2LRSA

The second dsrbd domain from a. thaliana dicer-like 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
NDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease Dicer homolog 1
publication title Second Double-Stranded RNA Binding Domain of Dicer-like Ribonuclease 1: Structural and Biochemical Characterization.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 15
structure length 71
sequence length 71
ec nomenclature ec 3.1.26.-:
pdb deposition date 2012-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lrsA00
2N3HA 3HTXA 4JI8E 4NXNE 2MDRA 1WHQA 4AQYE 1YYWA 1X49A 2LBSB 1UILA 3ADIA 1RC7A 1T4NA 1T4LB 4X66E 4KHPE 3P1XA 4DKKA 2EZ6A 1RQ0A 4GKKE 4K0KE 2B7VA 2LJHA 2ZM6E 2UXBE 4LFAE 4LF7E 2KHXA 2YT4A 1T4OA 3T1YE 1ZBTA 4DV4E 4NXME 2LUPB 4LFCE 4DR6E 5LMUE 1IBLE 2UXCE 5IWAE 2UUAE 4X8WA 2VQFE 1DI2A 1HNWE 3ADJA 5LMNE 1FKAE 4WYQB 1J26A 2B3TB 4DR4E 2UU9E 4B3ME 4JI4E 4DR2E 4B3TE 3T1HE 1QU6A 1I94E 1IBME 2IHR1 1XMOE 4M30A 2JVAA 2LTSA 2DIXA 2B7TA 1N34E 2LUQA 2L33A 4JI5E 1PKPA 3OTOE 1YYOA 4DV3E 1X47A 2JY9A 2RTXA 5BR8E 1FJGE 4LF6E 4DV0E 2L2NA 4JI6E 4DV1E 2UXDE 1N33E 2L2MA 4WFTA 1YZ9A 4DUZE 4JI0E 1YYKA 4GKJE 1XNQE 3VYYA 4DR3E 2NUFA 3J7Yp 4DV2E 3LLHA 1HNXE 2E5LE 4B3SE 4DR1E 1IBKE 4DUYE 1STUA 4LFBE 1HR0E 2VQEE 4LF8E 4B3RE 1N36E 1UHZA 4LF4E 4X64E 2N3GA 3C4BA 4YY3E 1HNZE 2UUBE 4OX9E 1X48A 5CFFE 4OOGC 1WHNA 4X62E 4DR5E 2LTRA 2RS6A 4JI7E 4M2ZA 2RSMA 1J5EE 4DR7E 2LRSA 2CPNA 1XMQE 3VYXA 2RS7A 4JI1E 2HHHE 2L2KB 1XNRE 3ADLA 4LF5E 2DMYA 1GQEA 3C4TA 4JYAE 4DV7E 4JI3E 4JI2E 2NUEA 1N32E 3ADGA 2DB2A 2L3JA 4YHHE 2F4VE 4LF9E 2UUCE 2NUGA 4DV5E 4X65E 4DV6E 2NA2A 1O0WA 1EKZA 4JV5E 2L3CA
chains in the Genus database with same CATH superfamily
3OMLA 2N3HA 2EOIA 3LMLA 1YYWA 2EQ0A 3J80C 1UILA 2EORA 2NABA 1T38A 2E72A 1DGCA 5AE1A 3EPKA 2J7JA 2GHFA 3P1XA 1YSAC 1PJSA 4Q28A 3L00A 2JYAA 2EZ6A 4GKKE 1WXRA 2B7VA 2EOXA 1N3GA 2EM9A 4DR6E 5A6JA 4M9VC 2RPCA 5A6BA 5IWAE 5A6BD 5KL2A 2EE8A 4I8OA 5AC5A 2B3TB 4R2DA 5IT9C 3T1HE 4BBYA 2IHR1 4P7DA 4RHBB 3C6MA 2EMAA 1P47A 2JVAA 5A2QC 1N34E 2DLQA 2YPNA 1IQOA 4L8NA 2EM2A 2EPMX 1IQSA 3THNA 1JK1A 2DMIA 5AE3A 2UXDE 1EH8A 4WFTA 2CTDA 1XNQE 4DR3E 3J7Yp 2JPAA 4WPYA 3LLHA 1IBKE 1EH6A 3IWCA 2V8QB 4WX9A 2I9IA 1A1JA 2GPIA 2N3GA 4OX9E 4OOGC 1WHNA 3AV0A 2RS6A 3VHTB 1LLMC 2EMYA 4M2ZA 2RSMA 1G2DC 2EL5A 2EMHA 4P78A 3VYXA 2V86A 4LTYA 2RS7A 2EMLA 4JI1E 2EP3A 3HQ1A 1A1HA 2EWLA 3ADLA 3HXLA 2MKDA 2ENAA 1ZU1A 4BC9A 5FLXC 4JYAE 5KL7A 1N32E 1GTKA 2V83A 2F4VE 3THOB 4YHHE 3EPLA 4F9CB 4LF9E 2NUGA 2EOZA 2EPPA 2MC6A 5A6KA 2M7QA 1SR9A 2FTXB 1A1GA 2EM4A 1EKZA 2RQLA 4O43A 2EL4A 1WHQA 3F6HA 4R2AA 4WXCA 1QNTA 1X49A 2DRPA 2R1FA 3ADIA 1RC7A 2EMZA 2EPRA 4X66E 3JAMC 4KHPE 1RMDA 3UK3C 3MHSC 3VK6A 2GLIA 1RQ0A 2EN8A 5DNYA 4TUIA 4R2RA 1T39A 4NXME 2EMWA 4LFCE 2K4VA 2VE7C 2YTJA 4X8WA 2EMIA 1NEIA 2JWOA 2EN6A 3ADJA 2PRTA 4B3ME 4GEQB 4DR2E 1TF3A 1SFEA 4JI4E 2YTIA 1I94E 1IBME 4R2QA 3AUZA 4M30A 2EOQA 2L33A 3OTOE 2RTXA 1IMUA 4WSGA 2LMZA 4LF6E 2EOHA 2YTNA 5LLQA 2YTEA 4X9JA 4DV0E 5KL4A 5IXMB 4R2PA 3EPJA 4IJDA 4DV1E 1N33E 5AE2A 2MKNA 3DF6A 4F9BB 4DUZE 4IS1C 4HEIA 2YTQA 2G7HA 3VYYA 2EPAA 1X6FA 2EJ4A 2WBSA 2EPOA 2EOOA 2L92A 2EN2A 2LVHA 2LT7A 1UBDC 4LF8E 3F6GA 1N36E 1UHZA 3KZYA 1MEYC 4X64E 4LF4E 4BC7A 2YTDA 2JOXA 2UUBE 1X48A 2EOEA 2LTRA 4F6NA 1A1FA 2ADRA 1PJQA 1XMQE 4L5NC 2D9HA 2LV2A 2EM7A 4KZSA 2HHHE 3J81C 1KYQA 3FIGA 2V89A 4LF5E 2B9DA 2VF1A 4DV7E 4JI3E 4F6MA 1X3CA 5KL5A 2BB8A 3JTZA 2YZTA 2YRHA 2JXPA 5AASA 4KWYA 2EPXA 3BBGA 2YTFA 4RH8A 1ZAAC 1WRJA 2EM6A 1TN9A 2UUCE 2EN4A 4X65E 4DV6E 5LL6R 2M9AA 4F54A 4B3RE 2EQ1A 4JV5E 1BB8A 1AAYA 2YTPA 4JI8E 2YTOA 3DJWA 4NXNE 4J8ZA 2EPCA 1YPNA 2YSOA 4ZYGA 1PDAA 3M99B 2LBSB 1T4LB 2WBUA 3EQ1A 5ADZA 2V85A 4DKKA 2EOMA 4K0KE 2LJHA 1KJKA 2YRMA 1A1IA 2UXBE 2EPZA 3K6QA 4LF7E 2Q8UA 1T4OA 4DV4E 2LO3A 5LMUE 2EOFA 2UXCE 2ODRC 4Q35B 1DI2A 2HGHA 5LMNE 4NHRA 1FKAE 4WYQB 1J26A 2EOJA 4DR4E 2ENHA 3QG5C 2EN3A 2M1SA 1QU6A 2YSPA 4R8OA 1XMOE 2WCC3 2DIXA 2B7TA 2JOBA 1B69A 4JI5E 1PKPA 1YYOA 5IV8B 1FJGE 2ELZA 5AC4A 4LU9A 2KOUA 4JI6E 2EMCA 2LCEA 4ZYEA 1TF6A 1Z1BA 1YZ9A 4MLVA 4JI0E 1YYKA 3MHHC 2L6MA 2NUFA 3RMPA 2V87A 1HNXE 2E5LE 4F9AB 4M0VA 1STUA 1HR0E 2VQEE 4F2JC 4R2CA 4ZYHA 3TQMA 4NZVA 2L8TA 4X62E 4DR5E 4BHBA 4R2EA 4DR7E 3BF2A 5T6JA 4O24A 3BGHA 1ZBQA 5A6AA 4WSPA 2EN7A 1A1KA 4N4RB 1XNRE 1A1LA 2DMYA 1GQEA 2ODRD 2MDGA 3C4TA 2A25A 2FV4B 2M4IA 4ZYDA 2DLKA 5KL6A 1WJPA 4R2SA 2E1MA 1BBOA 2CSHA 1GZ6A 2EQ3A 2CT1A 4R03A 5F3WA 4BS9A 1JK2A 3C6KA 1O0WA 3ECRA 2LJUA 2WBTA 2BBGA 4BCAA 3HTXA 2MDRA 4O4KA 4WXDA 4AQYE 2EMXA 2EM5A 1T4NA 4HTGA 1MGTA 5KL3A 2K7IA 4O5GA 4MLQA 3HPSA 3KZZA 2ZM6E 2EMKA 4LFAE 1YUJA 2KHXA 2YT4A 3T1YE 2EM8A 1X6HA 1ZBTA 2KONA 1UN6B 2LUPB 2ENCA 1IBLE 2UUAE 2VQFE 1HNWE 4DMIA 2UU9E 2EOSA 2H36X 2EPNA 3HPZA 4B3TE 2VRDA 1AH5A 2EOYA 2YWQA 3KWRA 2YRKA 2HJJA 2DSYA 2LTSA 1EH7A 2LUQA 3ZOQB 5A69A 4DV3E 1X47A 2JY9A 2EPUA 2WZOA 5BR8E 3H09A 3IWDA 2ELYA 2L2NA 4BHCA 2EM0A 2RSIA 2L2MA 4GKJE 2MC5A 2N8XA 2EM3A 1ZR9A 4DV2E 2YU5A 4B3SE 3JU0A 4DR1E 4DUYE 1F2IG 4LFBE 2FGGA 2EMFA 3C4BA 4YY3E 2V88A 3BIDA 1HNZE 5CFFE 2F8BA 1X5WA 1G2FC 2I13A 4JI7E 2DGCA 1J5EE 2YU8A 2LRSA 1NCSA 2CPNA 3J7AG 2EPLX 2EMGA 4TUGA 3EPHA 4FK5C 2L2KB 2EN1A 1DQ3A 1PJTA 1YUIA 2R76A 3IWBA 1BBGA 2EPKX 2JR1A 4GZNC 4BMJA 2JP9A 2EL6A 5TSEA 2EMBA 4JI2E 2NUEA 1YFHA 3ADGA 3MSWA 2DB2A 2YTGA 2L3JA 4DV5E 1L4SA 1X6EA 2NA2A 2HC5A 2L3CA 2LE2A
chains in the Genus database with same CATH topology
3OMLA 2N3HA 4BCAA 3HTXA 4JI8E 3DJWA 4NXNE 2MDRA 1WHQA 3F6HA 3LMLA 4J8ZA 4AQYE 1YYWA 1X49A 3J80C 2LBSB 1UILA 3ADIA 1RC7A 1T4NA 1T4LB 4X66E 5AE1A 3JAMC 4KHPE 3P1XA 5ADZA 3VK6A 2V85A 4Q28A 4DKKA 4DR6E 2EZ6A 1RQ0A 3HPSA 4GKKE 5DNYA 4TUIA 1WXRA 2B7VA 2LJHA 4K0KE 2ZM6E 2UXBE 3K6QA 4LF7E 4LFAE 2KHXA 2YT4A 1T4OA 3T1YE 1ZBTA 2KONA 4DV4E 2LUPB 4LFCE 2K4VA 2VE7C 4NXME 5LMUE 1IBLE 2UXCE 5IWAE 2UUAE 4X8WA 2ODRC 2VQFE 1DI2A 2JWOA 1HNWE 3ADJA 4I8OA 4DMIA 5LMNE 1FKAE 4WYQB 1J26A 2B3TB 4DR4E 2UU9E 2H36X 4B3ME 4GEQB 4DR2E 4JI4E 3HPZA 5IT9C 3T1HE 4B3TE 2M1SA 4BBYA 1QU6A 1I94E 1IBME 2IHR1 4P7DA 4R8OA 3AUZA 1XMOE 4M30A 3KWRA 2JVAA 2DSYA 2LTSA 5A2QC 2DIXA 2B7TA 2JOBA 1N34E 2LUQA 2L33A 4JI5E 3ZOQB 1PKPA 3OTOE 1YYOA 4DV3E 1X47A 2JY9A 2RTXA 2WZOA 5BR8E 4L8NA 3H09A 1FJGE 2LMZA 3IWDA 4LF6E 4DV0E 2L2NA 4LU9A 2KOUA 5AE3A 4JI6E 4DV1E 2UXDE 1N33E 5AE2A 3DF6A 2L2MA 4WFTA 4F9BB 4DUZE 4JI0E 1YYKA 1YZ9A 4GKJE 2MC5A 2G7HA 1XNQE 2L6MA 3VYYA 4DR3E 2NUFA 3J7Yp 3RMPA 4DV2E 2V87A 4WPYA 3LLHA 1HNXE 2E5LE 4B3SE 3JU0A 4DR1E 1IBKE 4F9AB 4M0VA 4DUYE 1STUA 3IWCA 4LFBE 2V8QB 2L92A 2VQEE 2FGGA 1HR0E 4LF8E 4B3RE 3F6GA 1N36E 1UHZA 4LF4E 4X64E 4BC7A 2N3GA 3C4BA 2V88A 4YY3E 2JOXA 1HNZE 2UUBE 4OX9E 1X48A 5CFFE 2F8BA 2L8TA 4OOGC 1WHNA 4X62E 4DR5E 2LTRA 3AV0A 2RS6A 4JI7E 4M2ZA 2RSMA 1J5EE 4DR7E 2LRSA 4P78A 2CPNA 5T6JA 1XMQE 4L5NC 3J7AG 3VYXA 2V86A 4LTYA 2RS7A 4TUGA 1ZBQA 4WSPA 4KZSA 2HHHE 4JI1E 3HQ1A 3J81C 2L2KB 2EWLA 3FIGA 1DQ3A 1XNRE 2V89A 3ADLA 3HXLA 4LF5E 3IWBA 2DMYA 2JR1A 1GQEA 2ODRD 4BMJA 2B9DA 2VF1A 2FV4B 3C4TA 4BC9A 2M4IA 5FLXC 4DV7E 4JYAE 4JI3E 4JI2E 2E1MA 1N32E 3JTZA 2YZTA 3ADGA 5AASA 2NUEA 3MSWA 1GZ6A 2DB2A 2V83A 2L3JA 4YHHE 2F4VE 4F9CB 2UUCE 4LF9E 4R03A 2NUGA 4DV5E 5F3WA 4BS9A 2MC6A 4X65E 4DV6E 5LL6R 1SR9A 2M7QA 2FTXB 2NA2A 1O0WA 4F54A 1EKZA 4JV5E 2L3CA 2LE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3H A;  3HTX A;  4JI8 E;  4NXN E;  2MDR A;  1WHQ A;  4AQY E;  1YYW A;  1X49 A;  2LBS B;  1UIL A;  3ADI A;  1RC7 A;  1T4N A;  1T4L B;  4X66 E;  4KHP E;  3P1X A;  4DKK A;  2EZ6 A;  1RQ0 A;  4GKK E;  4K0K E;  2B7V A;  2LJH A;  2ZM6 E;  2UXB E;  4LFA E;  4LF7 E;  2KHX A;  2YT4 A;  1T4O A;  3T1Y E;  1ZBT A;  4DV4 E;  4NXM E;  2LUP B;  4LFC E;  4DR6 E;  5LMU E;  1IBL E;  2UXC E;  5IWA E;  2UUA E;  4X8W A;  2VQF E;  1DI2 A;  1HNW E;  3ADJ A;  5LMN E;  1FKA E;  4WYQ B;  1J26 A;  2B3T B;  4DR4 E;  2UU9 E;  4B3M E;  4JI4 E;  4DR2 E;  4B3T E;  3T1H E;  1QU6 A;  1I94 E;  1IBM E;  2IHR 1;  1XMO E;  4M30 A;  2JVA A;  2LTS A;  2DIX A;  2B7T A;  1N34 E;  2LUQ A;  2L33 A;  4JI5 E;  1PKP A;  3OTO E;  1YYO A;  4DV3 E;  1X47 A;  2JY9 A;  2RTX A;  5BR8 E;  1FJG E;  4LF6 E;  4DV0 E;  2L2N A;  4JI6 E;  4DV1 E;  2UXD E;  1N33 E;  2L2M A;  4WFT A;  1YZ9 A;  4DUZ E;  4JI0 E;  1YYK A;  4GKJ E;  1XNQ E;  3VYY A;  4DR3 E;  2NUF A;  3J7Y p;  4DV2 E;  3LLH A;  1HNX E;  2E5L E;  4B3S E;  4DR1 E;  1IBK E;  4DUY E;  1STU A;  4LFB E;  1HR0 E;  2VQE E;  4LF8 E;  4B3R E;  1N36 E;  1UHZ A;  4LF4 E;  4X64 E;  2N3G A;  3C4B A;  4YY3 E;  1HNZ E;  2UUB E;  4OX9 E;  1X48 A;  5CFF E;  4OOG C;  1WHN A;  4X62 E;  4DR5 E;  2LTR A;  2RS6 A;  4JI7 E;  4M2Z A;  2RSM A;  1J5E E;  4DR7 E;  2LRS A;  2CPN A;  1XMQ E;  3VYX A;  2RS7 A;  4JI1 E;  2HHH E;  2L2K B;  1XNR E;  3ADL A;  4LF5 E;  2DMY A;  1GQE A;  3C4T A;  4JYA E;  4DV7 E;  4JI3 E;  4JI2 E;  2NUE A;  1N32 E;  3ADG A;  2DB2 A;  2L3J A;  4YHH E;  2F4V E;  4LF9 E;  2UUC E;  2NUG A;  4DV5 E;  4X65 E;  4DV6 E;  2NA2 A;  1O0W A;  1EKZ A;  4JV5 E;  2L3C A; 
#chains in the Genus database with same CATH topology
 3OML A;  2N3H A;  2EOI A;  3LML A;  1YYW A;  2EQ0 A;  3J80 C;  1UIL A;  2EOR A;  2NAB A;  1T38 A;  2E72 A;  1DGC A;  5AE1 A;  3EPK A;  2J7J A;  2GHF A;  3P1X A;  1YSA C;  1PJS A;  4Q28 A;  3L00 A;  2JYA A;  2EZ6 A;  4GKK E;  1WXR A;  2B7V A;  2EOX A;  1N3G A;  2EM9 A;  4DR6 E;  5A6J A;  4M9V C;  2RPC A;  5A6B A;  5IWA E;  5A6B D;  5KL2 A;  2EE8 A;  4I8O A;  5AC5 A;  2B3T B;  4R2D A;  5IT9 C;  3T1H E;  4BBY A;  2IHR 1;  4P7D A;  4RHB B;  3C6M A;  2EMA A;  1P47 A;  2JVA A;  5A2Q C;  1N34 E;  2DLQ A;  2YPN A;  1IQO A;  4L8N A;  2EM2 A;  2EPM X;  1IQS A;  3THN A;  1JK1 A;  2DMI A;  5AE3 A;  2UXD E;  1EH8 A;  4WFT A;  2CTD A;  1XNQ E;  4DR3 E;  3J7Y p;  2JPA A;  4WPY A;  3LLH A;  1IBK E;  1EH6 A;  3IWC A;  2V8Q B;  4WX9 A;  2I9I A;  1A1J A;  2GPI A;  2N3G A;  4OX9 E;  4OOG C;  1WHN A;  3AV0 A;  2RS6 A;  3VHT B;  1LLM C;  2EMY A;  4M2Z A;  2RSM A;  1G2D C;  2EL5 A;  2EMH A;  4P78 A;  3VYX A;  2V86 A;  4LTY A;  2RS7 A;  2EML A;  4JI1 E;  2EP3 A;  3HQ1 A;  1A1H A;  2EWL A;  3ADL A;  3HXL A;  2MKD A;  2ENA A;  1ZU1 A;  4BC9 A;  5FLX C;  4JYA E;  5KL7 A;  1N32 E;  1GTK A;  2V83 A;  2F4V E;  3THO B;  4YHH E;  3EPL A;  4F9C B;  4LF9 E;  2NUG A;  2EOZ A;  2EPP A;  2MC6 A;  5A6K A;  2M7Q A;  1SR9 A;  2FTX B;  1A1G A;  2EM4 A;  1EKZ A;  2RQL A;  4O43 A;  2EL4 A;  1WHQ A;  3F6H A;  4R2A A;  4WXC A;  1QNT A;  1X49 A;  2DRP A;  2R1F A;  3ADI A;  1RC7 A;  2EMZ A;  2EPR A;  4X66 E;  3JAM C;  4KHP E;  1RMD A;  3UK3 C;  3MHS C;  3VK6 A;  2GLI A;  1RQ0 A;  2EN8 A;  5DNY A;  4TUI A;  4R2R A;  1T39 A;  4NXM E;  2EMW A;  4LFC E;  2K4V A;  2VE7 C;  2YTJ A;  4X8W A;  2EMI A;  1NEI A;  2JWO A;  2EN6 A;  3ADJ A;  2PRT A;  4B3M E;  4GEQ B;  4DR2 E;  1TF3 A;  1SFE A;  4JI4 E;  2YTI A;  1I94 E;  1IBM E;  4R2Q A;  3AUZ A;  4M30 A;  2EOQ A;  2L33 A;  3OTO E;  2RTX A;  1IMU A;  4WSG A;  2LMZ A;  4LF6 E;  2EOH A;  2YTN A;  5LLQ A;  2YTE A;  4X9J A;  4DV0 E;  5KL4 A;  5IXM B;  4R2P A;  3EPJ A;  4IJD A;  4DV1 E;  1N33 E;  5AE2 A;  2MKN A;  3DF6 A;  4F9B B;  4DUZ E;  4IS1 C;  4HEI A;  2YTQ A;  2G7H A;  3VYY A;  2EPA A;  1X6F A;  2EJ4 A;  2WBS A;  2EPO A;  2EOO A;  2L92 A;  2EN2 A;  2LVH A;  2LT7 A;  1UBD C;  4LF8 E;  3F6G A;  1N36 E;  1UHZ A;  3KZY A;  1MEY C;  4X64 E;  4LF4 E;  4BC7 A;  2YTD A;  2JOX A;  2UUB E;  1X48 A;  2EOE A;  2LTR A;  4F6N A;  1A1F A;  2ADR A;  1PJQ A;  1XMQ E;  4L5N C;  2D9H A;  2LV2 A;  2EM7 A;  4KZS A;  2HHH E;  3J81 C;  1KYQ A;  3FIG A;  2V89 A;  4LF5 E;  2B9D A;  2VF1 A;  4DV7 E;  4JI3 E;  4F6M A;  1X3C A;  5KL5 A;  2BB8 A;  3JTZ A;  2YZT A;  2YRH A;  2JXP A;  5AAS A;  4KWY A;  2EPX A;  3BBG A;  2YTF A;  4RH8 A;  1ZAA C;  1WRJ A;  2EM6 A;  1TN9 A;  2UUC E;  2EN4 A;  4X65 E;  4DV6 E;  5LL6 R;  2M9A A;  4F54 A;  4B3R E;  2EQ1 A;  4JV5 E;  1BB8 A;  1AAY A;  2YTP A;  4JI8 E;  2YTO A;  3DJW A;  4NXN E;  4J8Z A;  2EPC A;  1YPN A;  2YSO A;  4ZYG A;  1PDA A;  3M99 B;  2LBS B;  1T4L B;  2WBU A;  3EQ1 A;  5ADZ A;  2V85 A;  4DKK A;  2EOM A;  4K0K E;  2LJH A;  1KJK A;  2YRM A;  1A1I A;  2UXB E;  2EPZ A;  3K6Q A;  4LF7 E;  2Q8U A;  1T4O A;  4DV4 E;  2LO3 A;  5LMU E;  2EOF A;  2UXC E;  2ODR C;  4Q35 B;  1DI2 A;  2HGH A;  5LMN E;  4NHR A;  1FKA E;  4WYQ B;  1J26 A;  2EOJ A;  4DR4 E;  2ENH A;  3QG5 C;  2EN3 A;  2M1S A;  1QU6 A;  2YSP A;  4R8O A;  1XMO E;  2WCC 3;  2DIX A;  2B7T A;  2JOB A;  1B69 A;  4JI5 E;  1PKP A;  1YYO A;  5IV8 B;  1FJG E;  2ELZ A;  5AC4 A;  4LU9 A;  2KOU A;  4JI6 E;  2EMC A;  2LCE A;  4ZYE A;  1TF6 A;  1Z1B A;  1YZ9 A;  4MLV A;  4JI0 E;  1YYK A;  3MHH C;  2L6M A;  2NUF A;  3RMP A;  2V87 A;  1HNX E;  2E5L E;  4F9A B;  4M0V A;  1STU A;  1HR0 E;  2VQE E;  4F2J C;  4R2C A;  4ZYH A;  3TQM A;  4NZV A;  2L8T A;  4X62 E;  4DR5 E;  4BHB A;  4R2E A;  4DR7 E;  3BF2 A;  5T6J A;  4O24 A;  3BGH A;  1ZBQ A;  5A6A A;  4WSP A;  2EN7 A;  1A1K A;  4N4R B;  1XNR E;  1A1L A;  2DMY A;  1GQE A;  2ODR D;  2MDG A;  3C4T A;  2A25 A;  2FV4 B;  2M4I A;  4ZYD A;  2DLK A;  5KL6 A;  1WJP A;  4R2S A;  2E1M A;  1BBO A;  2CSH A;  1GZ6 A;  2EQ3 A;  2CT1 A;  4R03 A;  5F3W A;  4BS9 A;  1JK2 A;  3C6K A;  1O0W A;  3ECR A;  2LJU A;  2WBT A;  2BBG A;  4BCA A;  3HTX A;  2MDR A;  4O4K A;  4WXD A;  4AQY E;  2EMX A;  2EM5 A;  1T4N A;  4HTG A;  1MGT A;  5KL3 A;  2K7I A;  4O5G A;  4MLQ A;  3HPS A;  3KZZ A;  2ZM6 E;  2EMK A;  4LFA E;  1YUJ A;  2KHX A;  2YT4 A;  3T1Y E;  2EM8 A;  1X6H A;  1ZBT A;  2KON A;  1UN6 B;  2LUP B;  2ENC A;  1IBL E;  2UUA E;  2VQF E;  1HNW E;  4DMI A;  2UU9 E;  2EOS A;  2H36 X;  2EPN A;  3HPZ A;  4B3T E;  2VRD A;  1AH5 A;  2EOY A;  2YWQ A;  3KWR A;  2YRK A;  2HJJ A;  2DSY A;  2LTS A;  1EH7 A;  2LUQ A;  3ZOQ B;  5A69 A;  4DV3 E;  1X47 A;  2JY9 A;  2EPU A;  2WZO A;  5BR8 E;  3H09 A;  3IWD A;  2ELY A;  2L2N A;  4BHC A;  2EM0 A;  2RSI A;  2L2M A;  4GKJ E;  2MC5 A;  2N8X A;  2EM3 A;  1ZR9 A;  4DV2 E;  2YU5 A;  4B3S E;  3JU0 A;  4DR1 E;  4DUY E;  1F2I G;  4LFB E;  2FGG A;  2EMF A;  3C4B A;  4YY3 E;  2V88 A;  3BID A;  1HNZ E;  5CFF E;  2F8B A;  1X5W A;  1G2F C;  2I13 A;  4JI7 E;  2DGC A;  1J5E E;  2YU8 A;  2LRS A;  1NCS A;  2CPN A;  3J7A G;  2EPL X;  2EMG A;  4TUG A;  3EPH A;  4FK5 C;  2L2K B;  2EN1 A;  1DQ3 A;  1PJT A;  1YUI A;  2R76 A;  3IWB A;  1BBG A;  2EPK X;  2JR1 A;  4GZN C;  4BMJ A;  2JP9 A;  2EL6 A;  5TSE A;  2EMB A;  4JI2 E;  2NUE A;  1YFH A;  3ADG A;  3MSW A;  2DB2 A;  2YTG A;  2L3J A;  4DV5 E;  1L4S A;  1X6E A;  2NA2 A;  2HC5 A;  2L3C A;  2LE2 A; 
#chains in the Genus database with same CATH homology
 3OML A;  2N3H A;  4BCA A;  3HTX A;  4JI8 E;  3DJW A;  4NXN E;  2MDR A;  1WHQ A;  3F6H A;  3LML A;  4J8Z A;  4AQY E;  1YYW A;  1X49 A;  3J80 C;  2LBS B;  1UIL A;  3ADI A;  1RC7 A;  1T4N A;  1T4L B;  4X66 E;  5AE1 A;  3JAM C;  4KHP E;  3P1X A;  5ADZ A;  3VK6 A;  2V85 A;  4Q28 A;  4DKK A;  4DR6 E;  2EZ6 A;  1RQ0 A;  3HPS A;  4GKK E;  5DNY A;  4TUI A;  1WXR A;  2B7V A;  2LJH A;  4K0K E;  2ZM6 E;  2UXB E;  3K6Q A;  4LF7 E;  4LFA E;  2KHX A;  2YT4 A;  1T4O A;  3T1Y E;  1ZBT A;  2KON A;  4DV4 E;  2LUP B;  4LFC E;  2K4V A;  2VE7 C;  4NXM E;  5LMU E;  1IBL E;  2UXC E;  5IWA E;  2UUA E;  4X8W A;  2ODR C;  2VQF E;  1DI2 A;  2JWO A;  1HNW E;  3ADJ A;  4I8O A;  4DMI A;  5LMN E;  1FKA E;  4WYQ B;  1J26 A;  2B3T B;  4DR4 E;  2UU9 E;  2H36 X;  4B3M E;  4GEQ B;  4DR2 E;  4JI4 E;  3HPZ A;  5IT9 C;  3T1H E;  4B3T E;  2M1S A;  4BBY A;  1QU6 A;  1I94 E;  1IBM E;  2IHR 1;  4P7D A;  4R8O A;  3AUZ A;  1XMO E;  4M30 A;  3KWR A;  2JVA A;  2DSY A;  2LTS A;  5A2Q C;  2DIX A;  2B7T A;  2JOB A;  1N34 E;  2LUQ A;  2L33 A;  4JI5 E;  3ZOQ B;  1PKP A;  3OTO E;  1YYO A;  4DV3 E;  1X47 A;  2JY9 A;  2RTX A;  2WZO A;  5BR8 E;  4L8N A;  3H09 A;  1FJG E;  2LMZ A;  3IWD A;  4LF6 E;  4DV0 E;  2L2N A;  4LU9 A;  2KOU A;  5AE3 A;  4JI6 E;  4DV1 E;  2UXD E;  1N33 E;  5AE2 A;  3DF6 A;  2L2M A;  4WFT A;  4F9B B;  4DUZ E;  4JI0 E;  1YYK A;  1YZ9 A;  4GKJ E;  2MC5 A;  2G7H A;  1XNQ E;  2L6M A;  3VYY A;  4DR3 E;  2NUF A;  3J7Y p;  3RMP A;  4DV2 E;  2V87 A;  4WPY A;  3LLH A;  1HNX E;  2E5L E;  4B3S E;  3JU0 A;  4DR1 E;  1IBK E;  4F9A B;  4M0V A;  4DUY E;  1STU A;  3IWC A;  4LFB E;  2V8Q B;  2L92 A;  2VQE E;  2FGG A;  1HR0 E;  4LF8 E;  4B3R E;  3F6G A;  1N36 E;  1UHZ A;  4LF4 E;  4X64 E;  4BC7 A;  2N3G A;  3C4B A;  2V88 A;  4YY3 E;  2JOX A;  1HNZ E;  2UUB E;  4OX9 E;  1X48 A;  5CFF E;  2F8B A;  2L8T A;  4OOG C;  1WHN A;  4X62 E;  4DR5 E;  2LTR A;  3AV0 A;  2RS6 A;  4JI7 E;  4M2Z A;  2RSM A;  1J5E E;  4DR7 E;  2LRS A;  4P78 A;  2CPN A;  5T6J A;  1XMQ E;  4L5N C;  3J7A G;  3VYX A;  2V86 A;  4LTY A;  2RS7 A;  4TUG A;  1ZBQ A;  4WSP A;  4KZS A;  2HHH E;  4JI1 E;  3HQ1 A;  3J81 C;  2L2K B;  2EWL A;  3FIG A;  1DQ3 A;  1XNR E;  2V89 A;  3ADL A;  3HXL A;  4LF5 E;  3IWB A;  2DMY A;  2JR1 A;  1GQE A;  2ODR D;  4BMJ A;  2B9D A;  2VF1 A;  2FV4 B;  3C4T A;  4BC9 A;  2M4I A;  5FLX C;  4DV7 E;  4JYA E;  4JI3 E;  4JI2 E;  2E1M A;  1N32 E;  3JTZ A;  2YZT A;  3ADG A;  5AAS A;  2NUE A;  3MSW A;  1GZ6 A;  2DB2 A;  2V83 A;  2L3J A;  4YHH E;  2F4V E;  4F9C B;  2UUC E;  4LF9 E;  4R03 A;  2NUG A;  4DV5 E;  5F3W A;  4BS9 A;  2MC6 A;  4X65 E;  4DV6 E;  5LL6 R;  1SR9 A;  2M7Q A;  2FTX B;  2NA2 A;  1O0W A;  4F54 A;  1EKZ A;  4JV5 E;  2L3C A;  2LE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...