2LRSA

The second dsrbd domain from a. thaliana dicer-like 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
NDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Second Double-Stranded RNA Binding Domain of Dicer-like Ribonuclease 1: Structural and Biochemical Characterization.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Endoribonuclease Dicer homolog 1
total genus 15
structure length 71
sequence length 71
ec nomenclature ec 3.1.26.-:
pdb deposition date 2012-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lrsA00
1PKPA 3LLHA 2MDRA 2HHHE 1WHQA 1YZ9A 2UXDE 4GKJE 4JI5E 4DV3E 3T1HE 1HNXE 3P1XA 4DR3E 1FJGE 2L3CA 1YYOA 3ADIA 2L33A 3C4TA 1UILA 4JI2E 2KHXA 1WHNA 1XMQE 2ZM6E 1IBKE 4OX9E 2E5LE 1XNQE 3J7Yp 4B3RE 4DUYE 1DI2A 1FKAE 2DB2A 4LF6E 1RC7A 5IWAE 4YHHE 1IBLE 4X62E 5BR8E 4LF4E 1X49A 2NUFA 1EKZA 3VYXA 3OTOE 2B7VA 4JYAE 4KHPE 4LFCE 4WYQB 4JI0E 4DKKA 2UXBE 4M2ZA 2N3HA 4WFTA 2B7TA 4DR6E 2LTRA 1T4LB 2NUEA 2EZ6A 3ADGA 1J5EE 1X48A 4DV1E 1X47A 4AQYE 1XNRE 4JI1E 2L2MA 2UU9E 4X66E 1N33E 2L2KB 4DR4E 4NXME 1QU6A 2RTXA 1GQEA 2DIXA 1T4NA 4DR1E 4DV5E 1YYKA 4JI6E 1HNWE 4LFAE 1HNZE 4X65E 5LMNE 4K0KE 2L2NA 2LBSB 4JI3E 2VQFE 5LMUE 1N32E 3C4BA 5CFFE 2LJHA 2L3JA 4M30A 4GKKE 4B3ME 2LUQA 4X64E 1I94E 1J26A 2UUAE 3ADLA 4B3TE 2RSMA 1ZBTA 2RS7A 2VQEE 2LUPB 4DUZE 2UUCE 2UUBE 4LFBE 2LRSA 3VYYA 4DV4E 2RS6A 2N3GA 3ADJA 2DMYA 4DV2E 3T1YE 1T4OA 4LF5E 4DR2E 1XMOE 1N36E 4NXNE 4OOGC 2YT4A 4YY3E 2NUGA 4B3SE 4DR5E 2IHR1 4LF8E 2JVAA 2NA2A 1RQ0A 1O0WA 2UXCE 2F4VE 4X8WA 2B3TB 1N34E 4JI4E 1YYWA 4JV5E 3HTXA 4DR7E 2JY9A 4DV0E 2CPNA 1STUA 1IBME 2LTSA 4JI8E 4LF9E 1UHZA 4DV7E 1HR0E 4JI7E 4DV6E 4LF7E
chains in the Genus database with same CATH superfamily
2E1MA 2HHHE 1YZ9A 3J7AG 2UXDE 3IWDA 2VE7C 4JI5E 3BIDA 3T1HE 4O5GA 2EPNA 4DR3E 1PJQA 2EMZA 3J80C 2L3CA 1YYOA 3ADIA 3KWRA 1SFEA 2L33A 2YZTA 2YRMA 3ZOQB 3JU0A 1JK1A 2ZM6E 5DNYA 4OX9E 1XNQE 4B3RE 2V87A 1IQOA 1KYQA 2FGGA 2EOZA 4P78A 1TF3A 4YHHE 5A6JA 4R2EA 2NUFA 1EKZA 2EM8A 2EM9A 2ELYA 4WYQB 5LL6R 4MLVA 4TUIA 2UXBE 2HJJA 2N3HA 2EOSA 2DRPA 4DMIA 4O4KA 2EN6A 1A1LA 5AC4A 4AQYE 4F9AB 2EPLX 2YTEA 4DR4E 3J81C 1QU6A 2CTDA 2RTXA 2EWLA 1A1JA 2JPAA 1DQ3A 4BBYA 5TSEA 4JI6E 1HNWE 4LFAE 2VQFE 2YTIA 1X6HA 5AASA 3M99B 3F6GA 2EPAA 3MHHC 1YPNA 2GHFA 2JP9A 2EMWA 2I9IA 1NCSA 2RSMA 2EM3A 2VRDA 4O24A 5A6KA 2UUCE 2EJ4A 2LRSA 3VYYA 4LFBE 2L8TA 2RS6A 4J8ZA 1A1IA 2WBUA 2V85A 1PJSA 4WSGA 2YTJA 1T4OA 2YTGA 4BHCA 2JYAA 4I8OA 4R2QA 2EOEA 4WX9A 2WCC3 5KL2A 2EORA 2IHR1 2NA2A 1RQ0A 1O0WA 2F4VE 4LTYA 2EM6A 2EPCA 5A6AA 4R2RA 4DR7E 1WRJA 5FLXC 4F9CB 2ODRD 4O43A 2KONA 3HQ1A 2I13A 3LMLA 2EM4A 2EOQA 4BMJA 2LJUA 1IBME 1STUA 2YTDA 1ZU1A 1UHZA 4DV7E 2BB8A 1WHQA 2EMXA 2J7JA 3THOB 4R2DA 2EPOA 2EPMX 3VK6A 2ADRA 1AH5A 3C4TA 1XMQE 3VHTB 1X3CA 2DB2A 2EOMA 2V89A 2RSIA 1RC7A 2K4VA 5IWAE 1BBGA 5A69A 4X9JA 4X62E 1DGCA 1IMUA 4JYAE 2B9DA 4R2CA 4M2ZA 4WFTA 1MGTA 2B7TA 3MSWA 4DR6E 1X5WA 1T4LB 2NUEA 2EZ6A 2EQ3A 4NHRA 1J5EE 1XNRE 3IWBA 2UU9E 2WZOA 1N33E 3TQMA 3ECRA 4RH8A 2ODRC 2EOOA 1HNZE 5AE1A 4X65E 5LMNE 2L2NA 2LBSB 3AUZA 2EOFA 5LMUE 1N32E 4L8NA 2EPRA 1PDAA 4MLQA 2L3JA 5IT9C 4WSPA 4X64E 2BBGA 1I94E 4R03A 2EMLA 2EN4A 3C6MA 2EMAA 3OMLA 5AE2A 2UUAE 3BF2A 4B3TE 1UBDC 2VQEE 1NEIA 2EMYA 4R2AA 2GLIA 1TF6A 2EN8A 2DMYA 1YSAC 4NXNE 4OOGC 2L92A 3EPHA 1MEYC 2YTOA 2R1FA 4ZYDA 4TUGA 2YU5A 2MC5A 4GZNC 2UXCE 3AV0A 5KL7A 1X6FA 4BS9A 2G7HA 2NABA 3H09A 3HTXA 4ZYGA 5AC5A 2MKDA 4LU9A 2WBSA 2EE8A 1ZR9A 1L4SA 2CPNA 4LF9E 1HR0E 2FTXB 1F2IG 2LMZA 4LF7E 1PKPA 2L6MA 2MDRA 3LLHA 2EL4A 2YSOA 4M9VC 4GKJE 1BB8A 4BCAA 1TN9A 1T39A 2PRTA 1HNXE 2M1SA 3P1XA 5IXMB 5A2QC 4F6NA 2HGHA 2LVHA 2EM7A 1UILA 3F6HA 4JI2E 1WHNA 3HPZA 4BHBA 1WXRA 2EPZA 4NZVA 1T38A 4WXCA 3J7Yp 1IBKE 4DUYE 1FKAE 1Z1BA 4LF6E 4ZYEA 2DLKA 2ENHA 1BBOA 2YTQA 2JOBA 1SR9A 2EOHA 3RMPA 2EMGA 2EM5A 1IBLE 1X6EA 2EPPA 1X49A 3VYXA 3OTOE 1B69A 4KHPE 4LFCE 2EOIA 2DLQA 1PJTA 1GTKA 4JI0E 5ADZA 1EH8A 3ADGA 1X48A 4DV1E 1X47A 2LE2A 2V88A 1A1HA 4JI1E 2EPKX 2A25A 4NXME 5LLQA 3L00A 1GQEA 4DR1E 2EMBA 2R76A 5KL3A 2YU8A 4JI3E 3JAMC 5CFFE 2LJHA 2EQ0A 4GKKE 1EH6A 2EL6A 3MHSC 2LUQA 2YWQA 3UK3C 2EMKA 4Q28A 2JOXA 2EM2A 1J26A 3ADLA 2DMIA 2YTNA 1KJKA 3EQ1A 2LUPB 4F6MA 4DUZE 2UUBE 4DV4E 2E72A 4RHBB 3ADJA 4FK5C 2LO3A 2MKNA 3T1YE 2EOXA 3HXLA 1N36E 1A1KA 4YY3E 1JK2A 1IQSA 2EM0A 3HPSA 2M7QA 2LCEA 4WXDA 2Q8UA 4GEQB 2F8BA 1N34E 2EN2A 2MDGA 3C6KA 5KL5A 1RMDA 2V8QB 1ZBQA 4P7DA 2EP3A 2H36X 2LT7A 2EMIA 4IJDA 4JI8E 4DV3E 5IV8B 4Q35B 3EPLA 2YRKA 2EL5A 1GZ6A 2DSYA 2N8XA 1FJGE 2CSHA 3THNA 2EOJA 2KHXA 3IWCA 3KZZA 2E5LE 1DI2A 2EN7A 2V83A 2HC5A 3BBGA 2EN3A 2EQ1A 2RPCA 3EPKA 5BR8E 4LF4E 2YTFA 1A1GA 2KOUA 2B7VA 2JWOA 4DKKA 2M9AA 4ZYHA 2EMHA 2ENAA 2FV4B 3DF6A 2LTRA 5KL6A 1YUJA 2YRHA 1UN6B 2L2MA 4X66E 2L2KB 3EPJA 3DJWA 2WBTA 2V86A 2EPUA 2EMFA 2DIXA 1T4NA 4DV5E 1YYKA 2DGCA 4K0KE 1WJPA 5F3WA 4R8OA 4KZSA 2GPIA 5AE3A 4F9BB 3K6QA 4HEIA 4F2JC 3C4BA 3JTZA 4BC9A 4M30A 2RQLA 4B3ME 1YFHA 2EOYA 5A6BA 4M0VA 5A6BD 2K7IA 2YPNA 2LV2A 1ZBTA 1LLMC 2RS7A 4BC7A 2ELZA 2YTPA 1G2FC 2D9HA 2CT1A 2VF1A 1YUIA 2N3GA 3FIGA 1A1FA 1N3GA 2M4IA 4L5NC 4DV2E 1QNTA 4LF5E 4DR2E 1XMOE 1P47A 2MC6A 2YT4A 4F54A 3QG5C 2NUGA 4WPYA 2JXPA 2EN1A 4B3SE 4IS1C 4DR5E 3BGHA 4LF8E 2JVAA 3KZYA 4R2SA 1AAYA 4X8WA 2B3TB 4HTGA 4JI4E 1G2DC 2EMCA 2ENCA 5KL4A 1YYWA 4JV5E 4R2PA 2EPXA 4N4RB 2JY9A 4DV0E 1ZAAC 2YSPA 4KWYA 1EH7A 2JR1A 2LTSA 4JI7E 5T6JA 4DV6E
chains in the Genus database with same CATH topology
1PKPA 2L6MA 2E1MA 2MDRA 1WHQA 3LLHA 2HHHE 1YZ9A 3J7AG 4GKJE 3IWDA 2VE7C 4JI5E 4DV3E 3T1HE 4BCAA 2UXDE 1HNXE 2M1SA 3P1XA 4DR3E 5A2QC 1GZ6A 2DSYA 3VK6A 3J80C 2L3CA 1FJGE 1YYOA 3ADIA 3KWRA 2L33A 2YZTA 1UILA 3C4TA 3F6HA 4JI2E 3ZOQB 2KHXA 1WHNA 3HPZA 3JU0A 3IWCA 1WXRA 2ZM6E 5DNYA 1XMQE 1IBKE 2E5LE 4OX9E 3J7Yp 1XNQE 4B3RE 4DUYE 2V87A 1DI2A 1FKAE 2DB2A 4LF6E 2FGGA 1RC7A 2V89A 2V83A 2JOBA 1SR9A 2K4VA 4P78A 5IWAE 4YHHE 3RMPA 1IBLE 4X62E 5BR8E 4LF4E 1X49A 2NUFA 1EKZA 3VYXA 2KOUA 2B7VA 3OTOE 4JYAE 4KHPE 2B9DA 2JWOA 4LFCE 4WYQB 4JI0E 5LL6R 4DKKA 5ADZA 4TUIA 2UXBE 4M2ZA 2N3HA 4WFTA 2B7TA 3MSWA 2FV4B 3DF6A 4DR6E 2LTRA 4DMIA 1T4LB 2EZ6A 2NUEA 3ADGA 1J5EE 1X48A 4DV1E 1X47A 4AQYE 2LE2A 2V88A 4JI1E 1XNRE 3IWBA 2L2MA 2WZOA 4F9AB 4X66E 2UU9E 1N33E 2L2KB 4DR4E 4NXME 3DJWA 1QU6A 3J81C 2V86A 4LF7E 2RTXA 2EWLA 1GQEA 2DIXA 1DQ3A 1T4NA 4DR1E 4BBYA 2ODRC 4DV5E 1YYKA 4JI6E 1HNWE 4LFAE 1HNZE 5AE1A 4X65E 5LMNE 4K0KE 2L2NA 2LBSB 5F3WA 3AUZA 4R8OA 4JI3E 4KZSA 3JAMC 5AE3A 2VQFE 4F9BB 3K6QA 5AASA 5LMUE 1N32E 3C4BA 3JTZA 4L8NA 2LJHA 4BC9A 4M30A 5CFFE 2L3JA 4GKKE 3F6GA 4WSPA 5IT9C 2LUQA 4B3ME 4X64E 1I94E 4R03A 4M0VA 4Q28A 2JOXA 1J26A 5AE2A 3OMLA 2UUAE 3ADLA 4B3TE 2RSMA 1ZBTA 2RS7A 2VQEE 4BC7A 2LUPB 4DUZE 2UUCE 2UUBE 4LFBE 2LRSA 3VYYA 2L8TA 4DV4E 2RS6A 4J8ZA 2V85A 2VF1A 2N3GA 3ADJA 3FIGA 2DMYA 2M4IA 4L5NC 4DV2E 3T1YE 1T4OA 3HXLA 4LF5E 4DR2E 1XMOE 1N36E 4I8OA 4NXNE 4OOGC 2L92A 2MC6A 2YT4A 4YY3E 4F54A 2NUGA 4WPYA 3HPSA 2M7QA 4TUGA 2UXCE 4B3SE 2MC5A 4DR5E 2IHR1 4LF8E 2JVAA 2NA2A 1RQ0A 1O0WA 3AV0A 2F4VE 4GEQB 2F8BA 4LTYA 4X8WA 2B3TB 1N34E 4JI4E 4BS9A 2G7HA 3H09A 1YYWA 4JV5E 3HTXA 4DR7E 5FLXC 4F9CB 2JY9A 4DV0E 2ODRD 2KONA 2V8QB 1ZBQA 3HQ1A 3LMLA 4LU9A 4P7DA 4BMJA 2H36X 2CPNA 1STUA 1IBME 2JR1A 2LTSA 4JI8E 4LF9E 1UHZA 4DV7E 1HR0E 2FTXB 4JI7E 5T6JA 4DV6E 2LMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKP A;  3LLH A;  2MDR A;  2HHH E;  1WHQ A;  1YZ9 A;  2UXD E;  4GKJ E;  4JI5 E;  4DV3 E;  3T1H E;  1HNX E;  3P1X A;  4DR3 E;  1FJG E;  2L3C A;  1YYO A;  3ADI A;  2L33 A;  3C4T A;  1UIL A;  4JI2 E;  2KHX A;  1WHN A;  1XMQ E;  2ZM6 E;  1IBK E;  4OX9 E;  2E5L E;  1XNQ E;  3J7Y p;  4B3R E;  4DUY E;  1DI2 A;  1FKA E;  2DB2 A;  4LF6 E;  1RC7 A;  5IWA E;  4YHH E;  1IBL E;  4X62 E;  5BR8 E;  4LF4 E;  1X49 A;  2NUF A;  1EKZ A;  3VYX A;  3OTO E;  2B7V A;  4JYA E;  4KHP E;  4LFC E;  4WYQ B;  4JI0 E;  4DKK A;  2UXB E;  4M2Z A;  2N3H A;  4WFT A;  2B7T A;  4DR6 E;  2LTR A;  1T4L B;  2NUE A;  2EZ6 A;  3ADG A;  1J5E E;  1X48 A;  4DV1 E;  1X47 A;  4AQY E;  1XNR E;  4JI1 E;  2L2M A;  2UU9 E;  4X66 E;  1N33 E;  2L2K B;  4DR4 E;  4NXM E;  1QU6 A;  2RTX A;  1GQE A;  2DIX A;  1T4N A;  4DR1 E;  4DV5 E;  1YYK A;  4JI6 E;  1HNW E;  4LFA E;  1HNZ E;  4X65 E;  5LMN E;  4K0K E;  2L2N A;  2LBS B;  4JI3 E;  2VQF E;  5LMU E;  1N32 E;  3C4B A;  5CFF E;  2LJH A;  2L3J A;  4M30 A;  4GKK E;  4B3M E;  2LUQ A;  4X64 E;  1I94 E;  1J26 A;  2UUA E;  3ADL A;  4B3T E;  2RSM A;  1ZBT A;  2RS7 A;  2VQE E;  2LUP B;  4DUZ E;  2UUC E;  2UUB E;  4LFB E;  2LRS A;  3VYY A;  4DV4 E;  2RS6 A;  2N3G A;  3ADJ A;  2DMY A;  4DV2 E;  3T1Y E;  1T4O A;  4LF5 E;  4DR2 E;  1XMO E;  1N36 E;  4NXN E;  4OOG C;  2YT4 A;  4YY3 E;  2NUG A;  4B3S E;  4DR5 E;  2IHR 1;  4LF8 E;  2JVA A;  2NA2 A;  1RQ0 A;  1O0W A;  2UXC E;  2F4V E;  4X8W A;  2B3T B;  1N34 E;  4JI4 E;  1YYW A;  4JV5 E;  3HTX A;  4DR7 E;  2JY9 A;  4DV0 E;  2CPN A;  1STU A;  1IBM E;  2LTS A;  4JI8 E;  4LF9 E;  1UHZ A;  4DV7 E;  1HR0 E;  4JI7 E;  4DV6 E;  4LF7 E; 
#chains in the Genus database with same CATH topology
 2E1M A;  2HHH E;  1YZ9 A;  3J7A G;  2UXD E;  3IWD A;  2VE7 C;  4JI5 E;  3BID A;  3T1H E;  4O5G A;  2EPN A;  4DR3 E;  1PJQ A;  2EMZ A;  3J80 C;  2L3C A;  1YYO A;  3ADI A;  3KWR A;  1SFE A;  2L33 A;  2YZT A;  2YRM A;  3ZOQ B;  3JU0 A;  1JK1 A;  2ZM6 E;  5DNY A;  4OX9 E;  1XNQ E;  4B3R E;  2V87 A;  1IQO A;  1KYQ A;  2FGG A;  2EOZ A;  4P78 A;  1TF3 A;  4YHH E;  5A6J A;  4R2E A;  2NUF A;  1EKZ A;  2EM8 A;  2EM9 A;  2ELY A;  4WYQ B;  5LL6 R;  4MLV A;  4TUI A;  2UXB E;  2HJJ A;  2N3H A;  2EOS A;  2DRP A;  4DMI A;  4O4K A;  2EN6 A;  1A1L A;  5AC4 A;  4AQY E;  4F9A B;  2EPL X;  2YTE A;  4DR4 E;  3J81 C;  1QU6 A;  2CTD A;  2RTX A;  2EWL A;  1A1J A;  2JPA A;  1DQ3 A;  4BBY A;  5TSE A;  4JI6 E;  1HNW E;  4LFA E;  2VQF E;  2YTI A;  1X6H A;  5AAS A;  3M99 B;  3F6G A;  2EPA A;  3MHH C;  1YPN A;  2GHF A;  2JP9 A;  2EMW A;  2I9I A;  1NCS A;  2RSM A;  2EM3 A;  2VRD A;  4O24 A;  5A6K A;  2UUC E;  2EJ4 A;  2LRS A;  3VYY A;  4LFB E;  2L8T A;  2RS6 A;  4J8Z A;  1A1I A;  2WBU A;  2V85 A;  1PJS A;  4WSG A;  2YTJ A;  1T4O A;  2YTG A;  4BHC A;  2JYA A;  4I8O A;  4R2Q A;  2EOE A;  4WX9 A;  2WCC 3;  5KL2 A;  2EOR A;  2IHR 1;  2NA2 A;  1RQ0 A;  1O0W A;  2F4V E;  4LTY A;  2EM6 A;  2EPC A;  5A6A A;  4R2R A;  4DR7 E;  1WRJ A;  5FLX C;  4F9C B;  2ODR D;  4O43 A;  2KON A;  3HQ1 A;  2I13 A;  3LML A;  2EM4 A;  2EOQ A;  4BMJ A;  2LJU A;  1IBM E;  1STU A;  2YTD A;  1ZU1 A;  1UHZ A;  4DV7 E;  2BB8 A;  1WHQ A;  2EMX A;  2J7J A;  3THO B;  4R2D A;  2EPO A;  2EPM X;  3VK6 A;  2ADR A;  1AH5 A;  3C4T A;  1XMQ E;  3VHT B;  1X3C A;  2DB2 A;  2EOM A;  2V89 A;  2RSI A;  1RC7 A;  2K4V A;  5IWA E;  1BBG A;  5A69 A;  4X9J A;  4X62 E;  1DGC A;  1IMU A;  4JYA E;  2B9D A;  4R2C A;  4M2Z A;  4WFT A;  1MGT A;  2B7T A;  3MSW A;  4DR6 E;  1X5W A;  1T4L B;  2NUE A;  2EZ6 A;  2EQ3 A;  4NHR A;  1J5E E;  1XNR E;  3IWB A;  2UU9 E;  2WZO A;  1N33 E;  3TQM A;  3ECR A;  4RH8 A;  2ODR C;  2EOO A;  1HNZ E;  5AE1 A;  4X65 E;  5LMN E;  2L2N A;  2LBS B;  3AUZ A;  2EOF A;  5LMU E;  1N32 E;  4L8N A;  2EPR A;  1PDA A;  4MLQ A;  2L3J A;  5IT9 C;  4WSP A;  4X64 E;  2BBG A;  1I94 E;  4R03 A;  2EML A;  2EN4 A;  3C6M A;  2EMA A;  3OML A;  5AE2 A;  2UUA E;  3BF2 A;  4B3T E;  1UBD C;  2VQE E;  1NEI A;  2EMY A;  4R2A A;  2GLI A;  1TF6 A;  2EN8 A;  2DMY A;  1YSA C;  4NXN E;  4OOG C;  2L92 A;  3EPH A;  1MEY C;  2YTO A;  2R1F A;  4ZYD A;  4TUG A;  2YU5 A;  2MC5 A;  4GZN C;  2UXC E;  3AV0 A;  5KL7 A;  1X6F A;  4BS9 A;  2G7H A;  2NAB A;  3H09 A;  3HTX A;  4ZYG A;  5AC5 A;  2MKD A;  4LU9 A;  2WBS A;  2EE8 A;  1ZR9 A;  1L4S A;  2CPN A;  4LF9 E;  1HR0 E;  2FTX B;  1F2I G;  2LMZ A;  4LF7 E;  1PKP A;  2L6M A;  2MDR A;  3LLH A;  2EL4 A;  2YSO A;  4M9V C;  4GKJ E;  1BB8 A;  4BCA A;  1TN9 A;  1T39 A;  2PRT A;  1HNX E;  2M1S A;  3P1X A;  5IXM B;  5A2Q C;  4F6N A;  2HGH A;  2LVH A;  2EM7 A;  1UIL A;  3F6H A;  4JI2 E;  1WHN A;  3HPZ A;  4BHB A;  1WXR A;  2EPZ A;  4NZV A;  1T38 A;  4WXC A;  3J7Y p;  1IBK E;  4DUY E;  1FKA E;  1Z1B A;  4LF6 E;  4ZYE A;  2DLK A;  2ENH A;  1BBO A;  2YTQ A;  2JOB A;  1SR9 A;  2EOH A;  3RMP A;  2EMG A;  2EM5 A;  1IBL E;  1X6E A;  2EPP A;  1X49 A;  3VYX A;  3OTO E;  1B69 A;  4KHP E;  4LFC E;  2EOI A;  2DLQ A;  1PJT A;  1GTK A;  4JI0 E;  5ADZ A;  1EH8 A;  3ADG A;  1X48 A;  4DV1 E;  1X47 A;  2LE2 A;  2V88 A;  1A1H A;  4JI1 E;  2EPK X;  2A25 A;  4NXM E;  5LLQ A;  3L00 A;  1GQE A;  4DR1 E;  2EMB A;  2R76 A;  5KL3 A;  2YU8 A;  4JI3 E;  3JAM C;  5CFF E;  2LJH A;  2EQ0 A;  4GKK E;  1EH6 A;  2EL6 A;  3MHS C;  2LUQ A;  2YWQ A;  3UK3 C;  2EMK A;  4Q28 A;  2JOX A;  2EM2 A;  1J26 A;  3ADL A;  2DMI A;  2YTN A;  1KJK A;  3EQ1 A;  2LUP B;  4F6M A;  4DUZ E;  2UUB E;  4DV4 E;  2E72 A;  4RHB B;  3ADJ A;  4FK5 C;  2LO3 A;  2MKN A;  3T1Y E;  2EOX A;  3HXL A;  1N36 E;  1A1K A;  4YY3 E;  1JK2 A;  1IQS A;  2EM0 A;  3HPS A;  2M7Q A;  2LCE A;  4WXD A;  2Q8U A;  4GEQ B;  2F8B A;  1N34 E;  2EN2 A;  2MDG A;  3C6K A;  5KL5 A;  1RMD A;  2V8Q B;  1ZBQ A;  4P7D A;  2EP3 A;  2H36 X;  2LT7 A;  2EMI A;  4IJD A;  4JI8 E;  4DV3 E;  5IV8 B;  4Q35 B;  3EPL A;  2YRK A;  2EL5 A;  1GZ6 A;  2DSY A;  2N8X A;  1FJG E;  2CSH A;  3THN A;  2EOJ A;  2KHX A;  3IWC A;  3KZZ A;  2E5L E;  1DI2 A;  2EN7 A;  2V83 A;  2HC5 A;  3BBG A;  2EN3 A;  2EQ1 A;  2RPC A;  3EPK A;  5BR8 E;  4LF4 E;  2YTF A;  1A1G A;  2KOU A;  2B7V A;  2JWO A;  4DKK A;  2M9A A;  4ZYH A;  2EMH A;  2ENA A;  2FV4 B;  3DF6 A;  2LTR A;  5KL6 A;  1YUJ A;  2YRH A;  1UN6 B;  2L2M A;  4X66 E;  2L2K B;  3EPJ A;  3DJW A;  2WBT A;  2V86 A;  2EPU A;  2EMF A;  2DIX A;  1T4N A;  4DV5 E;  1YYK A;  2DGC A;  4K0K E;  1WJP A;  5F3W A;  4R8O A;  4KZS A;  2GPI A;  5AE3 A;  4F9B B;  3K6Q A;  4HEI A;  4F2J C;  3C4B A;  3JTZ A;  4BC9 A;  4M30 A;  2RQL A;  4B3M E;  1YFH A;  2EOY A;  5A6B A;  4M0V A;  5A6B D;  2K7I A;  2YPN A;  2LV2 A;  1ZBT A;  1LLM C;  2RS7 A;  4BC7 A;  2ELZ A;  2YTP A;  1G2F C;  2D9H A;  2CT1 A;  2VF1 A;  1YUI A;  2N3G A;  3FIG A;  1A1F A;  1N3G A;  2M4I A;  4L5N C;  4DV2 E;  1QNT A;  4LF5 E;  4DR2 E;  1XMO E;  1P47 A;  2MC6 A;  2YT4 A;  4F54 A;  3QG5 C;  2NUG A;  4WPY A;  2JXP A;  2EN1 A;  4B3S E;  4IS1 C;  4DR5 E;  3BGH A;  4LF8 E;  2JVA A;  3KZY A;  4R2S A;  1AAY A;  4X8W A;  2B3T B;  4HTG A;  4JI4 E;  1G2D C;  2EMC A;  2ENC A;  5KL4 A;  1YYW A;  4JV5 E;  4R2P A;  2EPX A;  4N4R B;  2JY9 A;  4DV0 E;  1ZAA C;  2YSP A;  4KWY A;  1EH7 A;  2JR1 A;  2LTS A;  4JI7 E;  5T6J A;  4DV6 E; 
#chains in the Genus database with same CATH homology
 1PKP A;  2L6M A;  2E1M A;  2MDR A;  1WHQ A;  3LLH A;  2HHH E;  1YZ9 A;  3J7A G;  4GKJ E;  3IWD A;  2VE7 C;  4JI5 E;  4DV3 E;  3T1H E;  4BCA A;  2UXD E;  1HNX E;  2M1S A;  3P1X A;  4DR3 E;  5A2Q C;  1GZ6 A;  2DSY A;  3VK6 A;  3J80 C;  2L3C A;  1FJG E;  1YYO A;  3ADI A;  3KWR A;  2L33 A;  2YZT A;  1UIL A;  3C4T A;  3F6H A;  4JI2 E;  3ZOQ B;  2KHX A;  1WHN A;  3HPZ A;  3JU0 A;  3IWC A;  1WXR A;  2ZM6 E;  5DNY A;  1XMQ E;  1IBK E;  2E5L E;  4OX9 E;  3J7Y p;  1XNQ E;  4B3R E;  4DUY E;  2V87 A;  1DI2 A;  1FKA E;  2DB2 A;  4LF6 E;  2FGG A;  1RC7 A;  2V89 A;  2V83 A;  2JOB A;  1SR9 A;  2K4V A;  4P78 A;  5IWA E;  4YHH E;  3RMP A;  1IBL E;  4X62 E;  5BR8 E;  4LF4 E;  1X49 A;  2NUF A;  1EKZ A;  3VYX A;  2KOU A;  2B7V A;  3OTO E;  4JYA E;  4KHP E;  2B9D A;  2JWO A;  4LFC E;  4WYQ B;  4JI0 E;  5LL6 R;  4DKK A;  5ADZ A;  4TUI A;  2UXB E;  4M2Z A;  2N3H A;  4WFT A;  2B7T A;  3MSW A;  2FV4 B;  3DF6 A;  4DR6 E;  2LTR A;  4DMI A;  1T4L B;  2EZ6 A;  2NUE A;  3ADG A;  1J5E E;  1X48 A;  4DV1 E;  1X47 A;  4AQY E;  2LE2 A;  2V88 A;  4JI1 E;  1XNR E;  3IWB A;  2L2M A;  2WZO A;  4F9A B;  4X66 E;  2UU9 E;  1N33 E;  2L2K B;  4DR4 E;  4NXM E;  3DJW A;  1QU6 A;  3J81 C;  2V86 A;  4LF7 E;  2RTX A;  2EWL A;  1GQE A;  2DIX A;  1DQ3 A;  1T4N A;  4DR1 E;  4BBY A;  2ODR C;  4DV5 E;  1YYK A;  4JI6 E;  1HNW E;  4LFA E;  1HNZ E;  5AE1 A;  4X65 E;  5LMN E;  4K0K E;  2L2N A;  2LBS B;  5F3W A;  3AUZ A;  4R8O A;  4JI3 E;  4KZS A;  3JAM C;  5AE3 A;  2VQF E;  4F9B B;  3K6Q A;  5AAS A;  5LMU E;  1N32 E;  3C4B A;  3JTZ A;  4L8N A;  2LJH A;  4BC9 A;  4M30 A;  5CFF E;  2L3J A;  4GKK E;  3F6G A;  4WSP A;  5IT9 C;  2LUQ A;  4B3M E;  4X64 E;  1I94 E;  4R03 A;  4M0V A;  4Q28 A;  2JOX A;  1J26 A;  5AE2 A;  3OML A;  2UUA E;  3ADL A;  4B3T E;  2RSM A;  1ZBT A;  2RS7 A;  2VQE E;  4BC7 A;  2LUP B;  4DUZ E;  2UUC E;  2UUB E;  4LFB E;  2LRS A;  3VYY A;  2L8T A;  4DV4 E;  2RS6 A;  4J8Z A;  2V85 A;  2VF1 A;  2N3G A;  3ADJ A;  3FIG A;  2DMY A;  2M4I A;  4L5N C;  4DV2 E;  3T1Y E;  1T4O A;  3HXL A;  4LF5 E;  4DR2 E;  1XMO E;  1N36 E;  4I8O A;  4NXN E;  4OOG C;  2L92 A;  2MC6 A;  2YT4 A;  4YY3 E;  4F54 A;  2NUG A;  4WPY A;  3HPS A;  2M7Q A;  4TUG A;  2UXC E;  4B3S E;  2MC5 A;  4DR5 E;  2IHR 1;  4LF8 E;  2JVA A;  2NA2 A;  1RQ0 A;  1O0W A;  3AV0 A;  2F4V E;  4GEQ B;  2F8B A;  4LTY A;  4X8W A;  2B3T B;  1N34 E;  4JI4 E;  4BS9 A;  2G7H A;  3H09 A;  1YYW A;  4JV5 E;  3HTX A;  4DR7 E;  5FLX C;  4F9C B;  2JY9 A;  4DV0 E;  2ODR D;  2KON A;  2V8Q B;  1ZBQ A;  3HQ1 A;  3LML A;  4LU9 A;  4P7D A;  4BMJ A;  2H36 X;  2CPN A;  1STU A;  1IBM E;  2JR1 A;  2LTS A;  4JI8 E;  4LF9 E;  1UHZ A;  4DV7 E;  1HR0 E;  2FTX B;  4JI7 E;  5T6J A;  4DV6 E;  2LMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...