2RSMA

Solution structure and sirna-mediated knockdown analysis of the mitochondrial disease-related protein c12orf65 (ict2)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
GSSGSSGKWGLRLQEKPALLFPGMAASTVQVAGRKDYPALLPLNESELEEQFVKGHGPGGQATNKTSNCVVLKHVPSGIVVKCHQTRSVDQNRKIARKVLQEKVDVFYNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable peptide chain release factor C12orf65 homolog, mito
publication title Solution structure and siRNA-mediated knockdown analysis of the mitochondrial disease-related protein C12orf65.
pubmed doi rcsb
source organism Mus musculus
molecule tags Translation
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rsmA00
4LF8E 2LTRA 3C4BA 4X65E 1WHQA 1X48A 2L3CA 4B3ME 4WFTA 2B7VA 4X66E 4JI6E 4DR6E 2IHR1 4JYAE 1HNWE 2KHXA 4LF4E 2EZ6A 4JI2E 3LLHA 2VQEE 4X8WA 2NA2A 1O0WA 4JI8E 4DR3E 4KHPE 4DUZE 3J7Yp 2YT4A 4B3RE 1HNZE 2L2MA 1T4LB 4M2ZA 3C4TA 4X64E 3ADLA 1EKZA 5LMUE 4DV4E 2UUBE 4NXNE 3HTXA 4LF5E 4LF7E 4DKKA 1N36E 4DR1E 1IBLE 1X49A 4LF9E 3T1HE 1N33E 2L2NA 4DV0E 1XMQE 4NXME 1UHZA 2UUCE 2DB2A 4JI4E 1UILA 2DIXA 4DV1E 4GKJE 4JI1E 1J26A 1HNXE 1WHNA 1J5EE 4DR4E 4DR7E 1T4OA 2DMYA 3T1YE 1YYKA 2ZM6E 2NUEA 2N3HA 4M30A 2LUPB 5CFFE 3VYXA 2L3JA 4LFBE 2RS7A 4DV7E 2LTSA 5LMNE 2LRSA 4LFAE 2CPNA 1X47A 2L33A 2HHHE 1FKAE 4LF6E 2JY9A 2N3GA 4DV5E 1DI2A 2UXDE 2MDRA 4DV2E 1YYWA 1IBME 4B3TE 2RTXA 1IBKE 1T4NA 2L2KB 2UUAE 1HR0E 1ZBTA 2NUGA 1N34E 1RC7A 4JV5E 4JI5E 4WYQB 2LJHA 1PKPA 2JVAA 4JI7E 2RSMA 3P1XA 2B7TA 2RS6A 1YYOA 3ADJA 2UXBE 4K0KE 4YHHE 4DR2E 4B3SE 2VQFE 3VYYA 1YZ9A 2F4VE 1XNRE 2UXCE 3ADGA 4OOGC 1XNQE 1GQEA 4DUYE 1FJGE 1RQ0A 1N32E 1XMOE 3ADIA 2UU9E 4DR5E 2B3TB 4JI0E 4GKKE 2LUQA 3OTOE 4JI3E 1QU6A 4YY3E 5IWAE 4LFCE 4DV6E 2LBSB 5BR8E 2E5LE 2NUFA 4OX9E 4AQYE 1STUA 4DV3E 1I94E 4X62E
chains in the Genus database with same CATH superfamily
1PJSA 5KL7A 1WHQA 2J7JA 2VRDA 1EH8A 4WFTA 2B7VA 2HGHA 5A6BD 4JYAE 2JXPA 5AC4A 1JK2A 4F54A 1TF6A 4LF4E 2EZ6A 4X8WA 2NA2A 3F6HA 4JI8E 2WBUA 3JTZA 2DLQA 3J7Yp 4L5NC 3DF6A 4Q35B 2NABA 2HC5A 4X64E 3ADLA 1EKZA 4N4RB 4LU9A 2EOOA 4F9CB 2YSPA 2UUBE 2ELZA 4TUIA 3C6KA 1IQSA 4BC7A 3OMLA 2YWQA 2YTGA 4BMJA 1EH6A 3MHHC 3MHSC 1XMQE 4NXME 2DB2A 2EN2A 5LL6R 1UILA 4J8ZA 4F9BB 1DQ3A 2V89A 3BBGA 3J80C 1HNXE 2EN4A 3JU0A 1A1IA 2EL6A 4ZYHA 1T4OA 1WJPA 2WBSA 5KL4A 2NUEA 5KL2A 2N3HA 2YTJA 2FV4B 4M30A 2LUPB 5KL3A 3FIGA 2EM3A 3HQ1A 4LFBE 2LTSA 2EM6A 2LCEA 2EM4A 4WSPA 4LF6E 4DV5E 1DI2A 4BCAA 4GZNC 3IWCA 2UXDE 2EL5A 2L92A 3UK3C 3ZOQB 1YYWA 3VHTB 1L4SA 3TQMA 4R2AA 2L2KB 2EMHA 1HR0E 1PJQA 1TN9A 4JV5E 2I9IA 4R2PA 2V87A 2LMZA 2LE2A 2LJHA 1PKPA 2JVAA 3EPJA 1G2DC 1SFEA 4JI7E 2ADRA 2K4VA 1YYOA 2RS6A 2LVHA 1MGTA 2DGCA 4TUGA 1A1JA 3J7AG 3QG5C 1DGCA 1IMUA 1BBOA 3J81C 5A6KA 1X3CA 2CSHA 2EN7A 4DUYE 1RQ0A 2YRHA 3ADIA 2B3TB 4NHRA 2EM2A 2LUQA 2JPAA 2RSIA 1QU6A 4YY3E 3HXLA 1A1HA 3THNA 2JR1A 5BR8E 2NUFA 2EOYA 3HPSA 2EM5A 4AQYE 2RPCA 2YTOA 2JOXA 5TSEA 4R2EA 4LF8E 2LTRA 3C4BA 4ZYGA 4X65E 4R2SA 2EN1A 2EM7A 3H09A 4F2JC 2KHXA 3EQ1A 4JI2E 2BBGA 1T39A 1ZBQA 2R76A 3MSWA 4KHPE 4DUZE 2EN8A 4R2QA 2EN3A 2EWLA 4WSGA 1T4LB 1A1KA 2DRPA 2KONA 5LMUE 2EQ0A 2ODRD 4NXNE 1GZ6A 4DKKA 2EPRA 1N36E 3AUZA 1IBLE 1X49A 2FGGA 3IWBA 4M9VC 1N33E 2EMXA 5LLQA 1YPNA 2EMFA 5AASA 2EL4A 1BB8A 2L2NA 4WXCA 4DV0E 3EPHA 4GKJE 1J26A 1A1FA 5F3WA 2ELYA 1WHNA 1RMDA 4DMIA 1YYKA 2DMYA 3L00A 3LMLA 2B9DA 2E1MA 2MC5A 2PRTA 2EMCA 1YFHA 1MEYC 3VYXA 2EPUA 2RQLA 4I8OA 2WBTA 2RS7A 1PJTA 5LMNE 2EPZA 2V85A 4LFAE 2EMWA 2EPNA 5IT9C 2JY9A 2G7HA 3K6QA 4RH8A 4DV2E 1YUJA 4B3TE 5A69A 1IBKE 2EPXA 1ZBTA 1RC7A 2R1FA 4FK5C 2EMZA 4ZYDA 2YPNA 2RSMA 2EMGA 3P1XA 2B7TA 1N3GA 2UXBE 4K0KE 2A25A 4DR2E 2M1SA 4B3SE 2MDGA 5IXMB 2F4VE 1XNRE 1Z1BA 2UXCE 3ADGA 1GTKA 3BF2A 1QNTA 2EOFA 3JAMC 4M0VA 1XMOE 2V83A 2YRKA 2M9AA 4JI0E 5FLXC 3KWRA 4GKKE 3OTOE 4LFCE 1YSAC 2ENAA 2LBSB 4P78A 4F6NA 2E5LE 4OX9E 4DV3E 1I94E 1NEIA 4X62E 4WX9A 4O4KA 2EMAA 1X48A 2L3CA 4B3ME 2N8XA 4X66E 5AE1A 4JI6E 1HNWE 2IHR1 5A6BA 1JK1A 1HNZE 2YU8A 2L2MA 2YZTA 2M7QA 5A2QC 4M2ZA 3C4TA 5A6AA 4X9JA 5AE3A 4LF5E 2EOMA 4LF7E 2EQ3A 1NCSA 4MLVA 4Q28A 2V88A 1X6HA 4LF9E 2D9HA 3DJWA 3HPZA 2E72A 4BBYA 4KWYA 2EM0A 3BGHA 2UUCE 4DV1E 2DLKA 4KZSA 2MKNA 4JI1E 2CTDA 1P47A 1EH7A 2EMBA 2EOHA 4DR4E 2BB8A 3T1YE 1UBDC 2EOZA 2EPCA 2M4IA 2KOUA 2EPMX 4BHBA 2I13A 2LRSA 4P7DA 2EPAA 2EMLA 1X47A 2EN6A 2L33A 2HHHE 1FKAE 1G2FC 2N3GA 2EP3A 2ODRC 2MDRA 2HJJA 3VK6A 4F9AB 2VE7C 2UUAE 1WXRA 4WPYA 2WCC3 2V86A 2YSOA 2ENHA 2JYAA 2GPIA 2YRMA 3EPLA 1IQOA 3ADJA 2EQ1A 2ENCA 5IV8B 1B69A 4OOGC 1XNQE 5KL5A 1GQEA 1FJGE 2JP9A 1PDAA 1N32E 4GEQB 5A6JA 4HTGA 4JI3E 2H36X 1BBGA 1ZAAC 1AH5A 3AV0A 2L8TA 2FTXB 2EPKX 1TF3A 2WZOA 1ZU1A 5DNYA 1T38A 4BS9A 4IJDA 2CT1A 2L6MA 4DR6E 1X6EA 3LLHA 2VQEE 4BC9A 1O0WA 4DR3E 2EOXA 5KL6A 2YT4A 2YTNA 4B3RE 5AE2A 2VF1A 4R2CA 4HEIA 4DV4E 4O24A 4R2RA 4R03A 3HTXA 2EM9A 1AAYA 4R2DA 2EOSA 2EORA 4DR1E 1X6FA 3T1HE 2EPPA 2LO3A 2MKDA 2YTEA 4L8NA 4NZVA 2F8BA 4ZYEA 1UHZA 1UN6B 4JI4E 2DIXA 3BIDA 4R8OA 4BHCA 2JWOA 4WXDA 1ZR9A 1KJKA 3C6MA 1J5EE 3EPKA 3F6GA 4DR7E 2EPLX 1A1GA 1LLMC 2ZM6E 2LV2A 2EOJA 5CFFE 1F2IG 3KZYA 3IWDA 2L3JA 2V8QB 3RMPA 4DV7E 2EMIA 3KZZA 2EOEA 2CPNA 2MC6A 4F6MA 2K7IA 2YTQA 2YTIA 1KYQA 1X5WA 5ADZA 1IBME 1YUIA 1SR9A 2RTXA 3ECRA 4O43A 1T4NA 2LJUA 5AC5A 2YU5A 1N34E 2NUGA 4MLQA 2YTFA 2GLIA 4JI5E 2EPOA 4WYQB 2EE8A 4RHBB 2YTDA 2EJ4A 2DMIA 4YHHE 2VQFE 3VYYA 1YZ9A 2EM8A 2EOQA 2EMYA 2YTPA 4LTYA 1A1LA 2UU9E 4O5GA 4DR5E 2Q8UA 5T6JA 2JOBA 5IWAE 4DV6E 1WRJA 3THOB 4IS1C 2EOIA 2EMKA 3M99B 2GHFA 1STUA 2DSYA 2LT7A
chains in the Genus database with same CATH topology
4LF8E 2LTRA 3C4BA 5DNYA 4BS9A 4X65E 1WHQA 3H09A 1X48A 2L3CA 4B3ME 4WFTA 2B7VA 2L6MA 5AE1A 4X66E 2IHR1 4JI6E 4DR6E 4JYAE 1HNWE 2KHXA 4LF4E 2EZ6A 4JI2E 3LLHA 4F54A 2VQEE 4BC9A 4X8WA 2NA2A 1O0WA 1ZBQA 3F6HA 3MSWA 4JI8E 4DR3E 3JTZA 4KHPE 4DUZE 3J7Yp 4L5NC 2YT4A 3DF6A 4B3RE 1HNZE 2L2MA 2YZTA 2EWLA 2M7QA 2VF1A 5AE2A 5A2QC 1T4LB 4M2ZA 3C4TA 2KONA 4X64E 1EKZA 3ADLA 4LU9A 5LMUE 4DV4E 4F9CB 4R03A 2UUBE 2ODRD 5AE3A 4NXNE 4TUIA 3HTXA 4LF5E 1GZ6A 4LF7E 4DKKA 4BC7A 1N36E 3AUZA 3OMLA 1X49A 2FGGA 3IWBA 4Q28A 2V88A 4DR1E 1IBLE 4LF9E 3T1HE 1N33E 3DJWA 3HPZA 4BMJA 4L8NA 5AASA 2F8BA 2L2NA 4BBYA 4DV0E 1XMQE 4NXME 1UHZA 2UUCE 2DB2A 5LL6R 4F9BB 1UILA 2DIXA 4J8ZA 4KZSA 4DV1E 4JI4E 4JI1E 4R8OA 4GKJE 1J26A 2JWOA 1DQ3A 2V89A 5F3WA 3J80C 1HNXE 1WHNA 3JU0A 1J5EE 4DR4E 4DR7E 3F6GA 4DMIA 1T4OA 2DMYA 3LMLA 3T1YE 1YYKA 2ZM6E 2B9DA 2E1MA 2NUEA 2N3HA 2FV4B 2MC5A 4M30A 2M4IA 2KOUA 2LUPB 3FIGA 5CFFE 3VYXA 3IWDA 3HQ1A 4I8OA 2L3JA 4LFBE 2V8QB 3RMPA 2RS7A 4DV7E 2LTSA 5LMNE 2LRSA 4P7DA 2V85A 4LFAE 2WZOA 2CPNA 2MC6A 1X47A 2L33A 2HHHE 4WSPA 5IT9C 1FKAE 4LF6E 2JY9A 2N3GA 4DV5E 1DI2A 4BCAA 2G7HA 3IWCA 2UXDE 3K6QA 2ODRC 2MDRA 3VK6A 4DV2E 2L92A 4F9AB 3ZOQB 1YYWA 5ADZA 1IBME 4B3TE 1SR9A 2RTXA 2VE7C 1IBKE 1T4NA 2L2KB 2UUAE 1WXRA 1ZBTA 4WPYA 1N34E 1RC7A 1HR0E 2NUGA 4JV5E 2V86A 2V87A 4JI5E 4WYQB 2LMZA 2LE2A 2LJHA 1PKPA 2JVAA 4JI7E 2RSMA 2K4VA 3P1XA 2B7TA 2RS6A 1YYOA 3ADJA 2UXBE 4K0KE 4TUGA 4YHHE 4DR2E 2M1SA 3J7AG 4B3SE 2VQFE 3VYYA 1YZ9A 2F4VE 1XNRE 3J81C 2UXCE 3ADGA 4OOGC 1XNQE 1GQEA 4DUYE 1FJGE 4LTYA 1RQ0A 3JAMC 4GEQB 1N32E 4M0VA 1XMOE 2V83A 3ADIA 2UU9E 4DR5E 2B3TB 3KWRA 5FLXC 4JI0E 2LUQA 2H36X 3OTOE 4JI3E 4GKKE 5T6JA 1QU6A 2JOBA 4YY3E 5IWAE 3HXLA 4LFCE 4DV6E 2LBSB 4P78A 3AV0A 2JR1A 5BR8E 2E5LE 2NUFA 2L8TA 2FTXB 4OX9E 3HPSA 4AQYE 1STUA 2DSYA 4DV3E 1I94E 4X62E 2JOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 E;  2LTR A;  3C4B A;  4X65 E;  1WHQ A;  1X48 A;  2L3C A;  4B3M E;  4WFT A;  2B7V A;  4X66 E;  4JI6 E;  4DR6 E;  2IHR 1;  4JYA E;  1HNW E;  2KHX A;  4LF4 E;  2EZ6 A;  4JI2 E;  3LLH A;  2VQE E;  4X8W A;  2NA2 A;  1O0W A;  4JI8 E;  4DR3 E;  4KHP E;  4DUZ E;  3J7Y p;  2YT4 A;  4B3R E;  1HNZ E;  2L2M A;  1T4L B;  4M2Z A;  3C4T A;  4X64 E;  3ADL A;  1EKZ A;  5LMU E;  4DV4 E;  2UUB E;  4NXN E;  3HTX A;  4LF5 E;  4LF7 E;  4DKK A;  1N36 E;  4DR1 E;  1IBL E;  1X49 A;  4LF9 E;  3T1H E;  1N33 E;  2L2N A;  4DV0 E;  1XMQ E;  4NXM E;  1UHZ A;  2UUC E;  2DB2 A;  4JI4 E;  1UIL A;  2DIX A;  4DV1 E;  4GKJ E;  4JI1 E;  1J26 A;  1HNX E;  1WHN A;  1J5E E;  4DR4 E;  4DR7 E;  1T4O A;  2DMY A;  3T1Y E;  1YYK A;  2ZM6 E;  2NUE A;  2N3H A;  4M30 A;  2LUP B;  5CFF E;  3VYX A;  2L3J A;  4LFB E;  2RS7 A;  4DV7 E;  2LTS A;  5LMN E;  2LRS A;  4LFA E;  2CPN A;  1X47 A;  2L33 A;  2HHH E;  1FKA E;  4LF6 E;  2JY9 A;  2N3G A;  4DV5 E;  1DI2 A;  2UXD E;  2MDR A;  4DV2 E;  1YYW A;  1IBM E;  4B3T E;  2RTX A;  1IBK E;  1T4N A;  2L2K B;  2UUA E;  1HR0 E;  1ZBT A;  2NUG A;  1N34 E;  1RC7 A;  4JV5 E;  4JI5 E;  4WYQ B;  2LJH A;  1PKP A;  2JVA A;  4JI7 E;  2RSM A;  3P1X A;  2B7T A;  2RS6 A;  1YYO A;  3ADJ A;  2UXB E;  4K0K E;  4YHH E;  4DR2 E;  4B3S E;  2VQF E;  3VYY A;  1YZ9 A;  2F4V E;  1XNR E;  2UXC E;  3ADG A;  4OOG C;  1XNQ E;  1GQE A;  4DUY E;  1FJG E;  1RQ0 A;  1N32 E;  1XMO E;  3ADI A;  2UU9 E;  4DR5 E;  2B3T B;  4JI0 E;  4GKK E;  2LUQ A;  3OTO E;  4JI3 E;  1QU6 A;  4YY3 E;  5IWA E;  4LFC E;  4DV6 E;  2LBS B;  5BR8 E;  2E5L E;  2NUF A;  4OX9 E;  4AQY E;  1STU A;  4DV3 E;  1I94 E;  4X62 E; 
#chains in the Genus database with same CATH topology
 1PJS A;  5KL7 A;  1WHQ A;  2J7J A;  2VRD A;  1EH8 A;  4WFT A;  2B7V A;  2HGH A;  5A6B D;  4JYA E;  2JXP A;  5AC4 A;  1JK2 A;  4F54 A;  1TF6 A;  4LF4 E;  2EZ6 A;  4X8W A;  2NA2 A;  3F6H A;  4JI8 E;  2WBU A;  3JTZ A;  2DLQ A;  3J7Y p;  4L5N C;  3DF6 A;  4Q35 B;  2NAB A;  2HC5 A;  4X64 E;  3ADL A;  1EKZ A;  4N4R B;  4LU9 A;  2EOO A;  4F9C B;  2YSP A;  2UUB E;  2ELZ A;  4TUI A;  3C6K A;  1IQS A;  4BC7 A;  3OML A;  2YWQ A;  2YTG A;  4BMJ A;  1EH6 A;  3MHH C;  3MHS C;  1XMQ E;  4NXM E;  2DB2 A;  2EN2 A;  5LL6 R;  1UIL A;  4J8Z A;  4F9B B;  1DQ3 A;  2V89 A;  3BBG A;  3J80 C;  1HNX E;  2EN4 A;  3JU0 A;  1A1I A;  2EL6 A;  4ZYH A;  1T4O A;  1WJP A;  2WBS A;  5KL4 A;  2NUE A;  5KL2 A;  2N3H A;  2YTJ A;  2FV4 B;  4M30 A;  2LUP B;  5KL3 A;  3FIG A;  2EM3 A;  3HQ1 A;  4LFB E;  2LTS A;  2EM6 A;  2LCE A;  2EM4 A;  4WSP A;  4LF6 E;  4DV5 E;  1DI2 A;  4BCA A;  4GZN C;  3IWC A;  2UXD E;  2EL5 A;  2L92 A;  3UK3 C;  3ZOQ B;  1YYW A;  3VHT B;  1L4S A;  3TQM A;  4R2A A;  2L2K B;  2EMH A;  1HR0 E;  1PJQ A;  1TN9 A;  4JV5 E;  2I9I A;  4R2P A;  2V87 A;  2LMZ A;  2LE2 A;  2LJH A;  1PKP A;  2JVA A;  3EPJ A;  1G2D C;  1SFE A;  4JI7 E;  2ADR A;  2K4V A;  1YYO A;  2RS6 A;  2LVH A;  1MGT A;  2DGC A;  4TUG A;  1A1J A;  3J7A G;  3QG5 C;  1DGC A;  1IMU A;  1BBO A;  3J81 C;  5A6K A;  1X3C A;  2CSH A;  2EN7 A;  4DUY E;  1RQ0 A;  2YRH A;  3ADI A;  2B3T B;  4NHR A;  2EM2 A;  2LUQ A;  2JPA A;  2RSI A;  1QU6 A;  4YY3 E;  3HXL A;  1A1H A;  3THN A;  2JR1 A;  5BR8 E;  2NUF A;  2EOY A;  3HPS A;  2EM5 A;  4AQY E;  2RPC A;  2YTO A;  2JOX A;  5TSE A;  4R2E A;  4LF8 E;  2LTR A;  3C4B A;  4ZYG A;  4X65 E;  4R2S A;  2EN1 A;  2EM7 A;  3H09 A;  4F2J C;  2KHX A;  3EQ1 A;  4JI2 E;  2BBG A;  1T39 A;  1ZBQ A;  2R76 A;  3MSW A;  4KHP E;  4DUZ E;  2EN8 A;  4R2Q A;  2EN3 A;  2EWL A;  4WSG A;  1T4L B;  1A1K A;  2DRP A;  2KON A;  5LMU E;  2EQ0 A;  2ODR D;  4NXN E;  1GZ6 A;  4DKK A;  2EPR A;  1N36 E;  3AUZ A;  1IBL E;  1X49 A;  2FGG A;  3IWB A;  4M9V C;  1N33 E;  2EMX A;  5LLQ A;  1YPN A;  2EMF A;  5AAS A;  2EL4 A;  1BB8 A;  2L2N A;  4WXC A;  4DV0 E;  3EPH A;  4GKJ E;  1J26 A;  1A1F A;  5F3W A;  2ELY A;  1WHN A;  1RMD A;  4DMI A;  1YYK A;  2DMY A;  3L00 A;  3LML A;  2B9D A;  2E1M A;  2MC5 A;  2PRT A;  2EMC A;  1YFH A;  1MEY C;  3VYX A;  2EPU A;  2RQL A;  4I8O A;  2WBT A;  2RS7 A;  1PJT A;  5LMN E;  2EPZ A;  2V85 A;  4LFA E;  2EMW A;  2EPN A;  5IT9 C;  2JY9 A;  2G7H A;  3K6Q A;  4RH8 A;  4DV2 E;  1YUJ A;  4B3T E;  5A69 A;  1IBK E;  2EPX A;  1ZBT A;  1RC7 A;  2R1F A;  4FK5 C;  2EMZ A;  4ZYD A;  2YPN A;  2RSM A;  2EMG A;  3P1X A;  2B7T A;  1N3G A;  2UXB E;  4K0K E;  2A25 A;  4DR2 E;  2M1S A;  4B3S E;  2MDG A;  5IXM B;  2F4V E;  1XNR E;  1Z1B A;  2UXC E;  3ADG A;  1GTK A;  3BF2 A;  1QNT A;  2EOF A;  3JAM C;  4M0V A;  1XMO E;  2V83 A;  2YRK A;  2M9A A;  4JI0 E;  5FLX C;  3KWR A;  4GKK E;  3OTO E;  4LFC E;  1YSA C;  2ENA A;  2LBS B;  4P78 A;  4F6N A;  2E5L E;  4OX9 E;  4DV3 E;  1I94 E;  1NEI A;  4X62 E;  4WX9 A;  4O4K A;  2EMA A;  1X48 A;  2L3C A;  4B3M E;  2N8X A;  4X66 E;  5AE1 A;  4JI6 E;  1HNW E;  2IHR 1;  5A6B A;  1JK1 A;  1HNZ E;  2YU8 A;  2L2M A;  2YZT A;  2M7Q A;  5A2Q C;  4M2Z A;  3C4T A;  5A6A A;  4X9J A;  5AE3 A;  4LF5 E;  2EOM A;  4LF7 E;  2EQ3 A;  1NCS A;  4MLV A;  4Q28 A;  2V88 A;  1X6H A;  4LF9 E;  2D9H A;  3DJW A;  3HPZ A;  2E72 A;  4BBY A;  4KWY A;  2EM0 A;  3BGH A;  2UUC E;  4DV1 E;  2DLK A;  4KZS A;  2MKN A;  4JI1 E;  2CTD A;  1P47 A;  1EH7 A;  2EMB A;  2EOH A;  4DR4 E;  2BB8 A;  3T1Y E;  1UBD C;  2EOZ A;  2EPC A;  2M4I A;  2KOU A;  2EPM X;  4BHB A;  2I13 A;  2LRS A;  4P7D A;  2EPA A;  2EML A;  1X47 A;  2EN6 A;  2L33 A;  2HHH E;  1FKA E;  1G2F C;  2N3G A;  2EP3 A;  2ODR C;  2MDR A;  2HJJ A;  3VK6 A;  4F9A B;  2VE7 C;  2UUA E;  1WXR A;  4WPY A;  2WCC 3;  2V86 A;  2YSO A;  2ENH A;  2JYA A;  2GPI A;  2YRM A;  3EPL A;  1IQO A;  3ADJ A;  2EQ1 A;  2ENC A;  5IV8 B;  1B69 A;  4OOG C;  1XNQ E;  5KL5 A;  1GQE A;  1FJG E;  2JP9 A;  1PDA A;  1N32 E;  4GEQ B;  5A6J A;  4HTG A;  4JI3 E;  2H36 X;  1BBG A;  1ZAA C;  1AH5 A;  3AV0 A;  2L8T A;  2FTX B;  2EPK X;  1TF3 A;  2WZO A;  1ZU1 A;  5DNY A;  1T38 A;  4BS9 A;  4IJD A;  2CT1 A;  2L6M A;  4DR6 E;  1X6E A;  3LLH A;  2VQE E;  4BC9 A;  1O0W A;  4DR3 E;  2EOX A;  5KL6 A;  2YT4 A;  2YTN A;  4B3R E;  5AE2 A;  2VF1 A;  4R2C A;  4HEI A;  4DV4 E;  4O24 A;  4R2R A;  4R03 A;  3HTX A;  2EM9 A;  1AAY A;  4R2D A;  2EOS A;  2EOR A;  4DR1 E;  1X6F A;  3T1H E;  2EPP A;  2LO3 A;  2MKD A;  2YTE A;  4L8N A;  4NZV A;  2F8B A;  4ZYE A;  1UHZ A;  1UN6 B;  4JI4 E;  2DIX A;  3BID A;  4R8O A;  4BHC A;  2JWO A;  4WXD A;  1ZR9 A;  1KJK A;  3C6M A;  1J5E E;  3EPK A;  3F6G A;  4DR7 E;  2EPL X;  1A1G A;  1LLM C;  2ZM6 E;  2LV2 A;  2EOJ A;  5CFF E;  1F2I G;  3KZY A;  3IWD A;  2L3J A;  2V8Q B;  3RMP A;  4DV7 E;  2EMI A;  3KZZ A;  2EOE A;  2CPN A;  2MC6 A;  4F6M A;  2K7I A;  2YTQ A;  2YTI A;  1KYQ A;  1X5W A;  5ADZ A;  1IBM E;  1YUI A;  1SR9 A;  2RTX A;  3ECR A;  4O43 A;  1T4N A;  2LJU A;  5AC5 A;  2YU5 A;  1N34 E;  2NUG A;  4MLQ A;  2YTF A;  2GLI A;  4JI5 E;  2EPO A;  4WYQ B;  2EE8 A;  4RHB B;  2YTD A;  2EJ4 A;  2DMI A;  4YHH E;  2VQF E;  3VYY A;  1YZ9 A;  2EM8 A;  2EOQ A;  2EMY A;  2YTP A;  4LTY A;  1A1L A;  2UU9 E;  4O5G A;  4DR5 E;  2Q8U A;  5T6J A;  2JOB A;  5IWA E;  4DV6 E;  1WRJ A;  3THO B;  4IS1 C;  2EOI A;  2EMK A;  3M99 B;  2GHF A;  1STU A;  2DSY A;  2LT7 A; 
#chains in the Genus database with same CATH homology
 4LF8 E;  2LTR A;  3C4B A;  5DNY A;  4BS9 A;  4X65 E;  1WHQ A;  3H09 A;  1X48 A;  2L3C A;  4B3M E;  4WFT A;  2B7V A;  2L6M A;  5AE1 A;  4X66 E;  2IHR 1;  4JI6 E;  4DR6 E;  4JYA E;  1HNW E;  2KHX A;  4LF4 E;  2EZ6 A;  4JI2 E;  3LLH A;  4F54 A;  2VQE E;  4BC9 A;  4X8W A;  2NA2 A;  1O0W A;  1ZBQ A;  3F6H A;  3MSW A;  4JI8 E;  4DR3 E;  3JTZ A;  4KHP E;  4DUZ E;  3J7Y p;  4L5N C;  2YT4 A;  3DF6 A;  4B3R E;  1HNZ E;  2L2M A;  2YZT A;  2EWL A;  2M7Q A;  2VF1 A;  5AE2 A;  5A2Q C;  1T4L B;  4M2Z A;  3C4T A;  2KON A;  4X64 E;  1EKZ A;  3ADL A;  4LU9 A;  5LMU E;  4DV4 E;  4F9C B;  4R03 A;  2UUB E;  2ODR D;  5AE3 A;  4NXN E;  4TUI A;  3HTX A;  4LF5 E;  1GZ6 A;  4LF7 E;  4DKK A;  4BC7 A;  1N36 E;  3AUZ A;  3OML A;  1X49 A;  2FGG A;  3IWB A;  4Q28 A;  2V88 A;  4DR1 E;  1IBL E;  4LF9 E;  3T1H E;  1N33 E;  3DJW A;  3HPZ A;  4BMJ A;  4L8N A;  5AAS A;  2F8B A;  2L2N A;  4BBY A;  4DV0 E;  1XMQ E;  4NXM E;  1UHZ A;  2UUC E;  2DB2 A;  5LL6 R;  4F9B B;  1UIL A;  2DIX A;  4J8Z A;  4KZS A;  4DV1 E;  4JI4 E;  4JI1 E;  4R8O A;  4GKJ E;  1J26 A;  2JWO A;  1DQ3 A;  2V89 A;  5F3W A;  3J80 C;  1HNX E;  1WHN A;  3JU0 A;  1J5E E;  4DR4 E;  4DR7 E;  3F6G A;  4DMI A;  1T4O A;  2DMY A;  3LML A;  3T1Y E;  1YYK A;  2ZM6 E;  2B9D A;  2E1M A;  2NUE A;  2N3H A;  2FV4 B;  2MC5 A;  4M30 A;  2M4I A;  2KOU A;  2LUP B;  3FIG A;  5CFF E;  3VYX A;  3IWD A;  3HQ1 A;  4I8O A;  2L3J A;  4LFB E;  2V8Q B;  3RMP A;  2RS7 A;  4DV7 E;  2LTS A;  5LMN E;  2LRS A;  4P7D A;  2V85 A;  4LFA E;  2WZO A;  2CPN A;  2MC6 A;  1X47 A;  2L33 A;  2HHH E;  4WSP A;  5IT9 C;  1FKA E;  4LF6 E;  2JY9 A;  2N3G A;  4DV5 E;  1DI2 A;  4BCA A;  2G7H A;  3IWC A;  2UXD E;  3K6Q A;  2ODR C;  2MDR A;  3VK6 A;  4DV2 E;  2L92 A;  4F9A B;  3ZOQ B;  1YYW A;  5ADZ A;  1IBM E;  4B3T E;  1SR9 A;  2RTX A;  2VE7 C;  1IBK E;  1T4N A;  2L2K B;  2UUA E;  1WXR A;  1ZBT A;  4WPY A;  1N34 E;  1RC7 A;  1HR0 E;  2NUG A;  4JV5 E;  2V86 A;  2V87 A;  4JI5 E;  4WYQ B;  2LMZ A;  2LE2 A;  2LJH A;  1PKP A;  2JVA A;  4JI7 E;  2RSM A;  2K4V A;  3P1X A;  2B7T A;  2RS6 A;  1YYO A;  3ADJ A;  2UXB E;  4K0K E;  4TUG A;  4YHH E;  4DR2 E;  2M1S A;  3J7A G;  4B3S E;  2VQF E;  3VYY A;  1YZ9 A;  2F4V E;  1XNR E;  3J81 C;  2UXC E;  3ADG A;  4OOG C;  1XNQ E;  1GQE A;  4DUY E;  1FJG E;  4LTY A;  1RQ0 A;  3JAM C;  4GEQ B;  1N32 E;  4M0V A;  1XMO E;  2V83 A;  3ADI A;  2UU9 E;  4DR5 E;  2B3T B;  3KWR A;  5FLX C;  4JI0 E;  2LUQ A;  2H36 X;  3OTO E;  4JI3 E;  4GKK E;  5T6J A;  1QU6 A;  2JOB A;  4YY3 E;  5IWA E;  3HXL A;  4LFC E;  4DV6 E;  2LBS B;  4P78 A;  3AV0 A;  2JR1 A;  5BR8 E;  2E5L E;  2NUF A;  2L8T A;  2FTX B;  4OX9 E;  3HPS A;  4AQY E;  1STU A;  2DSY A;  4DV3 E;  1I94 E;  4X62 E;  2JOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...