2LRSA

The second dsrbd domain from a. thaliana dicer-like 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
NDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoribonuclease Dicer homolog 1
publication title Second Double-Stranded RNA Binding Domain of Dicer-like Ribonuclease 1: Structural and Biochemical Characterization.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 15
structure length 71
sequence length 71
ec nomenclature ec 3.1.26.-:
pdb deposition date 2012-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lrsA00
1UHZA 4DR1E 2N3HA 4DV6E 3J7Yp 4DKKA 1N32E 2DIXA 1T4OA 3VYYA 1N36E 4JI5E 1J26A 4YHHE 4DR4E 1N33E 4JI6E 2L33A 4OX9E 3ADGA 3ADLA 2MDRA 2LUPB 2NUGA 2F4VE 1J5EE 1YYOA 4JYAE 1DI2A 2L3CA 1WHNA 2DB2A 4OOGC 4NXME 2L2NA 2RSMA 5CFFE 2ZM6E 1T4LB 2UUCE 4JI0E 1STUA 2L2KB 4LFCE 2NUEA 1IBME 2LTSA 4DV1E 2NA2A 4LF6E 2VQEE 1PKPA 3VYXA 2VQFE 4DV4E 1HNWE 4JI7E 2EZ6A 2RS7A 2IHR1 3C4TA 4WYQB 1XMQE 1IBLE 4DV2E 4JI4E 4DR2E 3C4BA 1XNQE 2LUQA 2B7TA 2UU9E 4B3ME 2NUFA 2N3GA 4X65E 2JY9A 2RS6A 4JI8E 1FKAE 1T4NA 2UUBE 4GKKE 2L2MA 1O0WA 2KHXA 4DUYE 5BR8E 1IBKE 1YZ9A 3LLHA 3HTXA 4DV5E 4KHPE 5IWAE 4DR7E 4LF4E 1UILA 1HNZE 4LF8E 4LFBE 4DUZE 1XMOE 4JV5E 3T1YE 4DV0E 3OTOE 1ZBTA 2B3TB 1X49A 1HNXE 2HHHE 4B3SE 2E5LE 4DR3E 4LFAE 4B3TE 2LTRA 4AQYE 1YYKA 1WHQA 1EKZA 4X8WA 2JVAA 4DR6E 4M30A 1X48A 2DMYA 1I94E 2LBSB 4K0KE 2LJHA 2L3JA 4B3RE 4DV3E 4LF7E 2UUAE 1N34E 4X64E 4DV7E 2RTXA 2B7VA 3P1XA 4JI1E 1FJGE 1RQ0A 1YYWA 2UXDE 4JI3E 4X66E 2YT4A 2CPNA 4LF5E 2LRSA 4DR5E 4GKJE 1GQEA 4NXNE 1XNRE 1HR0E 3T1HE 1X47A 4X62E 4LF9E 4YY3E 4M2ZA 5LMUE 2UXBE 1QU6A 5LMNE 3ADIA 3ADJA 2UXCE 4WFTA 1RC7A 4JI2E
chains in the Genus database with same CATH superfamily
4WSGA 2YU8A 4ZYDA 3M99B 5AC4A 1AAYA 4DV6E 3J7Yp 2YTGA 1N32E 2DIXA 4WPYA 5A6JA 2EOZA 2YTQA 3VYYA 1N36E 4ZYEA 3JU0A 1A1IA 4BCAA 4KWYA 3KWRA 2V88A 4DR4E 2NABA 2B9DA 4O4KA 2MDRA 1UN6B 2NUGA 2EPLX 2EM6A 4JYAE 4RH8A 2EMHA 1WHNA 4OOGC 3MSWA 1SFEA 2EOMA 1A1LA 2L8TA 2UUCE 1ZBQA 2LVHA 4DV1E 1F2IG 2EN8A 4P7DA 4BC7A 4O5GA 4LF6E 2YTIA 2EPZA 2EPNA 4JI7E 2ODRD 4BBYA 2EL5A 1MEYC 1GZ6A 2V86A 4O43A 2ELYA 2FV4B 1AH5A 4P78A 1YSAC 5KL3A 4B3ME 4F9CB 1IQOA 2GLIA 2N3GA 1QNTA 2EORA 2JY9A 2ELZA 2HJJA 2LO3A 2UUBE 4GKKE 4DUYE 2YTPA 1YZ9A 1EH7A 3LLHA 2EQ3A 3HTXA 2MKNA 5IWAE 4LF4E 1BB8A 1BBOA 1UILA 4LF8E 1XMOE 2H36X 3T1YE 3UK3C 1PDAA 2B3TB 1HNXE 3OMLA 4B3SE 3LMLA 5DNYA 2EMAA 5KL5A 2LTRA 1TF3A 2EE8A 2VRDA 2WBTA 3JAMC 1WHQA 1N3GA 4X8WA 3THNA 4M30A 3F6GA 4ZYGA 1G2FC 4K0KE 4B3RE 2EM0A 4HTGA 3EPLA 4DV7E 3BBGA 2DRPA 1FJGE 2EM3A 4R2AA 2VF1A 2EJ4A 4LF5E 2JP9A 4Q35B 4GEQB 2DLQA 2EOOA 5LMUE 4BS9A 5IXMB 1IQSA 2EWLA 2UXCE 2BBGA 2JOXA 1RC7A 2EOFA 1LLMC 2A25A 1T4OA 2YZTA 1N33E 4WX9A 2GPIA 2L33A 2EPRA 3ADGA 4OX9E 4R2PA 5T6JA 4F6NA 1DGCA 4M0VA 2WBSA 2EPAA 2L3CA 2DB2A 2LMZA 3J81C 4NXME 2L2NA 2EN3A 2RSMA 5LL6R 5CFFE 4IS1C 2ENAA 3VHTB 1KJKA 1WRJA 2YPNA 2PRTA 1IMUA 2EPCA 3TQMA 2G7HA 5A6AA 2EPKX 2NUEA 3ECRA 1IBME 3HPSA 4GZNC 2NA2A 2YSOA 2VQEE 3L00A 3VYXA 4DV4E 2V8QB 2K7IA 1HNWE 2EZ6A 2LCEA 2FTXB 2IHR1 3C4TA 1YUJA 1A1GA 4WYQB 1XMQE 1WJPA 1GTKA 4R8OA 4JI4E 2EN6A 3H09A 2EMCA 2M7QA 2NUFA 4HEIA 4X65E 2EPXA 1NEIA 1T4NA 1RMDA 1O0WA 2Q8UA 4WXDA 4MLQA 4M9VC 2EMIA 5A6BD 4MLVA 5KL6A 2EMZA 2DGCA 2HHHE 4F9AB 2EOYA 4DR3E 2EQ0A 2L6MA 2EMFA 2LJUA 4LFAE 2YTNA 2EN7A 5AE1A 2EMXA 2EOXA 2LT7A 1JK1A 4BMJA 4X9JA 1I94E 1WXRA 2EOSA 2LJHA 1PJQA 4DV3E 4LF7E 2EPUA 2UUAE 1N34E 2EM8A 2B7VA 3P1XA 4JI1E 4JI3E 2YT4A 1Z1BA 4R2QA 2EMGA 4GKJE 1YUIA 1GQEA 1XNRE 1HR0E 4R2CA 4DMIA 2E72A 4LF9E 2YSPA 2V89A 3VK6A 5IT9C 3ADJA 2ENCA 4Q28A 4JI2E 4DR1E 2N3HA 2I13A 3ZOQB 4JI5E 1J26A 3THOB 1DQ3A 1X6EA 2YTEA 4JI6E 3ADLA 2YWQA 2LUPB 1J5EE 4IJDA 3F6HA 2RQLA 4TUGA 3IWDA 1DI2A 3BF2A 1SR9A 4RHBB 4JI0E 2L2KB 4NHRA 2EMKA 4R2EA 1TN9A 2LTSA 3BGHA 2R1FA 2MC5A 2EM5A 1PKPA 4WSPA 5A69A 2J7JA 5FLXC 4F6MA 1A1HA 2EPOA 2JWOA 1ZR9A 2EP3A 3BIDA 4LU9A 2ENHA 3J7AG 4DR2E 1L4SA 2ADRA 2YRMA 2B7TA 4KZSA 2JXPA 2RS6A 3J80C 4JI8E 5AE3A 1EH8A 2L2MA 2KHXA 2HC5A 3AV0A 1IBKE 1KYQA 2WBUA 4F9BB 2CTDA 4DR7E 2N8XA 1X6HA 3KZZA 1HNZE 5AE2A 4LFBE 4JV5E 4DV0E 5ADZA 3EPKA 1X49A 2EM4A 3HXLA 4TUIA 2E5LE 2JOBA 4R2SA 4B3TE 2BB8A 2FGGA 4N4RB 2JPAA 1YYKA 1EKZA 2EOIA 1A1JA 2JVAA 3RMPA 4DR6E 3HQ1A 2EMLA 2YRHA 2JYAA 1T38A 1YPNA 2DMYA 2LBSB 2L3JA 3MHSC 3DJWA 4X64E 3KZYA 1PJTA 2EMWA 2UXDE 1RQ0A 2MDGA 4L5NC 2EOEA 1BBGA 4J8ZA 4DR5E 2DMIA 2E1MA 2GHFA 1UBDC 1NCSA 4FK5C 1A1KA 1MGTA 3AUZA 3T1HE 1X3CA 1B69A 2EL4A 2EOHA 5LLQA 5A6BA 3MHHC 1ZAAC 2UXBE 5TSEA 2EN2A 1QU6A 5LMNE 2EQ1A 2EMYA 4ZYHA 2EM7A 1UHZA 5A2QC 2VE7C 2M1SA 2YTOA 2YRKA 4DKKA 2YTJA 4YHHE 5KL7A 2LE2A 2M4IA 2F4VE 3DF6A 3HPZA 2D9HA 1YYOA 2L92A 2EM9A 2DLKA 3EQ1A 2EPPA 3JTZA 1YFHA 1X6FA 4WXCA 2ZM6E 3C6KA 3QG5C 2CT1A 2EL6A 1T4LB 2MC6A 4O24A 1STUA 4LFCE 3K6QA 1EH6A 1G2DC 2RSIA 4LTYA 2EPMX 2MKDA 2VQFE 2V87A 2V83A 2RS7A 2YTDA 3EPHA 1IBLE 3IWCA 4DV2E 1P47A 2I9IA 3C4BA 4R03A 1XNQE 2EOQA 2LUQA 2WZOA 2UU9E 2EN1A 4L8NA 3C6MA 2K4VA 2WCC3 2CSHA 1FKAE 5KL4A 4R2RA 5BR8E 1JK2A 2R76A 1ZU1A 4DV5E 4KHPE 2KONA 4DUZE 4BHBA 5AASA 2KOUA 3OTOE 1ZBTA 3FIGA 5KL2A 1TF6A 2HGHA 4BC9A 2EM2A 4AQYE 2ODRC 1T39A 4BHCA 2F8BA 2RPCA 1X48A 5A6KA 1PJSA 2EN4A 5IV8B 2RTXA 2JR1A 2DSYA 4F2JC 1YYWA 4X66E 5F3WA 4R2DA 2YU5A 1A1FA 4I8OA 3EPJA 2CPNA 2LRSA 2M9AA 1X5WA 3IWBA 4NXNE 2EMBA 1X47A 4X62E 4YY3E 4M2ZA 4F54A 3ADIA 4NZVA 5AC5A 2EOJA 4WFTA 2LV2A 2YTFA 2V85A
chains in the Genus database with same CATH topology
1UHZA 5A2QC 2VE7C 4DR1E 2M1SA 2N3HA 4DV6E 3J7Yp 4DKKA 1N32E 2DIXA 4WPYA 3ZOQB 1T4OA 3VYYA 1N36E 4JI5E 1J26A 3JU0A 2YZTA 4BCAA 4YHHE 1DQ3A 3KWRA 2V88A 4DR4E 1N33E 4JI6E 2L33A 2B9DA 2LE2A 3ADGA 4OX9E 2M4IA 2MDRA 3ADLA 2LUPB 2NUGA 5T6JA 2F4VE 3DF6A 1J5EE 3HPZA 4M0VA 3F6HA 4TUGA 2L92A 1YYOA 4JYAE 3IWDA 1DI2A 2L3CA 1WHNA 2DB2A 2LMZA 4OOGC 3MSWA 3J81C 4NXME 2L2NA 3JTZA 2RSMA 5LL6R 5CFFE 2ZM6E 1SR9A 2L8TA 1T4LB 2MC6A 2UUCE 4JI0E 1STUA 2V85A 2L2KB 4LFCE 2G7HA 2NUEA 1ZBQA 1IBME 3HPSA 2LTSA 4DV1E 2NA2A 4P7DA 4LF6E 4BC7A 3K6QA 2MC5A 2VQEE 1PKPA 4LTYA 4WSPA 3VYXA 2VQFE 2V8QB 4DV4E 1HNWE 4JI7E 2EZ6A 2V87A 2V83A 5FLXC 2FTXB 2RS7A 2ODRD 2IHR1 3C4TA 4BBYA 2JWOA 4WYQB 1XMQE 1GZ6A 2V86A 3IWCA 4LU9A 1IBLE 4R8OA 4DV2E 2FV4B 4JI4E 3J7AG 4DR2E 3C4BA 4R03A 1XNQE 2LUQA 4P78A 2B7TA 2WZOA 2UU9E 3H09A 4L8NA 4F9CB 2K4VA 2M7QA 4B3ME 4KZSA 2NUFA 2N3GA 4X65E 2JY9A 2RS6A 3J80C 4JI8E 1FKAE 5AE3A 1T4NA 2UUBE 4GKKE 2L2MA 1O0WA 2KHXA 4DUYE 3AV0A 5BR8E 1IBKE 1YZ9A 3LLHA 4F9BB 3HTXA 4DV5E 4JI2E 4KHPE 5IWAE 4DR7E 2KONA 4LF4E 1UILA 1HNZE 5AE2A 4LF8E 4LFBE 4DUZE 1XMOE 5AASA 4JV5E 2H36X 3T1YE 2KOUA 4DV0E 3OTOE 1ZBTA 5ADZA 2B3TB 1X49A 3FIGA 3HXLA 3OMLA 4TUIA 1HNXE 2HHHE 4B3SE 4F9AB 2E5LE 4DR3E 2L6MA 2JOBA 3LMLA 5DNYA 4B3TE 2LTRA 2FGGA 4BC9A 4AQYE 2ODRC 4LFAE 5AE1A 3JAMC 1YYKA 2F8BA 1WHQA 1EKZA 4X8WA 2JVAA 3RMPA 4DR6E 3HQ1A 4M30A 4BMJA 1X48A 3F6GA 2DMYA 1I94E 2LBSB 1RC7A 4K0KE 1WXRA 2LJHA 2L3JA 4B3RE 4DV3E 4LF7E 2UUAE 3DJWA 1N34E 4X64E 4DV7E 2RTXA 2JR1A 2B7VA 2DSYA 3P1XA 4JI1E 1RQ0A 4L5NC 1FJGE 2VF1A 1YYWA 2UXDE 4JI3E 4X66E 5F3WA 2YT4A 4I8OA 2CPNA 4LF5E 2LRSA 4J8ZA 4DR5E 2E1MA 4GKJE 3IWBA 1GQEA 4GEQB 4NXNE 1XNRE 1HR0E 3AUZA 3T1HE 1X47A 4X62E 4DMIA 4LF9E 4YY3E 4M2ZA 5LMUE 2UXBE 4BS9A 2V89A 3VK6A 5IT9C 1QU6A 5LMNE 4F54A 3ADIA 3ADJA 2EWLA 2UXCE 4WFTA 2JOXA 4Q28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHZ A;  4DR1 E;  2N3H A;  4DV6 E;  3J7Y p;  4DKK A;  1N32 E;  2DIX A;  1T4O A;  3VYY A;  1N36 E;  4JI5 E;  1J26 A;  4YHH E;  4DR4 E;  1N33 E;  4JI6 E;  2L33 A;  4OX9 E;  3ADG A;  3ADL A;  2MDR A;  2LUP B;  2NUG A;  2F4V E;  1J5E E;  1YYO A;  4JYA E;  1DI2 A;  2L3C A;  1WHN A;  2DB2 A;  4OOG C;  4NXM E;  2L2N A;  2RSM A;  5CFF E;  2ZM6 E;  1T4L B;  2UUC E;  4JI0 E;  1STU A;  2L2K B;  4LFC E;  2NUE A;  1IBM E;  2LTS A;  4DV1 E;  2NA2 A;  4LF6 E;  2VQE E;  1PKP A;  3VYX A;  2VQF E;  4DV4 E;  1HNW E;  4JI7 E;  2EZ6 A;  2RS7 A;  2IHR 1;  3C4T A;  4WYQ B;  1XMQ E;  1IBL E;  4DV2 E;  4JI4 E;  4DR2 E;  3C4B A;  1XNQ E;  2LUQ A;  2B7T A;  2UU9 E;  4B3M E;  2NUF A;  2N3G A;  4X65 E;  2JY9 A;  2RS6 A;  4JI8 E;  1FKA E;  1T4N A;  2UUB E;  4GKK E;  2L2M A;  1O0W A;  2KHX A;  4DUY E;  5BR8 E;  1IBK E;  1YZ9 A;  3LLH A;  3HTX A;  4DV5 E;  4KHP E;  5IWA E;  4DR7 E;  4LF4 E;  1UIL A;  1HNZ E;  4LF8 E;  4LFB E;  4DUZ E;  1XMO E;  4JV5 E;  3T1Y E;  4DV0 E;  3OTO E;  1ZBT A;  2B3T B;  1X49 A;  1HNX E;  2HHH E;  4B3S E;  2E5L E;  4DR3 E;  4LFA E;  4B3T E;  2LTR A;  4AQY E;  1YYK A;  1WHQ A;  1EKZ A;  4X8W A;  2JVA A;  4DR6 E;  4M30 A;  1X48 A;  2DMY A;  1I94 E;  2LBS B;  4K0K E;  2LJH A;  2L3J A;  4B3R E;  4DV3 E;  4LF7 E;  2UUA E;  1N34 E;  4X64 E;  4DV7 E;  2RTX A;  2B7V A;  3P1X A;  4JI1 E;  1FJG E;  1RQ0 A;  1YYW A;  2UXD E;  4JI3 E;  4X66 E;  2YT4 A;  2CPN A;  4LF5 E;  2LRS A;  4DR5 E;  4GKJ E;  1GQE A;  4NXN E;  1XNR E;  1HR0 E;  3T1H E;  1X47 A;  4X62 E;  4LF9 E;  4YY3 E;  4M2Z A;  5LMU E;  2UXB E;  1QU6 A;  5LMN E;  3ADI A;  3ADJ A;  2UXC E;  4WFT A;  1RC7 A;  4JI2 E; 
#chains in the Genus database with same CATH topology
 4WSG A;  2YU8 A;  4ZYD A;  3M99 B;  5AC4 A;  1AAY A;  4DV6 E;  3J7Y p;  2YTG A;  1N32 E;  2DIX A;  4WPY A;  5A6J A;  2EOZ A;  2YTQ A;  3VYY A;  1N36 E;  4ZYE A;  3JU0 A;  1A1I A;  4BCA A;  4KWY A;  3KWR A;  2V88 A;  4DR4 E;  2NAB A;  2B9D A;  4O4K A;  2MDR A;  1UN6 B;  2NUG A;  2EPL X;  2EM6 A;  4JYA E;  4RH8 A;  2EMH A;  1WHN A;  4OOG C;  3MSW A;  1SFE A;  2EOM A;  1A1L A;  2L8T A;  2UUC E;  1ZBQ A;  2LVH A;  4DV1 E;  1F2I G;  2EN8 A;  4P7D A;  4BC7 A;  4O5G A;  4LF6 E;  2YTI A;  2EPZ A;  2EPN A;  4JI7 E;  2ODR D;  4BBY A;  2EL5 A;  1MEY C;  1GZ6 A;  2V86 A;  4O43 A;  2ELY A;  2FV4 B;  1AH5 A;  4P78 A;  1YSA C;  5KL3 A;  4B3M E;  4F9C B;  1IQO A;  2GLI A;  2N3G A;  1QNT A;  2EOR A;  2JY9 A;  2ELZ A;  2HJJ A;  2LO3 A;  2UUB E;  4GKK E;  4DUY E;  2YTP A;  1YZ9 A;  1EH7 A;  3LLH A;  2EQ3 A;  3HTX A;  2MKN A;  5IWA E;  4LF4 E;  1BB8 A;  1BBO A;  1UIL A;  4LF8 E;  1XMO E;  2H36 X;  3T1Y E;  3UK3 C;  1PDA A;  2B3T B;  1HNX E;  3OML A;  4B3S E;  3LML A;  5DNY A;  2EMA A;  5KL5 A;  2LTR A;  1TF3 A;  2EE8 A;  2VRD A;  2WBT A;  3JAM C;  1WHQ A;  1N3G A;  4X8W A;  3THN A;  4M30 A;  3F6G A;  4ZYG A;  1G2F C;  4K0K E;  4B3R E;  2EM0 A;  4HTG A;  3EPL A;  4DV7 E;  3BBG A;  2DRP A;  1FJG E;  2EM3 A;  4R2A A;  2VF1 A;  2EJ4 A;  4LF5 E;  2JP9 A;  4Q35 B;  4GEQ B;  2DLQ A;  2EOO A;  5LMU E;  4BS9 A;  5IXM B;  1IQS A;  2EWL A;  2UXC E;  2BBG A;  2JOX A;  1RC7 A;  2EOF A;  1LLM C;  2A25 A;  1T4O A;  2YZT A;  1N33 E;  4WX9 A;  2GPI A;  2L33 A;  2EPR A;  3ADG A;  4OX9 E;  4R2P A;  5T6J A;  4F6N A;  1DGC A;  4M0V A;  2WBS A;  2EPA A;  2L3C A;  2DB2 A;  2LMZ A;  3J81 C;  4NXM E;  2L2N A;  2EN3 A;  2RSM A;  5LL6 R;  5CFF E;  4IS1 C;  2ENA A;  3VHT B;  1KJK A;  1WRJ A;  2YPN A;  2PRT A;  1IMU A;  2EPC A;  3TQM A;  2G7H A;  5A6A A;  2EPK X;  2NUE A;  3ECR A;  1IBM E;  3HPS A;  4GZN C;  2NA2 A;  2YSO A;  2VQE E;  3L00 A;  3VYX A;  4DV4 E;  2V8Q B;  2K7I A;  1HNW E;  2EZ6 A;  2LCE A;  2FTX B;  2IHR 1;  3C4T A;  1YUJ A;  1A1G A;  4WYQ B;  1XMQ E;  1WJP A;  1GTK A;  4R8O A;  4JI4 E;  2EN6 A;  3H09 A;  2EMC A;  2M7Q A;  2NUF A;  4HEI A;  4X65 E;  2EPX A;  1NEI A;  1T4N A;  1RMD A;  1O0W A;  2Q8U A;  4WXD A;  4MLQ A;  4M9V C;  2EMI A;  5A6B D;  4MLV A;  5KL6 A;  2EMZ A;  2DGC A;  2HHH E;  4F9A B;  2EOY A;  4DR3 E;  2EQ0 A;  2L6M A;  2EMF A;  2LJU A;  4LFA E;  2YTN A;  2EN7 A;  5AE1 A;  2EMX A;  2EOX A;  2LT7 A;  1JK1 A;  4BMJ A;  4X9J A;  1I94 E;  1WXR A;  2EOS A;  2LJH A;  1PJQ A;  4DV3 E;  4LF7 E;  2EPU A;  2UUA E;  1N34 E;  2EM8 A;  2B7V A;  3P1X A;  4JI1 E;  4JI3 E;  2YT4 A;  1Z1B A;  4R2Q A;  2EMG A;  4GKJ E;  1YUI A;  1GQE A;  1XNR E;  1HR0 E;  4R2C A;  4DMI A;  2E72 A;  4LF9 E;  2YSP A;  2V89 A;  3VK6 A;  5IT9 C;  3ADJ A;  2ENC A;  4Q28 A;  4JI2 E;  4DR1 E;  2N3H A;  2I13 A;  3ZOQ B;  4JI5 E;  1J26 A;  3THO B;  1DQ3 A;  1X6E A;  2YTE A;  4JI6 E;  3ADL A;  2YWQ A;  2LUP B;  1J5E E;  4IJD A;  3F6H A;  2RQL A;  4TUG A;  3IWD A;  1DI2 A;  3BF2 A;  1SR9 A;  4RHB B;  4JI0 E;  2L2K B;  4NHR A;  2EMK A;  4R2E A;  1TN9 A;  2LTS A;  3BGH A;  2R1F A;  2MC5 A;  2EM5 A;  1PKP A;  4WSP A;  5A69 A;  2J7J A;  5FLX C;  4F6M A;  1A1H A;  2EPO A;  2JWO A;  1ZR9 A;  2EP3 A;  3BID A;  4LU9 A;  2ENH A;  3J7A G;  4DR2 E;  1L4S A;  2ADR A;  2YRM A;  2B7T A;  4KZS A;  2JXP A;  2RS6 A;  3J80 C;  4JI8 E;  5AE3 A;  1EH8 A;  2L2M A;  2KHX A;  2HC5 A;  3AV0 A;  1IBK E;  1KYQ A;  2WBU A;  4F9B B;  2CTD A;  4DR7 E;  2N8X A;  1X6H A;  3KZZ A;  1HNZ E;  5AE2 A;  4LFB E;  4JV5 E;  4DV0 E;  5ADZ A;  3EPK A;  1X49 A;  2EM4 A;  3HXL A;  4TUI A;  2E5L E;  2JOB A;  4R2S A;  4B3T E;  2BB8 A;  2FGG A;  4N4R B;  2JPA A;  1YYK A;  1EKZ A;  2EOI A;  1A1J A;  2JVA A;  3RMP A;  4DR6 E;  3HQ1 A;  2EML A;  2YRH A;  2JYA A;  1T38 A;  1YPN A;  2DMY A;  2LBS B;  2L3J A;  3MHS C;  3DJW A;  4X64 E;  3KZY A;  1PJT A;  2EMW A;  2UXD E;  1RQ0 A;  2MDG A;  4L5N C;  2EOE A;  1BBG A;  4J8Z A;  4DR5 E;  2DMI A;  2E1M A;  2GHF A;  1UBD C;  1NCS A;  4FK5 C;  1A1K A;  1MGT A;  3AUZ A;  3T1H E;  1X3C A;  1B69 A;  2EL4 A;  2EOH A;  5LLQ A;  5A6B A;  3MHH C;  1ZAA C;  2UXB E;  5TSE A;  2EN2 A;  1QU6 A;  5LMN E;  2EQ1 A;  2EMY A;  4ZYH A;  2EM7 A;  1UHZ A;  5A2Q C;  2VE7 C;  2M1S A;  2YTO A;  2YRK A;  4DKK A;  2YTJ A;  4YHH E;  5KL7 A;  2LE2 A;  2M4I A;  2F4V E;  3DF6 A;  3HPZ A;  2D9H A;  1YYO A;  2L92 A;  2EM9 A;  2DLK A;  3EQ1 A;  2EPP A;  3JTZ A;  1YFH A;  1X6F A;  4WXC A;  2ZM6 E;  3C6K A;  3QG5 C;  2CT1 A;  2EL6 A;  1T4L B;  2MC6 A;  4O24 A;  1STU A;  4LFC E;  3K6Q A;  1EH6 A;  1G2D C;  2RSI A;  4LTY A;  2EPM X;  2MKD A;  2VQF E;  2V87 A;  2V83 A;  2RS7 A;  2YTD A;  3EPH A;  1IBL E;  3IWC A;  4DV2 E;  1P47 A;  2I9I A;  3C4B A;  4R03 A;  1XNQ E;  2EOQ A;  2LUQ A;  2WZO A;  2UU9 E;  2EN1 A;  4L8N A;  3C6M A;  2K4V A;  2WCC 3;  2CSH A;  1FKA E;  5KL4 A;  4R2R A;  5BR8 E;  1JK2 A;  2R76 A;  1ZU1 A;  4DV5 E;  4KHP E;  2KON A;  4DUZ E;  4BHB A;  5AAS A;  2KOU A;  3OTO E;  1ZBT A;  3FIG A;  5KL2 A;  1TF6 A;  2HGH A;  4BC9 A;  2EM2 A;  4AQY E;  2ODR C;  1T39 A;  4BHC A;  2F8B A;  2RPC A;  1X48 A;  5A6K A;  1PJS A;  2EN4 A;  5IV8 B;  2RTX A;  2JR1 A;  2DSY A;  4F2J C;  1YYW A;  4X66 E;  5F3W A;  4R2D A;  2YU5 A;  1A1F A;  4I8O A;  3EPJ A;  2CPN A;  2LRS A;  2M9A A;  1X5W A;  3IWB A;  4NXN E;  2EMB A;  1X47 A;  4X62 E;  4YY3 E;  4M2Z A;  4F54 A;  3ADI A;  4NZV A;  5AC5 A;  2EOJ A;  4WFT A;  2LV2 A;  2YTF A;  2V85 A; 
#chains in the Genus database with same CATH homology
 1UHZ A;  5A2Q C;  2VE7 C;  4DR1 E;  2M1S A;  2N3H A;  4DV6 E;  3J7Y p;  4DKK A;  1N32 E;  2DIX A;  4WPY A;  3ZOQ B;  1T4O A;  3VYY A;  1N36 E;  4JI5 E;  1J26 A;  3JU0 A;  2YZT A;  4BCA A;  4YHH E;  1DQ3 A;  3KWR A;  2V88 A;  4DR4 E;  1N33 E;  4JI6 E;  2L33 A;  2B9D A;  2LE2 A;  3ADG A;  4OX9 E;  2M4I A;  2MDR A;  3ADL A;  2LUP B;  2NUG A;  5T6J A;  2F4V E;  3DF6 A;  1J5E E;  3HPZ A;  4M0V A;  3F6H A;  4TUG A;  2L92 A;  1YYO A;  4JYA E;  3IWD A;  1DI2 A;  2L3C A;  1WHN A;  2DB2 A;  2LMZ A;  4OOG C;  3MSW A;  3J81 C;  4NXM E;  2L2N A;  3JTZ A;  2RSM A;  5LL6 R;  5CFF E;  2ZM6 E;  1SR9 A;  2L8T A;  1T4L B;  2MC6 A;  2UUC E;  4JI0 E;  1STU A;  2V85 A;  2L2K B;  4LFC E;  2G7H A;  2NUE A;  1ZBQ A;  1IBM E;  3HPS A;  2LTS A;  4DV1 E;  2NA2 A;  4P7D A;  4LF6 E;  4BC7 A;  3K6Q A;  2MC5 A;  2VQE E;  1PKP A;  4LTY A;  4WSP A;  3VYX A;  2VQF E;  2V8Q B;  4DV4 E;  1HNW E;  4JI7 E;  2EZ6 A;  2V87 A;  2V83 A;  5FLX C;  2FTX B;  2RS7 A;  2ODR D;  2IHR 1;  3C4T A;  4BBY A;  2JWO A;  4WYQ B;  1XMQ E;  1GZ6 A;  2V86 A;  3IWC A;  4LU9 A;  1IBL E;  4R8O A;  4DV2 E;  2FV4 B;  4JI4 E;  3J7A G;  4DR2 E;  3C4B A;  4R03 A;  1XNQ E;  2LUQ A;  4P78 A;  2B7T A;  2WZO A;  2UU9 E;  3H09 A;  4L8N A;  4F9C B;  2K4V A;  2M7Q A;  4B3M E;  4KZS A;  2NUF A;  2N3G A;  4X65 E;  2JY9 A;  2RS6 A;  3J80 C;  4JI8 E;  1FKA E;  5AE3 A;  1T4N A;  2UUB E;  4GKK E;  2L2M A;  1O0W A;  2KHX A;  4DUY E;  3AV0 A;  5BR8 E;  1IBK E;  1YZ9 A;  3LLH A;  4F9B B;  3HTX A;  4DV5 E;  4JI2 E;  4KHP E;  5IWA E;  4DR7 E;  2KON A;  4LF4 E;  1UIL A;  1HNZ E;  5AE2 A;  4LF8 E;  4LFB E;  4DUZ E;  1XMO E;  5AAS A;  4JV5 E;  2H36 X;  3T1Y E;  2KOU A;  4DV0 E;  3OTO E;  1ZBT A;  5ADZ A;  2B3T B;  1X49 A;  3FIG A;  3HXL A;  3OML A;  4TUI A;  1HNX E;  2HHH E;  4B3S E;  4F9A B;  2E5L E;  4DR3 E;  2L6M A;  2JOB A;  3LML A;  5DNY A;  4B3T E;  2LTR A;  2FGG A;  4BC9 A;  4AQY E;  2ODR C;  4LFA E;  5AE1 A;  3JAM C;  1YYK A;  2F8B A;  1WHQ A;  1EKZ A;  4X8W A;  2JVA A;  3RMP A;  4DR6 E;  3HQ1 A;  4M30 A;  4BMJ A;  1X48 A;  3F6G A;  2DMY A;  1I94 E;  2LBS B;  1RC7 A;  4K0K E;  1WXR A;  2LJH A;  2L3J A;  4B3R E;  4DV3 E;  4LF7 E;  2UUA E;  3DJW A;  1N34 E;  4X64 E;  4DV7 E;  2RTX A;  2JR1 A;  2B7V A;  2DSY A;  3P1X A;  4JI1 E;  1RQ0 A;  4L5N C;  1FJG E;  2VF1 A;  1YYW A;  2UXD E;  4JI3 E;  4X66 E;  5F3W A;  2YT4 A;  4I8O A;  2CPN A;  4LF5 E;  2LRS A;  4J8Z A;  4DR5 E;  2E1M A;  4GKJ E;  3IWB A;  1GQE A;  4GEQ B;  4NXN E;  1XNR E;  1HR0 E;  3AUZ A;  3T1H E;  1X47 A;  4X62 E;  4DMI A;  4LF9 E;  4YY3 E;  4M2Z A;  5LMU E;  2UXB E;  4BS9 A;  2V89 A;  3VK6 A;  5IT9 C;  1QU6 A;  5LMN E;  4F54 A;  3ADI A;  3ADJ A;  2EWL A;  2UXC E;  4WFT A;  2JOX A;  4Q28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...