZ A;  4Q28 A;  1RQ0 A;  2VQE E;  3HXL A;  2RS6 A;  2B7T A;  5AE1 A;  3OML A;  2B7V A;  4BC7 A;  4DV6 E;  4JI3 E;  4LFA E;  1N33 E;  1GZ6 A;  3HPS A;  5A2Q C;  4DR5 E;  4J8Z A;  1X47 A;  4WFT A;  5FLX C;  2LUP B;  1HNZ E;  2UUB E;  4JI4 E;  2DMY A;  3J7A G;  2VE7 C;  4LF8 E;  2VQF E;  4L8N A;  4LU9 A;  3J81 C;  2YZT A;  2F8B A;  4B3S E;  1DI2 A;  2L2N A;  2L92 A;  2V88 A;  4LF5 E;  2YT4 A;  2EZ6 A;  3ADL A;  4JV5 E;  2KHX A;  1N36 E;  4X62 E;  3VK6 A;  1ZBT A;  3FIG A;  3HQ1 A;  4P78 A;  3JAM C;  1RC7 A;  2LTS A;  4X65 E;  2FV4 B;  4TUI A;  4X66 E;  2RTX A;  4BMJ A;  4DMI A;  1YYW A;  4F9A B;  4X64 E;  2B9D A;  2EWL A;  4KZS A;  1ZBQ A;  2N3G A;  2V83 A;  2IHR 1;  2V8Q B;  3LLH A;  4R8O A;  3VYY A;  4DV5 E;  4DV7 E;  2RSM A;  4DV2 E;  5ADZ A;  2ZM6 E;  2MC6 A;  2E5L E;  2WZO A;  3VYX A;  4DR2 E;  4DKK A;  2LTR A;  5IT9 C;  4P7D A;  3F6G A;  4KHP E;  2LUQ A;  1IBL E;  2FTX B;  2NUE A;  2HHH E;  2M1S A;  1X48 A;  4GKJ E;  3IWC A;  4LTY A;  2DB2 A;  1XMQ E;  1X49 A;  1FKA E;  1STU A;  1WXR A;  2LBS B;  2B3T B;  4DR1 E;  4JI2 E;  5AAS A;  1WHQ A;  4LF9 E;  2L6M A;  2KON A;  2DIX A;  1UIL A;  2MC5 A;  4JI6 E;  5F3W A;  5LL6 R;  3C4B A;  2M4I A;  4OOG C;  4BC9 A;  2LMZ A;  4LFC E;  4DUZ E;  1XNR E;  4F54 A;  4YY3 E;  4JI1 E;  4M2Z A;  3ADG A;  4TUG A;  4DV1 E;  2G7H A;  4DR3 E;  2UXB E;  1IBM E;  5CFF E;  1HNX E;  2E1M A;  4B3R E;  3DF6 A;  5AE2 A;  2FGG A;  2DSY A;  4BS9 A;  4DR7 E;  1T4O A;  1GQE A;  2LE2 A;  5IWA E;  3HTX A;  2L8T A;  4DR6 E;  2CPN A;  3KWR A;  4GKK E;  1QU6 A;  3T1Y E;  4WYQ B;  3J80 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...