2LRSA

The second dsrbd domain from a. thaliana dicer-like 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
NDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Second Double-Stranded RNA Binding Domain of Dicer-like Ribonuclease 1: Structural and Biochemical Characterization.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Endoribonuclease Dicer homolog 1
total genus 15
structure length 71
sequence length 71
ec nomenclature ec 3.1.26.-:
pdb deposition date 2012-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lrsA00
1FJGE 1YZ9A 2RTXA 1N33E 4B3ME 2DB2A 2YT4A 2RS6A 3C4BA 4JV5E 4X64E 2L2NA 2LTRA 4DV2E 1XMQE 1YYWA 3T1YE 2B7TA 2UUAE 2L2MA 4DKKA 3LLHA 4WFTA 2JY9A 1HNXE 2ZM6E 2JVAA 1YYOA 4DV5E 2DMYA 1RC7A 4JI6E 4B3RE 3P1XA 3VYYA 2MDRA 2RSMA 4DV1E 4X62E 2LBSB 2LTSA 4X65E 2UUBE 2NUFA 1UILA 1N36E 1EKZA 1J26A 2KHXA 4LF7E 2L3CA 1J5EE 3ADIA 1IBKE 2HHHE 1T4NA 4LF4E 1QU6A 1WHNA 4KHPE 4DV7E 3J7Yp 2UXDE 4LF5E 3ADGA 4OOGC 4DR3E 2LRSA 5IWAE 5BR8E 4YHHE 4JI8E 4JI4E 4DV4E 4DR4E 4LFBE 4OX9E 4JI5E 1WHQA 2B3TB 2LUPB 4NXME 4DV0E 4B3SE 5LMNE 3C4TA 2UXBE 2LUQA 4LF6E 3OTOE 2LJHA 4DV3E 1T4LB 1N32E 2RS7A 4X66E 4AQYE 1RQ0A 4DUZE 4X8WA 2L2KB 4DV6E 3VYXA 2DIXA 4K0KE 1ZBTA 4JI7E 2E5LE 4JI0E 1UHZA 4GKKE 3T1HE 1IBME 4DR6E 1T4OA 1HNZE 3ADLA 1N34E 4JI2E 1DI2A 2VQFE 2UXCE 4GKJE 2NA2A 1O0WA 1X48A 4NXNE 1YYKA 2N3GA 2B7VA 1HR0E 4M2ZA 1FKAE 4JI3E 1GQEA 2N3HA 4DR1E 1STUA 3ADJA 1I94E 4DR2E 4LF9E 1PKPA 1IBLE 4JI1E 1X47A 4JYAE 4DR5E 2UU9E 4WYQB 1XNQE 4B3TE 4M30A 4DUYE 1XNRE 2EZ6A 4YY3E 2F4VE 2UUCE 4LFAE 2CPNA 4DR7E 2NUEA 2VQEE 5CFFE 5LMUE 2IHR1 2L33A 2NUGA 2L3JA 4LF8E 1X49A 4LFCE 3HTXA 1XMOE 1HNWE
chains in the Genus database with same CATH superfamily
1FJGE 2EPPA 4B3ME 2WZOA 4O43A 4F6NA 2YT4A 5KL3A 2LV2A 4X64E 3AV0A 4DV2E 1X6HA 5AC5A 3T1YE 2EMWA 2UUAE 3L00A 2EM8A 2L2MA 3LLHA 4O5GA 1YUJA 1IQSA 2DMYA 2YRKA 4JI6E 1QNTA 3C6MA 3JAMC 4B3RE 3M99B 2HGHA 1T38A 5A6AA 1EKZA 4R2AA 4R2QA 1A1GA 4LF7E 5DNYA 2ENAA 2MC5A 5A6KA 2HHHE 2GHFA 5KL5A 1T4NA 2EOXA 4KHPE 2UXDE 3DJWA 2FTXB 1EH8A 3QG5C 4DR3E 5IWAE 2EQ0A 2GPIA 4JI4E 4LFBE 4OX9E 1PJQA 2E72A 4WXCA 2KONA 1DGCA 4NXME 3C4TA 2ADRA 2LUQA 1X6EA 2EQ1A 1L4SA 1T39A 2MKNA 4AQYE 1F2IG 2EPOA 4DUZE 2B9DA 4X8WA 5AE1A 3VYXA 4L8NA 1G2DC 1A1JA 1ZBTA 2E5LE 3T1HE 1JK1A 2EN7A 2RQLA 1A1HA 2EM3A 1NEIA 2UXCE 3J80C 5KL4A 2I9IA 4NXNE 5IV8B 5IXMB 5AC4A 4BHBA 1I94E 2EMKA 4LF9E 4WSGA 1PKPA 2LT7A 1IBLE 1A1LA 3UK3C 2UU9E 3ZOQB 2EZ6A 2V86A 2EL5A 5F3WA 2EPCA 2UUCE 2EPKX 4LFAE 2EOZA 3THNA 4TUIA 2L33A 4LF8E 2EN8A 3RMPA 2EOEA 2EPRA 2EM2A 4LFCE 2K7IA 1YZ9A 2RTXA 1GZ6A 1ZR9A 2WBSA 3KZZA 1UN6B 4GEQB 1NCSA 2WCC3 2L6MA 4JV5E 1BBOA 3KWRA 2R76A 2EMYA 2EMHA 1WJPA 1XMQE 2M7QA 2EMAA 4WFTA 1X6FA 1PJTA 2JY9A 3J81C 2JVAA 3F6HA 1YYOA 4DV5E 3EPJA 1RC7A 2EORA 3F6GA 3TQMA 3P1XA 4F54A 2YPNA 4R2SA 4IS1C 2EE8A 4KZSA 4GZNC 2YTOA 2NUFA 1N36E 2EOOA 3J7AG 1SR9A 2LE2A 2M9AA 4BMJA 4WX9A 4LF4E 3HQ1A 1QU6A 1WHNA 2YZTA 2YU8A 2EMFA 4LF5E 3ADGA 2DRPA 1EH7A 5BR8E 1A1FA 2DMIA 2EMBA 2EM6A 3EPKA 2EMZA 4HTGA 1IMUA 5LL6R 4JI5E 2YTIA 2YRHA 2B3TB 2LUPB 2EN3A 5LMNE 2UXBE 3IWDA 4LF6E 2CT1A 2LJHA 1T4LB 2JPAA 5LLQA 3MSWA 5IT9C 1RQ0A 3C6KA 4BHCA 1MGTA 4BS9A 2ODRC 1WRJA 2G7HA 1ZAAC 2DIXA 2LCEA 4N4RB 2HC5A 4JI0E 2JP9A 5KL7A 2E1MA 2DGCA 4GKKE 1IBME 4DR6E 4F9BB 1WXRA 3JU0A 2CTDA 4RH8A 2YWQA 2EPNA 2VF1A 2J7JA 4GKJE 2NA2A 4M9VC 2B7VA 1FKAE 1DQ3A 4JI3E 2V87A 4JI1E 1X47A 2EP3A 1YPNA 2EL4A 2EPXA 4DR5E 2H36X 2YTJA 2YTPA 3MHHC 2DLQA 4DUYE 2EMLA 4YY3E 2M1SA 4R2DA 2V8QB 1BBGA 2KOUA 2CPNA 2K4VA 2PRTA 4RHBB 5A6BA 2MC6A 4IJDA 4Q28A 2VQEE 1YSAC 2EOMA 4J8ZA 4DMIA 1PJSA 3JTZA 2YSPA 1X3CA 4R2CA 1Z1BA 1XMOE 2ENHA 4R8OA 4WSPA 1KYQA 3H09A 2EOHA 2RS6A 2EQ3A 4Q35B 2ENCA 3K6QA 1P47A 1YUIA 2L2NA 2LTRA 3HPZA 4BC7A 4R2EA 2JOXA 2WBUA 2ELYA 2L92A 2YTNA 2VE7C 4DKKA 2FGGA 2YU5A 1HNXE 3VYYA 2HJJA 2RSMA 2CSHA 2LBSB 4X65E 1UILA 2EM9A 2V88A 2YRMA 1AAYA 3DF6A 5KL2A 2EOSA 3BIDA 3IWBA 1J26A 2KHXA 2EM0A 2RSIA 3ADIA 1IBKE 2Q8UA 5TSEA 4DV7E 2EN4A 3J7Yp 2EN6A 2ELZA 2EMXA 5AASA 1AH5A 4R2RA 1TN9A 2LRSA 2A25A 2L8TA 2N8XA 4JI8E 1LLMC 2DLKA 2FV4B 4DR4E 4ZYHA 2R1FA 2VRDA 2I13A 1WHQA 3FIGA 2EJ4A 4DV0E 2YTEA 4B3SE 2JR1A 4DV3E 2EPAA 2EN1A 4DV6E 2L2KB 2LJUA 2YTGA 5ADZA 5A6JA 4K0KE 2YTQA 4NZVA 4L5NC 4WPYA 4JI7E 3BGHA 3IWCA 4F6MA 1N34E 4JI2E 4BC9A 4ZYEA 3EPHA 4MLQA 2EMIA 1X48A 2EPMX 1YYKA 1HR0E 4M2ZA 2EL6A 3VK6A 4BCAA 4ZYGA 4P78A 2EM5A 2EPUA 2N3HA 3AUZA 1STUA 4DR2E 2BBGA 2LVHA 4JYAE 4LU9A 2EOIA 3OMLA 4WYQB 2MDGA 1XNQE 5AE3A 3KZYA 1XNRE 2F4VE 3LMLA 5T6JA 5KL6A 5LMUE 5CFFE 1X5WA 2IHR1 2NUGA 2L3JA 4BBYA 4O4KA 1TF3A 3HTXA 1HNWE 2YSOA 1N33E 2V85A 2DB2A 2EOQA 2BB8A 3C4BA 5A69A 3THOB 2ODRD 4I8OA 2EMCA 1A1IA 1YYWA 3MHSC 2B7TA 4X9JA 1RMDA 5AE2A 2ZM6E 2WBTA 1BB8A 2D9HA 1KJKA 1ZU1A 2MDRA 2LMZA 4DV1E 3HPSA 4X62E 2EMGA 2LTSA 2UUBE 1IQOA 4M0VA 2L3CA 3EPLA 4ZYDA 1J5EE 4P7DA 2EM4A 2EOJA 4R03A 2LO3A 5A6BD 2EWLA 4OOGC 4HEIA 2JOBA 2YTDA 4MLVA 4YHHE 1TF6A 4FK5C 1A1KA 2EN2A 4DV4E 4LTYA 2JXPA 5FLXC 2F8BA 2EPLX 4F9AB 4NHRA 3OTOE 1N32E 2RS7A 4X66E 2JYAA 5A2QC 4KWYA 1G2FC 1PDAA 2M4IA 4O24A 1EH6A 1UBDC 2EPZA 3ECRA 1N3GA 1UHZA 3BF2A 4TUGA 2V83A 1B69A 1T4OA 2V89A 4F2JC 1HNZE 3ADLA 2EOFA 1DI2A 2VQFE 3BBGA 1O0WA 2EOYA 2N3GA 1SFEA 2NABA 1GQEA 4DR1E 3ADJA 1GTKA 2MKDA 2DSYA 2JWOA 4B3TE 4M30A 3EQ1A 4R2PA 4F9CB 4DR7E 2NUEA 1MEYC 3VHTB 4WXDA 1YFHA 2GLIA 1ZBQA 1JK2A 3HXLA 2RPCA 1X49A 2YTFA 2EM7A
chains in the Genus database with same CATH topology
1FJGE 1YZ9A 2RTXA 1N33E 4R8OA 4WSPA 1GZ6A 4B3ME 2WZOA 2V85A 3H09A 2DB2A 2YT4A 2RS6A 4GEQB 3C4BA 2L6MA 4JV5E 3K6QA 3KWRA 4X64E 2ODRD 3AV0A 2L2NA 2LTRA 4I8OA 4DV2E 3HPZA 4BC7A 1XMQE 1YYWA 2JOXA 3T1YE 2B7TA 2L92A 2M7QA 2UUAE 2VE7C 2L2MA 4DKKA 3LLHA 2FGGA 4WFTA 2JY9A 5AE2A 1HNXE 3J81C 2ZM6E 2JVAA 3F6HA 1YYOA 4DV5E 2DMYA 1RC7A 3F6GA 4JI6E 3JAMC 4B3RE 4F54A 3P1XA 3VYYA 2MDRA 2LMZA 2RSMA 4DV1E 3HPSA 4X62E 2LBSB 2LTSA 4KZSA 4X65E 2UUBE 2NUFA 1UILA 1N36E 2V88A 3J7AG 3DF6A 1SR9A 3IWBA 2LE2A 1EKZA 4M0VA 1J26A 2KHXA 4LF7E 4BMJA 2L3CA 5DNYA 1J5EE 3ADIA 2MC5A 4P7DA 1IBKE 2HHHE 1T4NA 4R03A 3HQ1A 4LF4E 1QU6A 1WHNA 2YZTA 4DV7E 3DJWA 3J7Yp 2FTXB 4KHPE 2UXDE 5AASA 3ADGA 2EWLA 4LF5E 4OOGC 4DR3E 2JOBA 2LRSA 5IWAE 5BR8E 2L8TA 4YHHE 4JI8E 4JI4E 2FV4B 4DV4E 4DR4E 4LFBE 4OX9E 4LTYA 5LL6R 1WHQA 3FIGA 4JI5E 2B3TB 2KONA 5FLXC 2LUPB 4NXME 2F8BA 4DV0E 4B3SE 3C4TA 5LMNE 2UXBE 4F9AB 2JR1A 3IWDA 2LUQA 4LF6E 3OTOE 2LJHA 4DV3E 1T4LB 1N32E 2RS7A 4X66E 3MSWA 5IT9C 5A2QC 4AQYE 4GKKE 1RQ0A 2M4IA 4DUZE 2B9DA 4X8WA 5AE1A 2L2KB 4DV6E 3VYXA 4BS9A 2ODRC 2G7HA 2DIXA 4L8NA 5ADZA 4K0KE 1ZBTA 4JI7E 4L5NC 4WPYA 1UHZA 2E1MA 3T1HE 2E5LE 1IBME 4TUGA 4JI0E 2V83A 4DR6E 4F9BB 1WXRA 1T4OA 3JU0A 2V89A 3IWCA 1HNZE 3ADLA 1N34E 4JI2E 1DI2A 2VF1A 4BC9A 2VQFE 2UXCE 3J80C 4GKJE 2NA2A 1O0WA 1X48A 4NXNE 1YYKA 2N3GA 2B7VA 1HR0E 4M2ZA 3VK6A 4BCAA 4P78A 1FKAE 1DQ3A 4JI3E 1GQEA 2N3HA 3AUZA 4DR1E 1STUA 3ADJA 1I94E 4DR2E 4LF9E 1PKPA 2V87A 1IBLE 1X47A 4LU9A 4JI1E 4JYAE 4DR5E 2UU9E 3ZOQB 2H36X 3OMLA 4WYQB 2JWOA 1XNQE 4B3TE 4M30A 5AE3A 4DUYE 2V86A 1XNRE 4YY3E 2EZ6A 2F4VE 2M1SA 5F3WA 4F9CB 2UUCE 4LFAE 2V8QB 2KOUA 2CPNA 2K4VA 3LMLA 5T6JA 4DR7E 2NUEA 2MC6A 4Q28A 2VQEE 5CFFE 4TUIA 2IHR1 5LMUE 2L33A 2NUGA 2L3JA 4DMIA 4J8ZA 1ZBQA 4LF8E 4BBYA 3JTZA 3RMPA 3HXLA 1X49A 4LFCE 3HTXA 2DSYA 1XMOE 1HNWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG E;  1YZ9 A;  2RTX A;  1N33 E;  4B3M E;  2DB2 A;  2YT4 A;  2RS6 A;  3C4B A;  4JV5 E;  4X64 E;  2L2N A;  2LTR A;  4DV2 E;  1XMQ E;  1YYW A;  3T1Y E;  2B7T A;  2UUA E;  2L2M A;  4DKK A;  3LLH A;  4WFT A;  2JY9 A;  1HNX E;  2ZM6 E;  2JVA A;  1YYO A;  4DV5 E;  2DMY A;  1RC7 A;  4JI6 E;  4B3R E;  3P1X A;  3VYY A;  2MDR A;  2RSM A;  4DV1 E;  4X62 E;  2LBS B;  2LTS A;  4X65 E;  2UUB E;  2NUF A;  1UIL A;  1N36 E;  1EKZ A;  1J26 A;  2KHX A;  4LF7 E;  2L3C A;  1J5E E;  3ADI A;  1IBK E;  2HHH E;  1T4N A;  4LF4 E;  1QU6 A;  1WHN A;  4KHP E;  4DV7 E;  3J7Y p;  2UXD E;  4LF5 E;  3ADG A;  4OOG C;  4DR3 E;  2LRS A;  5IWA E;  5BR8 E;  4YHH E;  4JI8 E;  4JI4 E;  4DV4 E;  4DR4 E;  4LFB E;  4OX9 E;  4JI5 E;  1WHQ A;  2B3T B;  2LUP B;  4NXM E;  4DV0 E;  4B3S E;  5LMN E;  3C4T A;  2UXB E;  2LUQ A;  4LF6 E;  3OTO E;  2LJH A;  4DV3 E;  1T4L B;  1N32 E;  2RS7 A;  4X66 E;  4AQY E;  1RQ0 A;  4DUZ E;  4X8W A;  2L2K B;  4DV6 E;  3VYX A;  2DIX A;  4K0K E;  1ZBT A;  4JI7 E;  2E5L E;  4JI0 E;  1UHZ A;  4GKK E;  3T1H E;  1IBM E;  4DR6 E;  1T4O A;  1HNZ E;  3ADL A;  1N34 E;  4JI2 E;  1DI2 A;  2VQF E;  2UXC E;  4GKJ E;  2NA2 A;  1O0W A;  1X48 A;  4NXN E;  1YYK A;  2N3G A;  2B7V A;  1HR0 E;  4M2Z A;  1FKA E;  4JI3 E;  1GQE A;  2N3H A;  4DR1 E;  1STU A;  3ADJ A;  1I94 E;  4DR2 E;  4LF9 E;  1PKP A;  1IBL E;  4JI1 E;  1X47 A;  4JYA E;  4DR5 E;  2UU9 E;  4WYQ B;  1XNQ E;  4B3T E;  4M30 A;  4DUY E;  1XNR E;  2EZ6 A;  4YY3 E;  2F4V E;  2UUC E;  4LFA E;  2CPN A;  4DR7 E;  2NUE A;  2VQE E;  5CFF E;  5LMU E;  2IHR 1;  2L33 A;  2NUG A;  2L3J A;  4LF8 E;  1X49 A;  4LFC E;  3HTX A;  1XMO E;  1HNW E; 
#chains in the Genus database with same CATH topology
 1FJG E;  2EPP A;  4B3M E;  2WZO A;  4O43 A;  4F6N A;  2YT4 A;  5KL3 A;  2LV2 A;  4X64 E;  3AV0 A;  4DV2 E;  1X6H A;  5AC5 A;  3T1Y E;  2EMW A;  2UUA E;  3L00 A;  2EM8 A;  2L2M A;  3LLH A;  4O5G A;  1YUJ A;  1IQS A;  2DMY A;  2YRK A;  4JI6 E;  1QNT A;  3C6M A;  3JAM C;  4B3R E;  3M99 B;  2HGH A;  1T38 A;  5A6A A;  1EKZ A;  4R2A A;  4R2Q A;  1A1G A;  4LF7 E;  5DNY A;  2ENA A;  2MC5 A;  5A6K A;  2HHH E;  2GHF A;  5KL5 A;  1T4N A;  2EOX A;  4KHP E;  2UXD E;  3DJW A;  2FTX B;  1EH8 A;  3QG5 C;  4DR3 E;  5IWA E;  2EQ0 A;  2GPI A;  4JI4 E;  4LFB E;  4OX9 E;  1PJQ A;  2E72 A;  4WXC A;  2KON A;  1DGC A;  4NXM E;  3C4T A;  2ADR A;  2LUQ A;  1X6E A;  2EQ1 A;  1L4S A;  1T39 A;  2MKN A;  4AQY E;  1F2I G;  2EPO A;  4DUZ E;  2B9D A;  4X8W A;  5AE1 A;  3VYX A;  4L8N A;  1G2D C;  1A1J A;  1ZBT A;  2E5L E;  3T1H E;  1JK1 A;  2EN7 A;  2RQL A;  1A1H A;  2EM3 A;  1NEI A;  2UXC E;  3J80 C;  5KL4 A;  2I9I A;  4NXN E;  5IV8 B;  5IXM B;  5AC4 A;  4BHB A;  1I94 E;  2EMK A;  4LF9 E;  4WSG A;  1PKP A;  2LT7 A;  1IBL E;  1A1L A;  3UK3 C;  2UU9 E;  3ZOQ B;  2EZ6 A;  2V86 A;  2EL5 A;  5F3W A;  2EPC A;  2UUC E;  2EPK X;  4LFA E;  2EOZ A;  3THN A;  4TUI A;  2L33 A;  4LF8 E;  2EN8 A;  3RMP A;  2EOE A;  2EPR A;  2EM2 A;  4LFC E;  2K7I A;  1YZ9 A;  2RTX A;  1GZ6 A;  1ZR9 A;  2WBS A;  3KZZ A;  1UN6 B;  4GEQ B;  1NCS A;  2WCC 3;  2L6M A;  4JV5 E;  1BBO A;  3KWR A;  2R76 A;  2EMY A;  2EMH A;  1WJP A;  1XMQ E;  2M7Q A;  2EMA A;  4WFT A;  1X6F A;  1PJT A;  2JY9 A;  3J81 C;  2JVA A;  3F6H A;  1YYO A;  4DV5 E;  3EPJ A;  1RC7 A;  2EOR A;  3F6G A;  3TQM A;  3P1X A;  4F54 A;  2YPN A;  4R2S A;  4IS1 C;  2EE8 A;  4KZS A;  4GZN C;  2YTO A;  2NUF A;  1N36 E;  2EOO A;  3J7A G;  1SR9 A;  2LE2 A;  2M9A A;  4BMJ A;  4WX9 A;  4LF4 E;  3HQ1 A;  1QU6 A;  1WHN A;  2YZT A;  2YU8 A;  2EMF A;  4LF5 E;  3ADG A;  2DRP A;  1EH7 A;  5BR8 E;  1A1F A;  2DMI A;  2EMB A;  2EM6 A;  3EPK A;  2EMZ A;  4HTG A;  1IMU A;  5LL6 R;  4JI5 E;  2YTI A;  2YRH A;  2B3T B;  2LUP B;  2EN3 A;  5LMN E;  2UXB E;  3IWD A;  4LF6 E;  2CT1 A;  2LJH A;  1T4L B;  2JPA A;  5LLQ A;  3MSW A;  5IT9 C;  1RQ0 A;  3C6K A;  4BHC A;  1MGT A;  4BS9 A;  2ODR C;  1WRJ A;  2G7H A;  1ZAA C;  2DIX A;  2LCE A;  4N4R B;  2HC5 A;  4JI0 E;  2JP9 A;  5KL7 A;  2E1M A;  2DGC A;  4GKK E;  1IBM E;  4DR6 E;  4F9B B;  1WXR A;  3JU0 A;  2CTD A;  4RH8 A;  2YWQ A;  2EPN A;  2VF1 A;  2J7J A;  4GKJ E;  2NA2 A;  4M9V C;  2B7V A;  1FKA E;  1DQ3 A;  4JI3 E;  2V87 A;  4JI1 E;  1X47 A;  2EP3 A;  1YPN A;  2EL4 A;  2EPX A;  4DR5 E;  2H36 X;  2YTJ A;  2YTP A;  3MHH C;  2DLQ A;  4DUY E;  2EML A;  4YY3 E;  2M1S A;  4R2D A;  2V8Q B;  1BBG A;  2KOU A;  2CPN A;  2K4V A;  2PRT A;  4RHB B;  5A6B A;  2MC6 A;  4IJD A;  4Q28 A;  2VQE E;  1YSA C;  2EOM A;  4J8Z A;  4DMI A;  1PJS A;  3JTZ A;  2YSP A;  1X3C A;  4R2C A;  1Z1B A;  1XMO E;  2ENH A;  4R8O A;  4WSP A;  1KYQ A;  3H09 A;  2EOH A;  2RS6 A;  2EQ3 A;  4Q35 B;  2ENC A;  3K6Q A;  1P47 A;  1YUI A;  2L2N A;  2LTR A;  3HPZ A;  4BC7 A;  4R2E A;  2JOX A;  2WBU A;  2ELY A;  2L92 A;  2YTN A;  2VE7 C;  4DKK A;  2FGG A;  2YU5 A;  1HNX E;  3VYY A;  2HJJ A;  2RSM A;  2CSH A;  2LBS B;  4X65 E;  1UIL A;  2EM9 A;  2V88 A;  2YRM A;  1AAY A;  3DF6 A;  5KL2 A;  2EOS A;  3BID A;  3IWB A;  1J26 A;  2KHX A;  2EM0 A;  2RSI A;  3ADI A;  1IBK E;  2Q8U A;  5TSE A;  4DV7 E;  2EN4 A;  3J7Y p;  2EN6 A;  2ELZ A;  2EMX A;  5AAS A;  1AH5 A;  4R2R A;  1TN9 A;  2LRS A;  2A25 A;  2L8T A;  2N8X A;  4JI8 E;  1LLM C;  2DLK A;  2FV4 B;  4DR4 E;  4ZYH A;  2R1F A;  2VRD A;  2I13 A;  1WHQ A;  3FIG A;  2EJ4 A;  4DV0 E;  2YTE A;  4B3S E;  2JR1 A;  4DV3 E;  2EPA A;  2EN1 A;  4DV6 E;  2L2K B;  2LJU A;  2YTG A;  5ADZ A;  5A6J A;  4K0K E;  2YTQ A;  4NZV A;  4L5N C;  4WPY A;  4JI7 E;  3BGH A;  3IWC A;  4F6M A;  1N34 E;  4JI2 E;  4BC9 A;  4ZYE A;  3EPH A;  4MLQ A;  2EMI A;  1X48 A;  2EPM X;  1YYK A;  1HR0 E;  4M2Z A;  2EL6 A;  3VK6 A;  4BCA A;  4ZYG A;  4P78 A;  2EM5 A;  2EPU A;  2N3H A;  3AUZ A;  1STU A;  4DR2 E;  2BBG A;  2LVH A;  4JYA E;  4LU9 A;  2EOI A;  3OML A;  4WYQ B;  2MDG A;  1XNQ E;  5AE3 A;  3KZY A;  1XNR E;  2F4V E;  3LML A;  5T6J A;  5KL6 A;  5LMU E;  5CFF E;  1X5W A;  2IHR 1;  2NUG A;  2L3J A;  4BBY A;  4O4K A;  1TF3 A;  3HTX A;  1HNW E;  2YSO A;  1N33 E;  2V85 A;  2DB2 A;  2EOQ A;  2BB8 A;  3C4B A;  5A69 A;  3THO B;  2ODR D;  4I8O A;  2EMC A;  1A1I A;  1YYW A;  3MHS C;  2B7T A;  4X9J A;  1RMD A;  5AE2 A;  2ZM6 E;  2WBT A;  1BB8 A;  2D9H A;  1KJK A;  1ZU1 A;  2MDR A;  2LMZ A;  4DV1 E;  3HPS A;  4X62 E;  2EMG A;  2LTS A;  2UUB E;  1IQO A;  4M0V A;  2L3C A;  3EPL A;  4ZYD A;  1J5E E;  4P7D A;  2EM4 A;  2EOJ A;  4R03 A;  2LO3 A;  5A6B D;  2EWL A;  4OOG C;  4HEI A;  2JOB A;  2YTD A;  4MLV A;  4YHH E;  1TF6 A;  4FK5 C;  1A1K A;  2EN2 A;  4DV4 E;  4LTY A;  2JXP A;  5FLX C;  2F8B A;  2EPL X;  4F9A B;  4NHR A;  3OTO E;  1N32 E;  2RS7 A;  4X66 E;  2JYA A;  5A2Q C;  4KWY A;  1G2F C;  1PDA A;  2M4I A;  4O24 A;  1EH6 A;  1UBD C;  2EPZ A;  3ECR A;  1N3G A;  1UHZ A;  3BF2 A;  4TUG A;  2V83 A;  1B69 A;  1T4O A;  2V89 A;  4F2J C;  1HNZ E;  3ADL A;  2EOF A;  1DI2 A;  2VQF E;  3BBG A;  1O0W A;  2EOY A;  2N3G A;  1SFE A;  2NAB A;  1GQE A;  4DR1 E;  3ADJ A;  1GTK A;  2MKD A;  2DSY A;  2JWO A;  4B3T E;  4M30 A;  3EQ1 A;  4R2P A;  4F9C B;  4DR7 E;  2NUE A;  1MEY C;  3VHT B;  4WXD A;  1YFH A;  2GLI A;  1ZBQ A;  1JK2 A;  3HXL A;  2RPC A;  1X49 A;  2YTF A;  2EM7 A; 
#chains in the Genus database with same CATH homology
 1FJG E;  1YZ9 A;  2RTX A;  1N33 E;  4R8O A;  4WSP A;  1GZ6 A;  4B3M E;  2WZO A;  2V85 A;  3H09 A;  2DB2 A;  2YT4 A;  2RS6 A;  4GEQ B;  3C4B A;  2L6M A;  4JV5 E;  3K6Q A;  3KWR A;  4X64 E;  2ODR D;  3AV0 A;  2L2N A;  2LTR A;  4I8O A;  4DV2 E;  3HPZ A;  4BC7 A;  1XMQ E;  1YYW A;  2JOX A;  3T1Y E;  2B7T A;  2L92 A;  2M7Q A;  2UUA E;  2VE7 C;  2L2M A;  4DKK A;  3LLH A;  2FGG A;  4WFT A;  2JY9 A;  5AE2 A;  1HNX E;  3J81 C;  2ZM6 E;  2JVA A;  3F6H A;  1YYO A;  4DV5 E;  2DMY A;  1RC7 A;  3F6G A;  4JI6 E;  3JAM C;  4B3R E;  4F54 A;  3P1X A;  3VYY A;  2MDR A;  2LMZ A;  2RSM A;  4DV1 E;  3HPS A;  4X62 E;  2LBS B;  2LTS A;  4KZS A;  4X65 E;  2UUB E;  2NUF A;  1UIL A;  1N36 E;  2V88 A;  3J7A G;  3DF6 A;  1SR9 A;  3IWB A;  2LE2 A;  1EKZ A;  4M0V A;  1J26 A;  2KHX A;  4LF7 E;  4BMJ A;  2L3C A;  5DNY A;  1J5E E;  3ADI A;  2MC5 A;  4P7D A;  1IBK E;  2HHH E;  1T4N A;  4R03 A;  3HQ1 A;  4LF4 E;  1QU6 A;  1WHN A;  2YZT A;  4DV7 E;  3DJW A;  3J7Y p;  2FTX B;  4KHP E;  2UXD E;  5AAS A;  3ADG A;  2EWL A;  4LF5 E;  4OOG C;  4DR3 E;  2JOB A;  2LRS A;  5IWA E;  5BR8 E;  2L8T A;  4YHH E;  4JI8 E;  4JI4 E;  2FV4 B;  4DV4 E;  4DR4 E;  4LFB E;  4OX9 E;  4LTY A;  5LL6 R;  1WHQ A;  3FIG A;  4JI5 E;  2B3T B;  2KON A;  5FLX C;  2LUP B;  4NXM E;  2F8B A;  4DV0 E;  4B3S E;  3C4T A;  5LMN E;  2UXB E;  4F9A B;  2JR1 A;  3IWD A;  2LUQ A;  4LF6 E;  3OTO E;  2LJH A;  4DV3 E;  1T4L B;  1N32 E;  2RS7 A;  4X66 E;  3MSW A;  5IT9 C;  5A2Q C;  4AQY E;  4GKK E;  1RQ0 A;  2M4I A;  4DUZ E;  2B9D A;  4X8W A;  5AE1 A;  2L2K B;  4DV6 E;  3VYX A;  4BS9 A;  2ODR C;  2G7H A;  2DIX A;  4L8N A;  5ADZ A;  4K0K E;  1ZBT A;  4JI7 E;  4L5N C;  4WPY A;  1UHZ A;  2E1M A;  3T1H E;  2E5L E;  1IBM E;  4TUG A;  4JI0 E;  2V83 A;  4DR6 E;  4F9B B;  1WXR A;  1T4O A;  3JU0 A;  2V89 A;  3IWC A;  1HNZ E;  3ADL A;  1N34 E;  4JI2 E;  1DI2 A;  2VF1 A;  4BC9 A;  2VQF E;  2UXC E;  3J80 C;  4GKJ E;  2NA2 A;  1O0W A;  1X48 A;  4NXN E;  1YYK A;  2N3G A;  2B7V A;  1HR0 E;  4M2Z A;  3VK6 A;  4BCA A;  4P78 A;  1FKA E;  1DQ3 A;  4JI3 E;  1GQE A;  2N3H A;  3AUZ A;  4DR1 E;  1STU A;  3ADJ A;  1I94 E;  4DR2 E;  4LF9 E;  1PKP A;  2V87 A;  1IBL E;  1X47 A;  4LU9 A;  4JI1 E;  4JYA E;  4DR5 E;  2UU9 E;  3ZOQ B;  2H36 X;  3OML A;  4WYQ B;  2JWO A;  1XNQ E;  4B3T E;  4M30 A;  5AE3 A;  4DUY E;  2V86 A;  1XNR E;  4YY3 E;  2EZ6 A;  2F4V E;  2M1S A;  5F3W A;  4F9C B;  2UUC E;  4LFA E;  2V8Q B;  2KOU A;  2CPN A;  2K4V A;  3LML A;  5T6J A;  4DR7 E;  2NUE A;  2MC6 A;  4Q28 A;  2VQE E;  5CFF E;  4TUI A;  2IHR 1;  5LMU E;  2L33 A;  2NUG A;  2L3J A;  4DMI A;  4J8Z A;  1ZBQ A;  4LF8 E;  4BBY A;  3JTZ A;  3RMP A;  3HXL A;  1X49 A;  4LFC E;  3HTX A;  2DSY A;  1XMO E;  1HNW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...