2RSMA

Solution structure and sirna-mediated knockdown analysis of the mitochondrial disease-related protein c12orf65 (ict2)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
GSSGSSGKWGLRLQEKPALLFPGMAASTVQVAGRKDYPALLPLNESELEEQFVKGHGPGGQATNKTSNCVVLKHVPSGIVVKCHQTRSVDQNRKIARKVLQEKVDVFYNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and siRNA-mediated knockdown analysis of the mitochondrial disease-related protein C12orf65.
pubmed doi rcsb
source organism Mus musculus
molecule tags Translation
molecule keywords Probable peptide chain release factor C12orf65 homolog, mito
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rsmA00
4DR3E 3ADLA 2N3HA 1XMOE 1N34E 2EZ6A 1XNQE 1YYKA 5CFFE 4JI4E 1YYWA 1IBKE 4X8WA 1N36E 2UUAE 2HHHE 4X64E 1RQ0A 4DV6E 4JYAE 1I94E 2DMYA 2JVAA 4LFBE 1N32E 1RC7A 4LF9E 1XNRE 3HTXA 2CPNA 4B3TE 1O0WA 4DR4E 1ZBTA 2L2NA 4LF4E 2YT4A 2L3CA 1IBME 2VQEE 4X62E 2LJHA 1YZ9A 4DUZE 1UILA 4DUYE 2JY9A 4DV0E 2RSMA 2ZM6E 2N3GA 2L2MA 3OTOE 4GKKE 4B3ME 4X66E 3C4BA 3ADIA 5IWAE 4DV5E 4LF6E 4DV2E 2UU9E 4B3SE 3VYYA 4NXME 5LMUE 2KHXA 4AQYE 2F4VE 4M30A 1X48A 1X47A 2DIXA 3T1HE 1FKAE 2LBSB 4OOGC 1HNXE 1J26A 4JI7E 3J7Yp 1N33E 4M2ZA 2UUCE 4JI5E 1YYOA 1FJGE 4KHPE 3C4TA 1XMQE 1PKPA 1T4OA 2NA2A 2L33A 3LLHA 3ADGA 4JI2E 4GKJE 4WFTA 2NUEA 2RS6A 4JI8E 1WHQA 2LTSA 2L2KB 2UUBE 1WHNA 2RS7A 1EKZA 4JI1E 2NUGA 4DV1E 5BR8E 4JI6E 2B7VA 1T4NA 2LUPB 4LFAE 4DV3E 2UXDE 2NUFA 2IHR1 1HNWE 4JI0E 4DKKA 4LF7E 4YY3E 3P1XA 3VYXA 1QU6A 2UXBE 4DR6E 2B3TB 4YHHE 4DR2E 2UXCE 1IBLE 2B7TA 1HNZE 3T1YE 4JV5E 4LF5E 2DB2A 4DR5E 2E5LE 2LUQA 4LF8E 4NXNE 1DI2A 4DR7E 1T4LB 3ADJA 2LTRA 4WYQB 4B3RE 4JI3E 2LRSA 4LFCE 4DR1E 5LMNE 1STUA 1J5EE 4OX9E 2MDRA 4K0KE 1GQEA 2L3JA 4DV4E 2RTXA 4DV7E 4X65E 1UHZA 1X49A 2VQFE 1HR0E
chains in the Genus database with same CATH superfamily
3RMPA 3BGHA 2A25A 2EJ4A 2WBTA 1N34E 2EZ6A 3HQ1A 2M4IA 2YTFA 5CFFE 4X8WA 2YTGA 2UUAE 2LO3A 2YTNA 1RQ0A 2BBGA 2M1SA 3F6HA 2EORA 3M99B 2JOBA 4F6NA 1XNRE 2EN1A 5AE2A 2LMZA 2V89A 4LF4E 2V8QB 1YZ9A 1UILA 2J7JA 1L4SA 4I8OA 2L6MA 3L00A 2YTJA 2L2MA 4GKKE 2EQ3A 4WXCA 2RQLA 4DV5E 4DV2E 4BC7A 2JXPA 4B3SE 2R1FA 5LMUE 1T39A 4F9BB 2MKNA 3IWDA 1X3CA 1X48A 1X47A 2DIXA 2R76A 1PJQA 2V86A 3J80C 2LBSB 4OOGC 4GZNC 2HJJA 4WXDA 2EOEA 2YSPA 1A1LA 4R8OA 4DMIA 4P7DA 4ZYGA 2HGHA 1BBOA 2EMZA 5KL6A 2MC5A 5AC5A 1JK1A 3KZYA 2B9DA 3HXLA 1A1JA 2YTQA 2EMLA 5KL5A 1X6EA 2EL4A 1KYQA 4WFTA 3AV0A 2NUEA 4TUIA 3LMLA 5AC4A 4KZSA 2YTPA 2JWOA 3MHSC 4L5NC 2D9HA 1YFHA 2M9AA 4DV3E 4J8ZA 3DF6A 4JI0E 4DKKA 4LF7E 2M7QA 1YUJA 5AE3A 1QU6A 2EL6A 2WBUA 2EM4A 4DR2E 2UXCE 2LT7A 4WPYA 3KWRA 3T1YE 4JV5E 4R03A 1F2IG 2DB2A 2CSHA 2YZTA 4DR5E 2EN4A 2LUQA 4NXNE 1DI2A 2ADRA 1T4LB 5A6BA 3ECRA 4JI3E 2N8XA 4BHBA 4K0KE 2L8TA 3EPLA 4DV7E 2EWLA 4X65E 2ENCA 1RMDA 3JTZA 4GEQB 2H36X 3BF2A 1UHZA 2FTXB 3J81C 2DSYA 4TUGA 1HR0E 3ADLA 1AH5A 2PRTA 1YYKA 2GLIA 2EPPA 2JPAA 2EN6A 4ZYEA 3AUZA 2EPKX 2EMAA 2DLKA 4FK5C 4ZYDA 2JVAA 1A1GA 4MLVA 2KONA 1LLMC 2YU5A 1SFEA 1ZBTA 4R2DA 4F54A 2YRKA 1IBME 3KZZA 2VQEE 4X62E 1GZ6A 2ELYA 4DUYE 2EMFA 2JY9A 2ZM6E 2EM8A 3OTOE 2LE2A 2G7HA 2YWQA 4X66E 1G2FC 2EPMX 4NXME 2EPNA 2KHXA 2EM3A 2LCEA 4AQYE 2EOZA 4BCAA 3T1HE 2EMXA 1UN6B 5LLQA 5F3WA 1GTKA 2EOSA 1YPNA 4M2ZA 2YSOA 2MC6A 4NHRA 2I13A 1ZR9A 2YU8A 3C4TA 1PKPA 3C6MA 2EMHA 3HPZA 3LLHA 2RS6A 1WHQA 2L2KB 2UUBE 1ZU1A 2EOJA 1X6HA 1EKZA 4JI1E 2EPCA 5BR8E 3J7AG 2EMKA 2FGGA 3EPHA 1T4NA 2EPAA 3UK3C 4LFAE 2EOXA 2EN8A 1BB8A 1IQOA 2V88A 1QNTA 2BB8A 2E1MA 2UXBE 2B3TB 2EOQA 1HNZE 1N3GA 5IT9C 1PJTA 2EN2A 2DMIA 4DR7E 2FV4B 3ADJA 2E72A 2LRSA 2EM6A 2EMYA 4R2AA 5DNYA 2CTDA 2RTXA 1A1KA 2EM5A 4RHBB 5LL6R 2EOHA 2EPLX 1AAYA 1X49A 4HTGA 3BIDA 2EQ0A 1T4OA 2VQFE 1G2DC 2EM7A 2MKDA 4F2JC 2ENHA 3JAMC 1XNQE 1WJPA 3VK6A 4LTYA 1YYWA 4F9CB 2YTIA 4NZVA 2EMGA 4X64E 4ZYHA 4DV6E 4JYAE 2KOUA 5AE1A 4HEIA 4LFBE 2ODRC 1WXRA 1RC7A 5IV8B 4WSPA 2WZOA 2CPNA 4B3TE 2EN7A 1O0WA 2L2NA 3EPJA 1T38A 2LJHA 5A6AA 4DV0E 2WBSA 2RSMA 3TQMA 2N3GA 4R2RA 1DGCA 3C4BA 3ADIA 5IWAE 2UU9E 2EPRA 2VF1A 1FKAE 2EM2A 2EMIA 1J26A 4BHCA 3J7Yp 2VRDA 2ELZA 2EQ1A 1YYOA 3THOB 1TN9A 1FJGE 2K7IA 4IS1C 1XMQE 2NA2A 2JR1A 4JI2E 3IWBA 2EOMA 2WCC3 2LTSA 2JYAA 2YTOA 2YRMA 4DV1E 4JI6E 2LVHA 4M0VA 1EH8A 3JU0A 3MSWA 5TSEA 1BBGA 2LV2A 2UXDE 4N4RB 2IHR1 5KL3A 2NUFA 1HNWE 4Q28A 3VYXA 3VHTB 5AASA 5A69A 4IJDA 4Q35B 2HC5A 2B7TA 1TF6A 3THNA 1Z1BA 2NABA 3HPSA 4BC9A 4R2SA 4LF8E 3F6GA 2LTRA 4WYQB 4B3RE 2EOOA 1MEYC 4LFCE 4DR1E 2JOXA 5KL4A 5LMNE 1J5EE 2MDRA 2L3JA 4O43A 2DGCA 1P47A 4P78A 4BBYA 4LU9A 3MHHC 4O4KA 4DR3E 2N3HA 5A6JA 1XMOE 4F9AB 1A1HA 4JI4E 1IBKE 3EQ1A 1N36E 1DQ3A 2HHHE 2GPIA 2ODRD 1I94E 2L92A 2DMYA 4F6MA 2LJUA 2CT1A 2GHFA 2VE7C 1PDAA 1N32E 4LF9E 3HTXA 1ZAAC 4DR4E 2EP3A 2YT4A 2L3CA 1YSAC 5A6KA 1EH7A 4DUZE 5T6JA 4R2CA 2V87A 1TF3A 4B3ME 4BS9A 1EH6A 2MDGA 1IMUA 4O5GA 1NCSA 1X5WA 4L8NA 4LF6E 4R2QA 3FIGA 3VYYA 1MGTA 1IQSA 2F4VE 3OMLA 4M30A 4O24A 2DLQA 2F8BA 2EMWA 1HNXE 2YTEA 4JI7E 4BMJA 1N33E 3QG5C 2EOFA 4WSGA 4RH8A 2UUCE 4M9VC 1X6FA 3C6KA 2I9IA 4JI5E 2K4VA 2Q8UA 4KHPE 2V83A 2L33A 4R2EA 3ADGA 2EMBA 4GKJE 4R2PA 4JI8E 1WHNA 3K6QA 2RS7A 2JP9A 2NUGA 2EPXA 1UBDC 5ADZA 4X9JA 3IWCA 2EMCA 2B7VA 2YRHA 2EPOA 2LUPB 2EOYA 3H09A 2EOIA 1NEIA 5FLXC 1A1IA 1KJKA 2EPUA 2EM9A 2V85A 2YTDA 3P1XA 4YY3E 5KL7A 4DR6E 2DRPA 1SR9A 4WX9A 2EM0A 3DJWA 4YHHE 3ZOQB 2RSIA 2EL5A 3BBGA 3EPKA 1IBLE 4LF5E 5A6BD 5KL2A 2ENAA 2EPZA 2RPCA 2E5LE 4KWYA 1JK2A 1A1FA 2YPNA 2EN3A 1B69A 5IXMB 1YUIA 1ZBQA 1STUA 5A2QC 4OX9E 2EE8A 1GQEA 4DV4E 4MLQA 1PJSA 1WRJA
chains in the Genus database with same CATH topology
3RMPA 4DR3E 3ADLA 4LU9A 2N3HA 1XMOE 1N34E 4F9AB 2EZ6A 3JAMC 3HQ1A 1XNQE 1YYKA 3VK6A 2M4IA 5CFFE 4JI4E 4LTYA 1IBKE 1YYWA 4F9CB 3AUZA 4X8WA 1N36E 2UUAE 1DQ3A 4X64E 2HHHE 1RQ0A 2M1SA 4DV6E 2ODRD 3F6HA 4JYAE 2KOUA 5AE1A 1I94E 2L92A 2DMYA 2JOBA 2JVAA 4LFBE 2ODRC 2VE7C 1N32E 1WXRA 1RC7A 4LF9E 1XNRE 3HTXA 4WSPA 2WZOA 2KONA 2CPNA 4B3TE 1O0WA 4DR4E 5AE2A 1ZBTA 2L2NA 2LMZA 2V89A 4F54A 2YT4A 2L3CA 1IBME 4LF4E 2VQEE 2V8QB 4X62E 2LJHA 1YZ9A 1GZ6A 5T6JA 4DUZE 1UILA 4DUYE 2JY9A 2V87A 4DV0E 2RSMA 4I8OA 2L6MA 2ZM6E 2N3GA 2L2MA 3OTOE 4GKKE 2LE2A 4B3ME 2G7HA 4BS9A 4X66E 3C4BA 3ADIA 5IWAE 4DV5E 4LF6E 4L8NA 4BC7A 4DV2E 3FIGA 3VYYA 2UU9E 4B3SE 4NXME 5LMUE 2KHXA 2VF1A 4F9BB 4AQYE 3IWDA 3OMLA 4M30A 1X48A 1X47A 2DIXA 4BCAA 2V86A 3J80C 3T1HE 1FKAE 2LBSB 2F8BA 4OOGC 1HNXE 2F4VE 2VQFE 5F3WA 4JI7E 1J26A 3J7Yp 4BMJA 1N33E 4R8OA 4DMIA 4P7DA 4M2ZA 2MC5A 2UUCE 2MC6A 2B9DA 4JI5E 1YYOA 2K4VA 3HXLA 1FJGE 4KHPE 3C4TA 2V83A 1XMQE 1PKPA 2NA2A 2L33A 3HPZA 3LLHA 2JR1A 3ADGA 4JI2E 3IWBA 4GKJE 4WFTA 2NUEA 3AV0A 2RS6A 4JI8E 1WHQA 2LTSA 4TUIA 2L2KB 2UUBE 1WHNA 3K6QA 2RS7A 3LMLA 1EKZA 4JI1E 2NUGA 4DV1E 5BR8E 4JI6E 3J7AG 4KZSA 5ADZA 3IWCA 2FGGA 2B7VA 4M0VA 2JWOA 1T4NA 4L5NC 2LUPB 3JU0A 3MSWA 4LFAE 3H09A 4DV3E 4J8ZA 5FLXC 2UXDE 3DF6A 2IHR1 2NUFA 1HNWE 4JI0E 2V85A 4DKKA 2V88A 4Q28A 2M7QA 4LF7E 3P1XA 5AE3A 4YY3E 3VYXA 1QU6A 2E1MA 2UXBE 5AASA 2B3TB 1SR9A 4YHHE 4DR6E 3DJWA 3ZOQB 4DR2E 2UXCE 1IBLE 2B7TA 4WPYA 1HNZE 3HPSA 3KWRA 3T1YE 4JV5E 4LF5E 4R03A 4BC9A 2DB2A 2YZTA 5IT9C 4DR5E 2E5LE 2LUQA 4LF8E 4NXNE 1DI2A 4DR7E 1T4LB 4TUGA 2FV4B 3F6GA 3ADJA 2LTRA 4WYQB 4B3RE 4JI3E 1ZBQA 2LRSA 4LFCE 4DR1E 2JOXA 1STUA 5A2QC 5LMNE 1J5EE 4OX9E 2MDRA 5DNYA 1GQEA 2L8TA 2L3JA 4DV4E 4K0KE 2RTXA 4DV7E 2EWLA 3J81C 4X65E 3JTZA 4GEQB 4P78A 2H36X 5LL6R 1UHZA 2FTXB 1X49A 4BBYA 1T4OA 2DSYA 1HR0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 E;  3ADL A;  2N3H A;  1XMO E;  1N34 E;  2EZ6 A;  1XNQ E;  1YYK A;  5CFF E;  4JI4 E;  1YYW A;  1IBK E;  4X8W A;  1N36 E;  2UUA E;  2HHH E;  4X64 E;  1RQ0 A;  4DV6 E;  4JYA E;  1I94 E;  2DMY A;  2JVA A;  4LFB E;  1N32 E;  1RC7 A;  4LF9 E;  1XNR E;  3HTX A;  2CPN A;  4B3T E;  1O0W A;  4DR4 E;  1ZBT A;  2L2N A;  4LF4 E;  2YT4 A;  2L3C A;  1IBM E;  2VQE E;  4X62 E;  2LJH A;  1YZ9 A;  4DUZ E;  1UIL A;  4DUY E;  2JY9 A;  4DV0 E;  2RSM A;  2ZM6 E;  2N3G A;  2L2M A;  3OTO E;  4GKK E;  4B3M E;  4X66 E;  3C4B A;  3ADI A;  5IWA E;  4DV5 E;  4LF6 E;  4DV2 E;  2UU9 E;  4B3S E;  3VYY A;  4NXM E;  5LMU E;  2KHX A;  4AQY E;  2F4V E;  4M30 A;  1X48 A;  1X47 A;  2DIX A;  3T1H E;  1FKA E;  2LBS B;  4OOG C;  1HNX E;  1J26 A;  4JI7 E;  3J7Y p;  1N33 E;  4M2Z A;  2UUC E;  4JI5 E;  1YYO A;  1FJG E;  4KHP E;  3C4T A;  1XMQ E;  1PKP A;  1T4O A;  2NA2 A;  2L33 A;  3LLH A;  3ADG A;  4JI2 E;  4GKJ E;  4WFT A;  2NUE A;  2RS6 A;  4JI8 E;  1WHQ A;  2LTS A;  2L2K B;  2UUB E;  1WHN A;  2RS7 A;  1EKZ A;  4JI1 E;  2NUG A;  4DV1 E;  5BR8 E;  4JI6 E;  2B7V A;  1T4N A;  2LUP B;  4LFA E;  4DV3 E;  2UXD E;  2NUF A;  2IHR 1;  1HNW E;  4JI0 E;  4DKK A;  4LF7 E;  4YY3 E;  3P1X A;  3VYX A;  1QU6 A;  2UXB E;  4DR6 E;  2B3T B;  4YHH E;  4DR2 E;  2UXC E;  1IBL E;  2B7T A;  1HNZ E;  3T1Y E;  4JV5 E;  4LF5 E;  2DB2 A;  4DR5 E;  2E5L E;  2LUQ A;  4LF8 E;  4NXN E;  1DI2 A;  4DR7 E;  1T4L B;  3ADJ A;  2LTR A;  4WYQ B;  4B3R E;  4JI3 E;  2LRS A;  4LFC E;  4DR1 E;  5LMN E;  1STU A;  1J5E E;  4OX9 E;  2MDR A;  4K0K E;  1GQE A;  2L3J A;  4DV4 E;  2RTX A;  4DV7 E;  4X65 E;  1UHZ A;  1X49 A;  2VQF E;  1HR0 E; 
#chains in the Genus database with same CATH topology
 3RMP A;  3BGH A;  2A25 A;  2EJ4 A;  2WBT A;  1N34 E;  2EZ6 A;  3HQ1 A;  2M4I A;  2YTF A;  5CFF E;  4X8W A;  2YTG A;  2UUA E;  2LO3 A;  2YTN A;  1RQ0 A;  2BBG A;  2M1S A;  3F6H A;  2EOR A;  3M99 B;  2JOB A;  4F6N A;  1XNR E;  2EN1 A;  5AE2 A;  2LMZ A;  2V89 A;  4LF4 E;  2V8Q B;  1YZ9 A;  1UIL A;  2J7J A;  1L4S A;  4I8O A;  2L6M A;  3L00 A;  2YTJ A;  2L2M A;  4GKK E;  2EQ3 A;  4WXC A;  2RQL A;  4DV5 E;  4DV2 E;  4BC7 A;  2JXP A;  4B3S E;  2R1F A;  5LMU E;  1T39 A;  4F9B B;  2MKN A;  3IWD A;  1X3C A;  1X48 A;  1X47 A;  2DIX A;  2R76 A;  1PJQ A;  2V86 A;  3J80 C;  2LBS B;  4OOG C;  4GZN C;  2HJJ A;  4WXD A;  2EOE A;  2YSP A;  1A1L A;  4R8O A;  4DMI A;  4P7D A;  4ZYG A;  2HGH A;  1BBO A;  2EMZ A;  5KL6 A;  2MC5 A;  5AC5 A;  1JK1 A;  3KZY A;  2B9D A;  3HXL A;  1A1J A;  2YTQ A;  2EML A;  5KL5 A;  1X6E A;  2EL4 A;  1KYQ A;  4WFT A;  3AV0 A;  2NUE A;  4TUI A;  3LML A;  5AC4 A;  4KZS A;  2YTP A;  2JWO A;  3MHS C;  4L5N C;  2D9H A;  1YFH A;  2M9A A;  4DV3 E;  4J8Z A;  3DF6 A;  4JI0 E;  4DKK A;  4LF7 E;  2M7Q A;  1YUJ A;  5AE3 A;  1QU6 A;  2EL6 A;  2WBU A;  2EM4 A;  4DR2 E;  2UXC E;  2LT7 A;  4WPY A;  3KWR A;  3T1Y E;  4JV5 E;  4R03 A;  1F2I G;  2DB2 A;  2CSH A;  2YZT A;  4DR5 E;  2EN4 A;  2LUQ A;  4NXN E;  1DI2 A;  2ADR A;  1T4L B;  5A6B A;  3ECR A;  4JI3 E;  2N8X A;  4BHB A;  4K0K E;  2L8T A;  3EPL A;  4DV7 E;  2EWL A;  4X65 E;  2ENC A;  1RMD A;  3JTZ A;  4GEQ B;  2H36 X;  3BF2 A;  1UHZ A;  2FTX B;  3J81 C;  2DSY A;  4TUG A;  1HR0 E;  3ADL A;  1AH5 A;  2PRT A;  1YYK A;  2GLI A;  2EPP A;  2JPA A;  2EN6 A;  4ZYE A;  3AUZ A;  2EPK X;  2EMA A;  2DLK A;  4FK5 C;  4ZYD A;  2JVA A;  1A1G A;  4MLV A;  2KON A;  1LLM C;  2YU5 A;  1SFE A;  1ZBT A;  4R2D A;  4F54 A;  2YRK A;  1IBM E;  3KZZ A;  2VQE E;  4X62 E;  1GZ6 A;  2ELY A;  4DUY E;  2EMF A;  2JY9 A;  2ZM6 E;  2EM8 A;  3OTO E;  2LE2 A;  2G7H A;  2YWQ A;  4X66 E;  1G2F C;  2EPM X;  4NXM E;  2EPN A;  2KHX A;  2EM3 A;  2LCE A;  4AQY E;  2EOZ A;  4BCA A;  3T1H E;  2EMX A;  1UN6 B;  5LLQ A;  5F3W A;  1GTK A;  2EOS A;  1YPN A;  4M2Z A;  2YSO A;  2MC6 A;  4NHR A;  2I13 A;  1ZR9 A;  2YU8 A;  3C4T A;  1PKP A;  3C6M A;  2EMH A;  3HPZ A;  3LLH A;  2RS6 A;  1WHQ A;  2L2K B;  2UUB E;  1ZU1 A;  2EOJ A;  1X6H A;  1EKZ A;  4JI1 E;  2EPC A;  5BR8 E;  3J7A G;  2EMK A;  2FGG A;  3EPH A;  1T4N A;  2EPA A;  3UK3 C;  4LFA E;  2EOX A;  2EN8 A;  1BB8 A;  1IQO A;  2V88 A;  1QNT A;  2BB8 A;  2E1M A;  2UXB E;  2B3T B;  2EOQ A;  1HNZ E;  1N3G A;  5IT9 C;  1PJT A;  2EN2 A;  2DMI A;  4DR7 E;  2FV4 B;  3ADJ A;  2E72 A;  2LRS A;  2EM6 A;  2EMY A;  4R2A A;  5DNY A;  2CTD A;  2RTX A;  1A1K A;  2EM5 A;  4RHB B;  5LL6 R;  2EOH A;  2EPL X;  1AAY A;  1X49 A;  4HTG A;  3BID A;  2EQ0 A;  1T4O A;  2VQF E;  1G2D C;  2EM7 A;  2MKD A;  4F2J C;  2ENH A;  3JAM C;  1XNQ E;  1WJP A;  3VK6 A;  4LTY A;  1YYW A;  4F9C B;  2YTI A;  4NZV A;  2EMG A;  4X64 E;  4ZYH A;  4DV6 E;  4JYA E;  2KOU A;  5AE1 A;  4HEI A;  4LFB E;  2ODR C;  1WXR A;  1RC7 A;  5IV8 B;  4WSP A;  2WZO A;  2CPN A;  4B3T E;  2EN7 A;  1O0W A;  2L2N A;  3EPJ A;  1T38 A;  2LJH A;  5A6A A;  4DV0 E;  2WBS A;  2RSM A;  3TQM A;  2N3G A;  4R2R A;  1DGC A;  3C4B A;  3ADI A;  5IWA E;  2UU9 E;  2EPR A;  2VF1 A;  1FKA E;  2EM2 A;  2EMI A;  1J26 A;  4BHC A;  3J7Y p;  2VRD A;  2ELZ A;  2EQ1 A;  1YYO A;  3THO B;  1TN9 A;  1FJG E;  2K7I A;  4IS1 C;  1XMQ E;  2NA2 A;  2JR1 A;  4JI2 E;  3IWB A;  2EOM A;  2WCC 3;  2LTS A;  2JYA A;  2YTO A;  2YRM A;  4DV1 E;  4JI6 E;  2LVH A;  4M0V A;  1EH8 A;  3JU0 A;  3MSW A;  5TSE A;  1BBG A;  2LV2 A;  2UXD E;  4N4R B;  2IHR 1;  5KL3 A;  2NUF A;  1HNW E;  4Q28 A;  3VYX A;  3VHT B;  5AAS A;  5A69 A;  4IJD A;  4Q35 B;  2HC5 A;  2B7T A;  1TF6 A;  3THN A;  1Z1B A;  2NAB A;  3HPS A;  4BC9 A;  4R2S A;  4LF8 E;  3F6G A;  2LTR A;  4WYQ B;  4B3R E;  2EOO A;  1MEY C;  4LFC E;  4DR1 E;  2JOX A;  5KL4 A;  5LMN E;  1J5E E;  2MDR A;  2L3J A;  4O43 A;  2DGC A;  1P47 A;  4P78 A;  4BBY A;  4LU9 A;  3MHH C;  4O4K A;  4DR3 E;  2N3H A;  5A6J A;  1XMO E;  4F9A B;  1A1H A;  4JI4 E;  1IBK E;  3EQ1 A;  1N36 E;  1DQ3 A;  2HHH E;  2GPI A;  2ODR D;  1I94 E;  2L92 A;  2DMY A;  4F6M A;  2LJU A;  2CT1 A;  2GHF A;  2VE7 C;  1PDA A;  1N32 E;  4LF9 E;  3HTX A;  1ZAA C;  4DR4 E;  2EP3 A;  2YT4 A;  2L3C A;  1YSA C;  5A6K A;  1EH7 A;  4DUZ E;  5T6J A;  4R2C A;  2V87 A;  1TF3 A;  4B3M E;  4BS9 A;  1EH6 A;  2MDG A;  1IMU A;  4O5G A;  1NCS A;  1X5W A;  4L8N A;  4LF6 E;  4R2Q A;  3FIG A;  3VYY A;  1MGT A;  1IQS A;  2F4V E;  3OML A;  4M30 A;  4O24 A;  2DLQ A;  2F8B A;  2EMW A;  1HNX E;  2YTE A;  4JI7 E;  4BMJ A;  1N33 E;  3QG5 C;  2EOF A;  4WSG A;  4RH8 A;  2UUC E;  4M9V C;  1X6F A;  3C6K A;  2I9I A;  4JI5 E;  2K4V A;  2Q8U A;  4KHP E;  2V83 A;  2L33 A;  4R2E A;  3ADG A;  2EMB A;  4GKJ E;  4R2P A;  4JI8 E;  1WHN A;  3K6Q A;  2RS7 A;  2JP9 A;  2NUG A;  2EPX A;  1UBD C;  5ADZ A;  4X9J A;  3IWC A;  2EMC A;  2B7V A;  2YRH A;  2EPO A;  2LUP B;  2EOY A;  3H09 A;  2EOI A;  1NEI A;  5FLX C;  1A1I A;  1KJK A;  2EPU A;  2EM9 A;  2V85 A;  2YTD A;  3P1X A;  4YY3 E;  5KL7 A;  4DR6 E;  2DRP A;  1SR9 A;  4WX9 A;  2EM0 A;  3DJW A;  4YHH E;  3ZOQ B;  2RSI A;  2EL5 A;  3BBG A;  3EPK A;  1IBL E;  4LF5 E;  5A6B D;  5KL2 A;  2ENA A;  2EPZ A;  2RPC A;  2E5L E;  4KWY A;  1JK2 A;  1A1F A;  2YPN A;  2EN3 A;  1B69 A;  5IXM B;  1YUI A;  1ZBQ A;  1STU A;  5A2Q C;  4OX9 E;  2EE8 A;  1GQE A;  4DV4 E;  4MLQ A;  1PJS A;  1WRJ A; 
#chains in the Genus database with same CATH homology
 3RMP A;  4DR3 E;  3ADL A;  4LU9 A;  2N3H A;  1XMO E;  1N34 E;  4F9A B;  2EZ6 A;  3JAM C;  3HQ1 A;  1XNQ E;  1YYK A;  3VK6 A;  2M4I A;  5CFF E;  4JI4 E;  4LTY A;  1IBK E;  1YYW A;  4F9C B;  3AUZ A;  4X8W A;  1N36 E;  2UUA E;  1DQ3 A;  4X64 E;  2HHH E;  1RQ0 A;  2M1S A;  4DV6 E;  2ODR D;  3F6H A;  4JYA E;  2KOU A;  5AE1 A;  1I94 E;  2L92 A;  2DMY A;  2JOB A;  2JVA A;  4LFB E;  2ODR C;  2VE7 C;  1N32 E;  1WXR A;  1RC7 A;  4LF9 E;  1XNR E;  3HTX A;  4WSP A;  2WZO A;  2KON A;  2CPN A;  4B3T E;  1O0W A;  4DR4 E;  5AE2 A;  1ZBT A;  2L2N A;  2LMZ A;  2V89 A;  4F54 A;  2YT4 A;  2L3C A;  1IBM E;  4LF4 E;  2VQE E;  2V8Q B;  4X62 E;  2LJH A;  1YZ9 A;  1GZ6 A;  5T6J A;  4DUZ E;  1UIL A;  4DUY E;  2JY9 A;  2V87 A;  4DV0 E;  2RSM A;  4I8O A;  2L6M A;  2ZM6 E;  2N3G A;  2L2M A;  3OTO E;  4GKK E;  2LE2 A;  4B3M E;  2G7H A;  4BS9 A;  4X66 E;  3C4B A;  3ADI A;  5IWA E;  4DV5 E;  4LF6 E;  4L8N A;  4BC7 A;  4DV2 E;  3FIG A;  3VYY A;  2UU9 E;  4B3S E;  4NXM E;  5LMU E;  2KHX A;  2VF1 A;  4F9B B;  4AQY E;  3IWD A;  3OML A;  4M30 A;  1X48 A;  1X47 A;  2DIX A;  4BCA A;  2V86 A;  3J80 C;  3T1H E;  1FKA E;  2LBS B;  2F8B A;  4OOG C;  1HNX E;  2F4V E;  2VQF E;  5F3W A;  4JI7 E;  1J26 A;  3J7Y p;  4BMJ A;  1N33 E;  4R8O A;  4DMI A;  4P7D A;  4M2Z A;  2MC5 A;  2UUC E;  2MC6 A;  2B9D A;  4JI5 E;  1YYO A;  2K4V A;  3HXL A;  1FJG E;  4KHP E;  3C4T A;  2V83 A;  1XMQ E;  1PKP A;  2NA2 A;  2L33 A;  3HPZ A;  3LLH A;  2JR1 A;  3ADG A;  4JI2 E;  3IWB A;  4GKJ E;  4WFT A;  2NUE A;  3AV0 A;  2RS6 A;  4JI8 E;  1WHQ A;  2LTS A;  4TUI A;  2L2K B;  2UUB E;  1WHN A;  3K6Q A;  2RS7 A;  3LML A;  1EKZ A;  4JI1 E;  2NUG A;  4DV1 E;  5BR8 E;  4JI6 E;  3J7A G;  4KZS A;  5ADZ A;  3IWC A;  2FGG A;  2B7V A;  4M0V A;  2JWO A;  1T4N A;  4L5N C;  2LUP B;  3JU0 A;  3MSW A;  4LFA E;  3H09 A;  4DV3 E;  4J8Z A;  5FLX C;  2UXD E;  3DF6 A;  2IHR 1;  2NUF A;  1HNW E;  4JI0 E;  2V85 A;  4DKK A;  2V88 A;  4Q28 A;  2M7Q A;  4LF7 E;  3P1X A;  5AE3 A;  4YY3 E;  3VYX A;  1QU6 A;  2E1M A;  2UXB E;  5AAS A;  2B3T B;  1SR9 A;  4YHH E;  4DR6 E;  3DJW A;  3ZOQ B;  4DR2 E;  2UXC E;  1IBL E;  2B7T A;  4WPY A;  1HNZ E;  3HPS A;  3KWR A;  3T1Y E;  4JV5 E;  4LF5 E;  4R03 A;  4BC9 A;  2DB2 A;  2YZT A;  5IT9 C;  4DR5 E;  2E5L E;  2LUQ A;  4LF8 E;  4NXN E;  1DI2 A;  4DR7 E;  1T4L B;  4TUG A;  2FV4 B;  3F6G A;  3ADJ A;  2LTR A;  4WYQ B;  4B3R E;  4JI3 E;  1ZBQ A;  2LRS A;  4LFC E;  4DR1 E;  2JOX A;  1STU A;  5A2Q C;  5LMN E;  1J5E E;  4OX9 E;  2MDR A;  5DNY A;  1GQE A;  2L8T A;  2L3J A;  4DV4 E;  4K0K E;  2RTX A;  4DV7 E;  2EWL A;  3J81 C;  4X65 E;  3JTZ A;  4GEQ B;  4P78 A;  2H36 X;  5LL6 R;  1UHZ A;  2FTX B;  1X49 A;  4BBY A;  1T4O A;  2DSY A;  1HR0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...