2LRSA

The second dsrbd domain from a. thaliana dicer-like 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
b'NDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease Dicer homolog 1
publication title Second Double-Stranded RNA Binding Domain of Dicer-like Ribonuclease 1: Structural and Biochemical Characterization.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 15
structure length 71
sequence length 71
ec nomenclature ec 3.1.26.-:
pdb deposition date 2012-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lrsA00
4DR5E 4B3ME 1XNRE 2NUGA 1X48A 5CFFE 4DV5E 3HTXA 3VYYA 2UU9E 1IBME 1PKPA 4DV2E 4K0KE 2B3TB 1XMOE 4DV6E 4DV7E 4OX9E 3ADLA 1YYWA 1HNXE 1XMQE 2UUCE 4DR1E 1YYOA 1IBKE 2LTSA 4DV0E 3J7Yp 1HNZE 3C4TA 1EKZA 2RS7A 1I94E 4GKKE 2NA2A 4NXNE 2N3GA 4LF9E 2DIXA 2MDRA 4X66E 1J5EE 2L2NA 4LF8E 2LTRA 4M2ZA 2NUEA 4DR6E 4LFCE 3VYXA 4X64E 5IWAE 1RQ0A 2VQEE 4LFAE 4AQYE 1N32E 1T4OA 1YYKA 1WHNA 4DR3E 2L2KB 2B7VA 4JI1E 5LMNE 4DUYE 4WYQB 3ADJA 2HHHE 2L3CA 4JI5E 4NXME 4LF6E 3OTOE 4M30A 1GQEA 2LRSA 4X62E 2KHXA 1ZBTA 2DB2A 1O0WA 2ZM6E 2RSMA 5BR8E 4DV4E 3T1HE 2LBSB 4LF5E 2UXDE 2L3JA 2LUQA 4DKKA 2JY9A 2E5LE 4YHHE 1FKAE 3ADIA 4OOGC 2UXCE 2LJHA 4X65E 4DR7E 1N33E 1UHZA 2UUBE 1RC7A 3P1XA 3LLHA 2L33A 2EZ6A 4JI7E 4B3RE 4JI3E 2NUFA 1X47A 3ADGA 1T4NA 4KHPE 1QU6A 1DI2A 1YZ9A 2UUAE 1FJGE 2CPNA 3C4BA 1STUA 4JI8E 5LMUE 4DV3E 2F4VE 2VQFE 2JVAA 1J26A 4JI2E 4B3SE 4JI0E 4LFBE 2B7TA 1T4LB 1N34E 1XNQE 1WHQA 2YT4A 4DV1E 1X49A 1IBLE 2RTXA 2RS6A 4DR2E 2DMYA 3T1YE 4JI4E 1HR0E 2LUPB 4GKJE 4JYAE 4WFTA 4DUZE 4JV5E 2L2MA 1N36E 2IHR1 1UILA 4JI6E 4X8WA 2N3HA 1HNWE 4B3TE 4YY3E 2UXBE 4LF7E 4DR4E 4LF4E
chains in the Genus database with same CATH superfamily
1ZR9A 4DR5E 2EN1A 2EQ0A 2H36X 2ENAA 2CT1A 1KJKA 3OMLA 5CFFE 2DGCA 3HTXA 4DV6E 2G7HA 2YTGA 2JXPA 1WXRA 5DNYA 2R1FA 4KWYA 2EJ4A 2EE8A 4TUIA 1EKZA 2EOJA 1IQOA 2D9HA 2JWOA 1UN6B 3AV0A 4X66E 3K6QA 2L2NA 4M2ZA 4DR6E 5IT9C 1A1GA 2YTPA 2E1MA 4X64E 5IWAE 4P78A 2M4IA 1EH8A 1RQ0A 2VF1A 3AUZA 2Q8UA 2EOHA 3ECRA 2VQEE 4AQYE 1T4OA 2EMAA 4R2QA 1SR9A 4IS1C 4DUYE 4R03A 3ADJA 2YTDA 2MDGA 2L6MA 3DF6A 2NABA 3OTOE 1WJPA 2LBSB 2EOMA 2EOXA 3T1HE 2UXDE 4O43A 2CTDA 2EM6A 2JY9A 2JR1A 1AAYA 2E5LE 2EPKX 2V86A 2EM4A 1MEYC 2UXCE 2F8BA 1PJQA 2EOYA 2LJHA 1A1LA 2EMXA 4X65E 4ZYHA 1RC7A 3IWDA 3P1XA 4O24A 2EPCA 5KL7A 2EPZA 2GHFA 4JI3E 2JOXA 2ELZA 1QU6A 2EN8A 1YZ9A 5KL5A 4BS9A 2EPXA 2MKNA 2YWQA 4JI8E 4DV3E 1WRJA 2EPLX 4N4RB 2VE7C 4B3SE 2EM2A 1BBGA 4P7DA 1X6FA 1WHQA 4F9AB 4WXDA 4F6NA 2RTXA 2EPRA 3IWBA 3EPKA 2YSOA 5AE2A 4JI4E 4JYAE 4F2JC 4KZSA 4DUZE 2I13A 2IHR1 4JI6E 2VRDA 4WXCA 4IJDA 4HEIA 4BBYA 3H09A 3JU0A 2EMCA 4MLVA 2EOEA 1F2IG 1X48A 4DV5E 3THOB 3VYYA 1IBME 1PKPA 2YU5A 1AH5A 4L5NC 1XMOE 2YTOA 1ZAAC 2EWLA 3IWCA 2EOZA 1YPNA 3DJWA 2WBUA 5KL2A 1YFHA 2A25A 4DR1E 1YYOA 1IQSA 3J7Yp 4DV0E 3C4TA 4GKKE 1X3CA 2V88A 2NA2A 2K4VA 2N3GA 2RPCA 5A6BA 2JOBA 4LTYA 4LF8E 2NUEA 1TF6A 2EMKA 4HTGA 3J80C 4F6MA 1JK2A 1PJTA 2V8QB 3BBGA 2EM8A 2R76A 2EL6A 2V83A 2MKDA 1NEIA 3L00A 3F6GA 2HHHE 2L3CA 4JI5E 2DMIA 2EOQA 1GQEA 2LRSA 4X62E 2EPAA 2YSPA 1A1JA 2LT7A 2DB2A 1O0WA 3KZZA 5IXMB 3KWRA 2L3JA 4DKKA 3J7AG 2EM7A 4Q28A 2YU8A 2ODRC 2YTJA 3ADIA 4OOGC 4RHBB 3LMLA 3TQMA 2EM9A 1G2FC 4NZVA 5ADZA 2ELYA 2EOFA 4WSPA 2ADRA 1IMUA 4BMJA 2V85A 4B3RE 2B9DA 1X47A 1DI2A 4R8OA 2EPOA 5KL3A 2VQFE 2JVAA 4LFBE 2B7TA 4J8ZA 4BCAA 2EMWA 2YT4A 5AE1A 5KL4A 2RQLA 2RS6A 4R2EA 2EPPA 1EH6A 2DMYA 2K7IA 3M99B 3BF2A 4GKJE 4Q35B 3BIDA 2ENHA 1GZ6A 5TSEA 1N36E 1QNTA 2EOOA 2HC5A 1UILA 1HNWE 3HQ1A 5LL6R 4B3TE 2WCC3 4LF7E 3FIGA 4F9BB 4O5GA 1NCSA 2YPNA 5AC4A 2LE2A 2EMIA 1XNRE 1RMDA 2NUGA 2EMHA 1DGCA 3J81C 3HPZA 2EN7A 4DV2E 2B3TB 3EPLA 2EN2A 1SFEA 2FGGA 2WZOA 1A1FA 3ADLA 1YYWA 2EMGA 1XMQE 4R2PA 2EQ3A 2WBSA 1IBKE 2M1SA 1KYQA 1HNZE 1X6EA 2EN3A 3BGHA 2LVHA 2RS7A 1I94E 4R2SA 4LF9E 2MDRA 4ZYGA 1J5EE 2LCEA 3UK3C 1YUJA 2E72A 4LFCE 2N8XA 2WBTA 3QG5C 5T6JA 3VYXA 2LV2A 4LFAE 4WPYA 1N32E 2EMLA 2KOUA 1X5WA 1YYKA 1WHNA 1T38A 2BBGA 4GZNC 4WYQB 4NHRA 3ZOQB 2YRHA 4NXME 2YTEA 1BBOA 3EQ1A 1B69A 2EP3A 2KHXA 5BR8E 2ZM6E 2M9AA 4R2AA 4DV4E 4LF5E 2LUQA 2DSYA 2DLQA 1FKAE 4DR7E 4I8OA 4WSGA 3JAMC 1UHZA 2MC6A 3KZYA 3LLHA 2L33A 2DLKA 4M0VA 4JI7E 2EPUA 2EPMX 2FV4B 3ADGA 1L4SA 1T4NA 4L8NA 4KHPE 3JTZA 2EM3A 1MGTA 2UUAE 4F54A 2CPNA 1STUA 1YUIA 2EN6A 1J26A 3VHTB 4R2RA 4DMIA 1N34E 4F9CB 2GPIA 5A69A 1X49A 2EMYA 1IBLE 2YTNA 2JYAA 2DRPA 2EORA 5AASA 4RH8A 2LUPB 2L8TA 2EL4A 4WFTA 4JV5E 2L2MA 4MLQA 5A6BD 2EPNA 1A1HA 1A1IA 4X8WA 4WX9A 4BHBA 2EMBA 1TN9A 2UXBE 4DR4E 1EH7A 1P47A 3MSWA 5LLQA 4BHCA 4B3ME 5KL6A 2HGHA 5A2QC 2M7QA 2JP9A 2UU9E 4K0KE 4FK5C 4R2CA 2EM0A 2EOIA 4DV7E 4OX9E 4GEQB 2YRKA 1HNXE 2UUCE 2LTSA 2KONA 2V87A 4TUGA 2EOSA 4NXNE 4BC9A 2YTQA 2LMZA 2DIXA 3MHHC 1DQ3A 2LTRA 3EPJA 4R2DA 2CSHA 1TF3A 2I9IA 4DR3E 2L2KB 2B7VA 2EQ1A 2GLIA 1G2DC 1N3GA 4JI1E 5AE3A 5LMNE 2LO3A 1LLMC 5A6AA 1PDAA 2L92A 5FLXC 4LF6E 4M30A 1BB8A 3HPSA 1ZBTA 4LU9A 2RSMA 3F6HA 3EPHA 3C6KA 5IV8B 1ZU1A 2LJUA 4YHHE 2EN4A 5F3WA 2EM5A 1UBDC 2J7JA 2EL5A 2EMZA 2V89A 1N33E 2EMFA 2ENCA 3MHSC 2UUBE 1ZBQA 2EZ6A 1X6HA 1PJSA 4ZYEA 3VK6A 2NUFA 1T39A 2JPAA 2YRMA 2MC5A 2ODRD 1FJGE 3C4BA 4BC7A 5LMUE 2F4VE 1JK1A 4JI2E 4JI0E 3THNA 2RSIA 1Z1BA 1T4LB 5A6KA 1XNQE 4DV1E 2YZTA 3RMPA 4O4KA 4DR2E 3T1YE 2PRTA 1HR0E 4ZYDA 2BB8A 2HJJA 1A1KA 1YSAC 2FTXB 2N3HA 5A6JA 3HXLA 5AC5A 4X9JA 4YY3E 4LF4E 4M9VC 2YTIA 3C6MA 2YTFA 1GTKA
chains in the Genus database with same CATH topology
2UXDE 2LE2A 4DR5E 2H36X 4B3ME 1XNRE 2NUGA 5A2QC 1X48A 3OMLA 5CFFE 3J81C 4DV5E 2M7QA 3VYYA 3HTXA 3HPZA 2UU9E 1IBME 1PKPA 4DV2E 4L5NC 2B3TB 4K0KE 1XMOE 2FGGA 2WZOA 4DV6E 4DV7E 2G7HA 4OX9E 3ADLA 2EWLA 3IWCA 4GEQB 1YYWA 3DJWA 1HNXE 1WXRA 5DNYA 1XMQE 4DR1E 2UUCE 1YYOA 1IBKE 2LTSA 2M1SA 3J7Yp 2KONA 4DV0E 3C4TA 4TUIA 2V87A 1EKZA 1HNZE 4TUGA 2RS7A 1I94E 4GKKE 2JWOA 2V88A 2NA2A 4NXNE 4BC9A 2K4VA 2N3GA 2LMZA 2DIXA 3AV0A 2MDRA 4LF9E 1DQ3A 4X66E 3K6QA 2JOBA 2L2NA 4LTYA 2LTRA 1J5EE 4LF8E 5IT9C 4M2ZA 2NUEA 4LFCE 4DR6E 2E1MA 3J80C 5T6JA 3VYXA 4X64E 5IWAE 4P78A 2V8QB 2M4IA 1RQ0A 2VF1A 3AUZA 2VQEE 4LFAE 4WPYA 4AQYE 1N32E 1T4OA 2KOUA 1YYKA 1WHNA 4DR3E 2L2KB 2B7VA 1SR9A 2V83A 4JI1E 5AE3A 5LMNE 4DUYE 4R03A 4WYQB 3F6GA 3ADJA 2HHHE 2L3CA 2L6MA 4JI5E 2L92A 3ZOQB 4NXME 3DF6A 5FLXC 3OTOE 4M30A 1GQEA 2LRSA 4X62E 4LF6E 2KHXA 3HPSA 1ZBTA 2DB2A 1O0WA 2RSMA 3F6HA 4LU9A 5BR8E 2ZM6E 4DV4E 3T1HE 2LBSB 3KWRA 2LUQA 2L3JA 4LF5E 4DKKA 3J7AG 2DSYA 2JR1A 2JY9A 4YHHE 2E5LE 2V86A 4Q28A 1FKAE 2ODRC 5F3WA 3ADIA 4OOGC 2UXCE 2F8BA 3LMLA 2LJHA 2V89A 4X65E 5ADZA 4DR7E 4I8OA 1N33E 3JAMC 1UHZA 2MC6A 2UUBE 1ZBQA 3IWDA 3LLHA 3P1XA 2L33A 1RC7A 2EZ6A 4M0VA 4WSPA 4BMJA 4JI7E 2V85A 3VK6A 4B3RE 2B9DA 2FV4B 1X47A 3ADGA 2NUFA 1T4NA 4L8NA 4JI3E 3JTZA 4KHPE 2JOXA 1QU6A 1DI2A 1YZ9A 4R8OA 2MC5A 2ODRD 2UUAE 4F54A 1FJGE 2CPNA 4BS9A 3C4BA 1STUA 4JI8E 4BC7A 5LMUE 4DV3E 2F4VE 2VQFE 2JVAA 1J26A 2VE7C 4JI2E 4B3SE 4JI0E 4LFBE 2B7TA 4P7DA 4J8ZA 1T4LB 4DMIA 4BCAA 1N34E 4F9CB 1XNQE 1WHQA 2YT4A 4F9AB 4DV1E 1X49A 2YZTA 3RMPA 1IBLE 2RTXA 5AE1A 3IWBA 5AE2A 2RS6A 5AASA 4DR2E 2DMYA 3T1YE 4JI4E 1HR0E 2LUPB 2L8TA 4GKJE 4JYAE 4WFTA 4KZSA 1GZ6A 4DUZE 4JV5E 2L2MA 1N36E 2IHR1 1UILA 4JI6E 2FTXB 4X8WA 2N3HA 1HNWE 3HQ1A 5LL6R 4B3TE 3HXLA 4BBYA 3H09A 3JU0A 4YY3E 2UXBE 4LF7E 3FIGA 4DR4E 4LF4E 4F9BB 3MSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  4B3M E;  1XNR E;  2NUG A;  1X48 A;  5CFF E;  4DV5 E;  3HTX A;  3VYY A;  2UU9 E;  1IBM E;  1PKP A;  4DV2 E;  4K0K E;  2B3T B;  1XMO E;  4DV6 E;  4DV7 E;  4OX9 E;  3ADL A;  1YYW A;  1HNX E;  1XMQ E;  2UUC E;  4DR1 E;  1YYO A;  1IBK E;  2LTS A;  4DV0 E;  3J7Y p;  1HNZ E;  3C4T A;  1EKZ A;  2RS7 A;  1I94 E;  4GKK E;  2NA2 A;  4NXN E;  2N3G A;  4LF9 E;  2DIX A;  2MDR A;  4X66 E;  1J5E E;  2L2N A;  4LF8 E;  2LTR A;  4M2Z A;  2NUE A;  4DR6 E;  4LFC E;  3VYX A;  4X64 E;  5IWA E;  1RQ0 A;  2VQE E;  4LFA E;  4AQY E;  1N32 E;  1T4O A;  1YYK A;  1WHN A;  4DR3 E;  2L2K B;  2B7V A;  4JI1 E;  5LMN E;  4DUY E;  4WYQ B;  3ADJ A;  2HHH E;  2L3C A;  4JI5 E;  4NXM E;  4LF6 E;  3OTO E;  4M30 A;  1GQE A;  2LRS A;  4X62 E;  2KHX A;  1ZBT A;  2DB2 A;  1O0W A;  2ZM6 E;  2RSM A;  5BR8 E;  4DV4 E;  3T1H E;  2LBS B;  4LF5 E;  2UXD E;  2L3J A;  2LUQ A;  4DKK A;  2JY9 A;  2E5L E;  4YHH E;  1FKA E;  3ADI A;  4OOG C;  2UXC E;  2LJH A;  4X65 E;  4DR7 E;  1N33 E;  1UHZ A;  2UUB E;  1RC7 A;  3P1X A;  3LLH A;  2L33 A;  2EZ6 A;  4JI7 E;  4B3R E;  4JI3 E;  2NUF A;  1X47 A;  3ADG A;  1T4N A;  4KHP E;  1QU6 A;  1DI2 A;  1YZ9 A;  2UUA E;  1FJG E;  2CPN A;  3C4B A;  1STU A;  4JI8 E;  5LMU E;  4DV3 E;  2F4V E;  2VQF E;  2JVA A;  1J26 A;  4JI2 E;  4B3S E;  4JI0 E;  4LFB E;  2B7T A;  1T4L B;  1N34 E;  1XNQ E;  1WHQ A;  2YT4 A;  4DV1 E;  1X49 A;  1IBL E;  2RTX A;  2RS6 A;  4DR2 E;  2DMY A;  3T1Y E;  4JI4 E;  1HR0 E;  2LUP B;  4GKJ E;  4JYA E;  4WFT A;  4DUZ E;  4JV5 E;  2L2M A;  1N36 E;  2IHR 1;  1UIL A;  4JI6 E;  4X8W A;  2N3H A;  1HNW E;  4B3T E;  4YY3 E;  2UXB E;  4LF7 E;  4DR4 E;  4LF4 E; 
#chains in the Genus database with same CATH topology
 1ZR9 A;  4DR5 E;  2EN1 A;  2EQ0 A;  2H36 X;  2ENA A;  2CT1 A;  1KJK A;  3OML A;  5CFF E;  2DGC A;  3HTX A;  4DV6 E;  2G7H A;  2YTG A;  2JXP A;  1WXR A;  5DNY A;  2R1F A;  4KWY A;  2EJ4 A;  2EE8 A;  4TUI A;  1EKZ A;  2EOJ A;  1IQO A;  2D9H A;  2JWO A;  1UN6 B;  3AV0 A;  4X66 E;  3K6Q A;  2L2N A;  4M2Z A;  4DR6 E;  5IT9 C;  1A1G A;  2YTP A;  2E1M A;  4X64 E;  5IWA E;  4P78 A;  2M4I A;  1EH8 A;  1RQ0 A;  2VF1 A;  3AUZ A;  2Q8U A;  2EOH A;  3ECR A;  2VQE E;  4AQY E;  1T4O A;  2EMA A;  4R2Q A;  1SR9 A;  4IS1 C;  4DUY E;  4R03 A;  3ADJ A;  2YTD A;  2MDG A;  2L6M A;  3DF6 A;  2NAB A;  3OTO E;  1WJP A;  2LBS B;  2EOM A;  2EOX A;  3T1H E;  2UXD E;  4O43 A;  2CTD A;  2EM6 A;  2JY9 A;  2JR1 A;  1AAY A;  2E5L E;  2EPK X;  2V86 A;  2EM4 A;  1MEY C;  2UXC E;  2F8B A;  1PJQ A;  2EOY A;  2LJH A;  1A1L A;  2EMX A;  4X65 E;  4ZYH A;  1RC7 A;  3IWD A;  3P1X A;  4O24 A;  2EPC A;  5KL7 A;  2EPZ A;  2GHF A;  4JI3 E;  2JOX A;  2ELZ A;  1QU6 A;  2EN8 A;  1YZ9 A;  5KL5 A;  4BS9 A;  2EPX A;  2MKN A;  2YWQ A;  4JI8 E;  4DV3 E;  1WRJ A;  2EPL X;  4N4R B;  2VE7 C;  4B3S E;  2EM2 A;  1BBG A;  4P7D A;  1X6F A;  1WHQ A;  4F9A B;  4WXD A;  4F6N A;  2RTX A;  2EPR A;  3IWB A;  3EPK A;  2YSO A;  5AE2 A;  4JI4 E;  4JYA E;  4F2J C;  4KZS A;  4DUZ E;  2I13 A;  2IHR 1;  4JI6 E;  2VRD A;  4WXC A;  4IJD A;  4HEI A;  4BBY A;  3H09 A;  3JU0 A;  2EMC A;  4MLV A;  2EOE A;  1F2I G;  1X48 A;  4DV5 E;  3THO B;  3VYY A;  1IBM E;  1PKP A;  2YU5 A;  1AH5 A;  4L5N C;  1XMO E;  2YTO A;  1ZAA C;  2EWL A;  3IWC A;  2EOZ A;  1YPN A;  3DJW A;  2WBU A;  5KL2 A;  1YFH A;  2A25 A;  4DR1 E;  1YYO A;  1IQS A;  3J7Y p;  4DV0 E;  3C4T A;  4GKK E;  1X3C A;  2V88 A;  2NA2 A;  2K4V A;  2N3G A;  2RPC A;  5A6B A;  2JOB A;  4LTY A;  4LF8 E;  2NUE A;  1TF6 A;  2EMK A;  4HTG A;  3J80 C;  4F6M A;  1JK2 A;  1PJT A;  2V8Q B;  3BBG A;  2EM8 A;  2R76 A;  2EL6 A;  2V83 A;  2MKD A;  1NEI A;  3L00 A;  3F6G A;  2HHH E;  2L3C A;  4JI5 E;  2DMI A;  2EOQ A;  1GQE A;  2LRS A;  4X62 E;  2EPA A;  2YSP A;  1A1J A;  2LT7 A;  2DB2 A;  1O0W A;  3KZZ A;  5IXM B;  3KWR A;  2L3J A;  4DKK A;  3J7A G;  2EM7 A;  4Q28 A;  2YU8 A;  2ODR C;  2YTJ A;  3ADI A;  4OOG C;  4RHB B;  3LML A;  3TQM A;  2EM9 A;  1G2F C;  4NZV A;  5ADZ A;  2ELY A;  2EOF A;  4WSP A;  2ADR A;  1IMU A;  4BMJ A;  2V85 A;  4B3R E;  2B9D A;  1X47 A;  1DI2 A;  4R8O A;  2EPO A;  5KL3 A;  2VQF E;  2JVA A;  4LFB E;  2B7T A;  4J8Z A;  4BCA A;  2EMW A;  2YT4 A;  5AE1 A;  5KL4 A;  2RQL A;  2RS6 A;  4R2E A;  2EPP A;  1EH6 A;  2DMY A;  2K7I A;  3M99 B;  3BF2 A;  4GKJ E;  4Q35 B;  3BID A;  2ENH A;  1GZ6 A;  5TSE A;  1N36 E;  1QNT A;  2EOO A;  2HC5 A;  1UIL A;  1HNW E;  3HQ1 A;  5LL6 R;  4B3T E;  2WCC 3;  4LF7 E;  3FIG A;  4F9B B;  4O5G A;  1NCS A;  2YPN A;  5AC4 A;  2LE2 A;  2EMI A;  1XNR E;  1RMD A;  2NUG A;  2EMH A;  1DGC A;  3J81 C;  3HPZ A;  2EN7 A;  4DV2 E;  2B3T B;  3EPL A;  2EN2 A;  1SFE A;  2FGG A;  2WZO A;  1A1F A;  3ADL A;  1YYW A;  2EMG A;  1XMQ E;  4R2P A;  2EQ3 A;  2WBS A;  1IBK E;  2M1S A;  1KYQ A;  1HNZ E;  1X6E A;  2EN3 A;  3BGH A;  2LVH A;  2RS7 A;  1I94 E;  4R2S A;  4LF9 E;  2MDR A;  4ZYG A;  1J5E E;  2LCE A;  3UK3 C;  1YUJ A;  2E72 A;  4LFC E;  2N8X A;  2WBT A;  3QG5 C;  5T6J A;  3VYX A;  2LV2 A;  4LFA E;  4WPY A;  1N32 E;  2EML A;  2KOU A;  1X5W A;  1YYK A;  1WHN A;  1T38 A;  2BBG A;  4GZN C;  4WYQ B;  4NHR A;  3ZOQ B;  2YRH A;  4NXM E;  2YTE A;  1BBO A;  3EQ1 A;  1B69 A;  2EP3 A;  2KHX A;  5BR8 E;  2ZM6 E;  2M9A A;  4R2A A;  4DV4 E;  4LF5 E;  2LUQ A;  2DSY A;  2DLQ A;  1FKA E;  4DR7 E;  4I8O A;  4WSG A;  3JAM C;  1UHZ A;  2MC6 A;  3KZY A;  3LLH A;  2L33 A;  2DLK A;  4M0V A;  4JI7 E;  2EPU A;  2EPM X;  2FV4 B;  3ADG A;  1L4S A;  1T4N A;  4L8N A;  4KHP E;  3JTZ A;  2EM3 A;  1MGT A;  2UUA E;  4F54 A;  2CPN A;  1STU A;  1YUI A;  2EN6 A;  1J26 A;  3VHT B;  4R2R A;  4DMI A;  1N34 E;  4F9C B;  2GPI A;  5A69 A;  1X49 A;  2EMY A;  1IBL E;  2YTN A;  2JYA A;  2DRP A;  2EOR A;  5AAS A;  4RH8 A;  2LUP B;  2L8T A;  2EL4 A;  4WFT A;  4JV5 E;  2L2M A;  4MLQ A;  5A6B D;  2EPN A;  1A1H A;  1A1I A;  4X8W A;  4WX9 A;  4BHB A;  2EMB A;  1TN9 A;  2UXB E;  4DR4 E;  1EH7 A;  1P47 A;  3MSW A;  5LLQ A;  4BHC A;  4B3M E;  5KL6 A;  2HGH A;  5A2Q C;  2M7Q A;  2JP9 A;  2UU9 E;  4K0K E;  4FK5 C;  4R2C A;  2EM0 A;  2EOI A;  4DV7 E;  4OX9 E;  4GEQ B;  2YRK A;  1HNX E;  2UUC E;  2LTS A;  2KON A;  2V87 A;  4TUG A;  2EOS A;  4NXN E;  4BC9 A;  2YTQ A;  2LMZ A;  2DIX A;  3MHH C;  1DQ3 A;  2LTR A;  3EPJ A;  4R2D A;  2CSH A;  1TF3 A;  2I9I A;  4DR3 E;  2L2K B;  2B7V A;  2EQ1 A;  2GLI A;  1G2D C;  1N3G A;  4JI1 E;  5AE3 A;  5LMN E;  2LO3 A;  1LLM C;  5A6A A;  1PDA A;  2L92 A;  5FLX C;  4LF6 E;  4M30 A;  1BB8 A;  3HPS A;  1ZBT A;  4LU9 A;  2RSM A;  3F6H A;  3EPH A;  3C6K A;  5IV8 B;  1ZU1 A;  2LJU A;  4YHH E;  2EN4 A;  5F3W A;  2EM5 A;  1UBD C;  2J7J A;  2EL5 A;  2EMZ A;  2V89 A;  1N33 E;  2EMF A;  2ENC A;  3MHS C;  2UUB E;  1ZBQ A;  2EZ6 A;  1X6H A;  1PJS A;  4ZYE A;  3VK6 A;  2NUF A;  1T39 A;  2JPA A;  2YRM A;  2MC5 A;  2ODR D;  1FJG E;  3C4B A;  4BC7 A;  5LMU E;  2F4V E;  1JK1 A;  4JI2 E;  4JI0 E;  3THN A;  2RSI A;  1Z1B A;  1T4L B;  5A6K A;  1XNQ E;  4DV1 E;  2YZT A;  3RMP A;  4O4K A;  4DR2 E;  3T1Y E;  2PRT A;  1HR0 E;  4ZYD A;  2BB8 A;  2HJJ A;  1A1K A;  1YSA C;  2FTX B;  2N3H A;  5A6J A;  3HXL A;  5AC5 A;  4X9J A;  4YY3 E;  4LF4 E;  4M9V C;  2YTI A;  3C6M A;  2YTF A;  1GTK A; 
#chains in the Genus database with same CATH homology
 2UXD E;  2LE2 A;  4DR5 E;  2H36 X;  4B3M E;  1XNR E;  2NUG A;  5A2Q C;  1X48 A;  3OML A;  5CFF E;  3J81 C;  4DV5 E;  2M7Q A;  3VYY A;  3HTX A;  3HPZ A;  2UU9 E;  1IBM E;  1PKP A;  4DV2 E;  4L5N C;  2B3T B;  4K0K E;  1XMO E;  2FGG A;  2WZO A;  4DV6 E;  4DV7 E;  2G7H A;  4OX9 E;  3ADL A;  2EWL A;  3IWC A;  4GEQ B;  1YYW A;  3DJW A;  1HNX E;  1WXR A;  5DNY A;  1XMQ E;  4DR1 E;  2UUC E;  1YYO A;  1IBK E;  2LTS A;  2M1S A;  3J7Y p;  2KON A;  4DV0 E;  3C4T A;  4TUI A;  2V87 A;  1EKZ A;  1HNZ E;  4TUG A;  2RS7 A;  1I94 E;  4GKK E;  2JWO A;  2V88 A;  2NA2 A;  4NXN E;  4BC9 A;  2K4V A;  2N3G A;  2LMZ A;  2DIX A;  3AV0 A;  2MDR A;  4LF9 E;  1DQ3 A;  4X66 E;  3K6Q A;  2JOB A;  2L2N A;  4LTY A;  2LTR A;  1J5E E;  4LF8 E;  5IT9 C;  4M2Z A;  2NUE A;  4LFC E;  4DR6 E;  2E1M A;  3J80 C;  5T6J A;  3VYX A;  4X64 E;  5IWA E;  4P78 A;  2V8Q B;  2M4I A;  1RQ0 A;  2VF1 A;  3AUZ A;  2VQE E;  4LFA E;  4WPY A;  4AQY E;  1N32 E;  1T4O A;  2KOU A;  1YYK A;  1WHN A;  4DR3 E;  2L2K B;  2B7V A;  1SR9 A;  2V83 A;  4JI1 E;  5AE3 A;  5LMN E;  4DUY E;  4R03 A;  4WYQ B;  3F6G A;  3ADJ A;  2HHH E;  2L3C A;  2L6M A;  4JI5 E;  2L92 A;  3ZOQ B;  4NXM E;  3DF6 A;  5FLX C;  3OTO E;  4M30 A;  1GQE A;  2LRS A;  4X62 E;  4LF6 E;  2KHX A;  3HPS A;  1ZBT A;  2DB2 A;  1O0W A;  2RSM A;  3F6H A;  4LU9 A;  5BR8 E;  2ZM6 E;  4DV4 E;  3T1H E;  2LBS B;  3KWR A;  2LUQ A;  2L3J A;  4LF5 E;  4DKK A;  3J7A G;  2DSY A;  2JR1 A;  2JY9 A;  4YHH E;  2E5L E;  2V86 A;  4Q28 A;  1FKA E;  2ODR C;  5F3W A;  3ADI A;  4OOG C;  2UXC E;  2F8B A;  3LML A;  2LJH A;  2V89 A;  4X65 E;  5ADZ A;  4DR7 E;  4I8O A;  1N33 E;  3JAM C;  1UHZ A;  2MC6 A;  2UUB E;  1ZBQ A;  3IWD A;  3LLH A;  3P1X A;  2L33 A;  1RC7 A;  2EZ6 A;  4M0V A;  4WSP A;  4BMJ A;  4JI7 E;  2V85 A;  3VK6 A;  4B3R E;  2B9D A;  2FV4 B;  1X47 A;  3ADG A;  2NUF A;  1T4N A;  4L8N A;  4JI3 E;  3JTZ A;  4KHP E;  2JOX A;  1QU6 A;  1DI2 A;  1YZ9 A;  4R8O A;  2MC5 A;  2ODR D;  2UUA E;  4F54 A;  1FJG E;  2CPN A;  4BS9 A;  3C4B A;  1STU A;  4JI8 E;  4BC7 A;  5LMU E;  4DV3 E;  2F4V E;  2VQF E;  2JVA A;  1J26 A;  2VE7 C;  4JI2 E;  4B3S E;  4JI0 E;  4LFB E;  2B7T A;  4P7D A;  4J8Z A;  1T4L B;  4DMI A;  4BCA A;  1N34 E;  4F9C B;  1XNQ E;  1WHQ A;  2YT4 A;  4F9A B;  4DV1 E;  1X49 A;  2YZT A;  3RMP A;  1IBL E;  2RTX A;  5AE1 A;  3IWB A;  5AE2 A;  2RS6 A;  5AAS A;  4DR2 E;  2DMY A;  3T1Y E;  4JI4 E;  1HR0 E;  2LUP B;  2L8T A;  4GKJ E;  4JYA E;  4WFT A;  4KZS A;  1GZ6 A;  4DUZ E;  4JV5 E;  2L2M A;  1N36 E;  2IHR 1;  1UIL A;  4JI6 E;  2FTX B;  4X8W A;  2N3H A;  1HNW E;  3HQ1 A;  5LL6 R;  4B3T E;  3HXL A;  4BBY A;  3H09 A;  3JU0 A;  4YY3 E;  2UXB E;  4LF7 E;  3FIG A;  4DR4 E;  4LF4 E;  4F9B B;  3MSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...