2LRSA

The second dsrbd domain from a. thaliana dicer-like 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
NDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease Dicer homolog 1
publication title Second Double-Stranded RNA Binding Domain of Dicer-like Ribonuclease 1: Structural and Biochemical Characterization.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 15
structure length 71
sequence length 71
ec nomenclature ec 3.1.26.-:
pdb deposition date 2012-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lrsA00
4DR4E 2LJHA 4X65E 4YY3E 2LUQA 2KHXA 4DR2E 2CPNA 4AQYE 3T1YE 2DMYA 5LMUE 1YYKA 4B3TE 1DI2A 2L33A 1X47A 2NA2A 4JV5E 1UHZA 2B3TB 4GKJE 4LF5E 2RS6A 4GKKE 2DIXA 4DUYE 1FJGE 5LMNE 4LFBE 2L2KB 1T4LB 4X62E 3ADIA 2VQFE 4DUZE 2L2MA 4JI1E 2UUAE 1WHQA 3ADGA 4JI2E 1IBLE 1XMQE 2E5LE 2B7VA 3J7Yp 2B7TA 4JI6E 4DR3E 1PKPA 4YHHE 2LUPB 1N33E 4JI5E 1X48A 2RSMA 4DV0E 4DR5E 1N34E 1HNXE 2L2NA 2LBSB 1WHNA 1IBME 2UXBE 1IBKE 4DR1E 4DKKA 1GQEA 2L3CA 1J5EE 4M30A 1QU6A 2NUEA 1ZBTA 4DR7E 1T4NA 4NXME 4DV7E 5BR8E 4DV6E 1UILA 4LF4E 1RC7A 4OOGC 4B3ME 4LF7E 4M2ZA 2NUGA 4OX9E 4B3RE 4DV5E 3C4BA 3P1XA 2RTXA 4WFTA 2RS7A 2LTRA 5IWAE 1EKZA 1YYWA 1J26A 3VYXA 1RQ0A 2DB2A 4JI3E 4JYAE 3HTXA 4X66E 3T1HE 2UXCE 1XNRE 2IHR1 3C4TA 2L3JA 1YYOA 4JI4E 1HNWE 4B3SE 4JI0E 3OTOE 2UU9E 2VQEE 1N36E 1T4OA 1X49A 5CFFE 1O0WA 2HHHE 4NXNE 2NUFA 2JVAA 1XMOE 3ADJA 2EZ6A 2UUBE 2UUCE 1N32E 4LFCE 2UXDE 1HR0E 1XNQE 4KHPE 4WYQB 4DV4E 4X8WA 1I94E 4LF6E 4X64E 4JI8E 2LTSA 1YZ9A 4DV1E 2JY9A 1FKAE 4DR6E 4LF9E 2YT4A 2MDRA 2N3GA 4LFAE 3ADLA 4DV3E 4DV2E 2ZM6E 2F4VE 3LLHA 4K0KE 3VYYA 1STUA 1HNZE 2N3HA 4JI7E 4LF8E 2LRSA
chains in the Genus database with same CATH superfamily
1A1JA 2EL5A 4YY3E 2EPRA 2DMYA 5LMUE 2EM4A 1DI2A 2EN7A 1UHZA 1AH5A 4M0VA 2V83A 3THOB 4F9CB 4LF5E 2RQLA 1YPNA 2N8XA 4R2DA 1X5WA 4DUYE 2WBSA 1FJGE 2LE2A 4R2EA 2L2KB 1T4LB 5KL4A 2YTFA 2ADRA 2L2MA 5AE2A 2EOOA 1WHQA 3ADGA 5AC4A 5F3WA 2GPIA 2YTNA 2B7VA 2EPAA 4WXDA 4DR3E 2V87A 1A1KA 3C6MA 1N33E 1X48A 1X6EA 4DR5E 2EM0A 2LBSB 1A1HA 4Q28A 1WHNA 2BB8A 4NZVA 3IWCA 1SFEA 1IBME 4L8NA 2EMXA 4BMJA 4DR1E 1DGCA 5A6BD 2YRMA 3JU0A 4F6MA 2EOEA 4DV7E 5KL3A 4WPYA 2EQ0A 2F8BA 2JP9A 2WBTA 2EMAA 1MEYC 2KONA 1EKZA 3HXLA 4BHCA 1T39A 2EMGA 4JYAE 3HTXA 3KWRA 2IHR1 4R2QA 4R2AA 3MSWA 2EM3A 3JTZA 1YYOA 1YUIA 4P78A 2EMIA 1HNWE 4JI0E 3OTOE 5AE3A 2YRHA 1NEIA 4F2JC 3IWDA 5CFFE 2A25A 4NXNE 2FGGA 2JVAA 5A69A 2UUBE 2UUCE 4F6NA 2ELZA 2EOIA 1N32E 1PJQA 5IXMB 2V86A 4M9VC 2HJJA 5IV8B 4X8WA 4LF6E 3RMPA 3FIGA 1YFHA 5KL5A 3AUZA 4HEIA 2Q8UA 4DR6E 2YT4A 2MDRA 3M99B 3VHTB 2ZM6E 2LV2A 4P7DA 2MKDA 5AE1A 4K0KE 2N3HA 4JI7E 2RPCA 2DLQA 2B9DA 5LL6R 3VK6A 1UBDC 1WRJA 4AQYE 1TF3A 2EN3A 2YU8A 2JYAA 4BC7A 1B69A 2YTPA 4GKKE 2LO3A 3K6QA 5A6AA 2R1FA 2YPNA 3JAMC 2VQFE 1WJPA 2YSPA 2UUAE 4ZYDA 5IT9C 3C6KA 1DQ3A 4BCAA 4RHBB 1XMQE 2E5LE 3J7Yp 2EMYA 4JI6E 2EM5A 1PKPA 4YHHE 1LLMC 2RSMA 4DV0E 4JI5E 4ZYHA 2EP3A 2YU5A 1X6HA 2EPKX 4L5NC 2K4VA 2ENHA 4DMIA 2YTEA 2YTJA 2NABA 2YTGA 2YTOA 1IBKE 2YWQA 4F54A 1BBOA 1PJTA 1F2IG 1QU6A 1T38A 2NUEA 4MLVA 2D9HA 4NXME 4LF4E 2I9IA 5BR8E 1UILA 4WX9A 1RC7A 4OOGC 4LF7E 2EMFA 5A6BA 3ECRA 2EMHA 2YTDA 2R76A 4DV5E 4R03A 3C4BA 4WFTA 2LTRA 2EOMA 5IWAE 1YYWA 2EMCA 3VYXA 4JI3E 2JOXA 1RMDA 4O43A 1A1GA 1UN6B 1XNRE 2L92A 4NHRA 2ELYA 2EM6A 4WSGA 2V88A 5AC5A 4JI4E 2EPPA 1PJSA 2ODRD 1N36E 2GHFA 3F6HA 1O0WA 2HHHE 5A6JA 3L00A 2NUFA 2EOJA 2EZ6A 2UXDE 4MLQA 2E1MA 1ZU1A 4WYQB 2EQ1A 1BB8A 4LU9A 1I94E 2VE7C 4X64E 1X6FA 1G2DC 2EOZA 4O24A 2N3GA 2JWOA 4LFAE 3ADLA 3F6GA 4TUGA 4R2SA 3LLHA 1TN9A 1P47A 3BF2A 2LRSA 2EPZA 1QNTA 4DR4E 2LJHA 4X65E 2JPAA 3TQMA 2LUQA 2KHXA 2EL4A 3EPKA 2M4IA 1YYKA 2EMLA 1X47A 1EH8A 5KL6A 3EPLA 4JV5E 4O4KA 1Z1BA 2M7QA 2VF1A 2VRDA 2YTIA 3HPZA 3EQ1A 5A6KA 4R2PA 2DIXA 5AASA 4I8OA 4LFBE 4WSPA 4X62E 1IMUA 2EM7A 4DUZE 2V8QB 4JI1E 2CTDA 1IBLE 2M9AA 2EOSA 3KZYA 2HGHA 2EPMX 3J81C 2EPNA 3DJWA 2LUPB 4F9BB 2V85A 3J7AG 2LVHA 4J8ZA 1N34E 1SR9A 1A1IA 1HNXE 2L2NA 3QG5C 2JXPA 2YSOA 5FLXC 2EQ3A 1BBGA 1G2FC 4M30A 1T4NA 5TSEA 2FTXB 3THNA 4N4RB 2WZOA 2JOBA 3MHHC 3P1XA 2EOQA 4X9JA 2RTXA 1J26A 2KOUA 2EOXA 1PDAA 2EOYA 3T1HE 3UK3C 5KL2A 2JR1A 2EMBA 4FK5C 2L3JA 1ZAAC 1YUJA 4B3SE 2UU9E 4Q35B 4R2CA 2DLKA 2ENCA 1T4OA 2L6MA 2H36X 2LT7A 2ENAA 1XMOE 5LLQA 4BS9A 2EPOA 4BC9A 1N3GA 3J80C 4LFCE 1XNQE 4ZYGA 2DMIA 2LJUA 4DV4E 2MDGA 3ZOQB 1ZBQA 2LTSA 2JY9A 4LF9E 3AV0A 2CSHA 1L4SA 4DV2E 2EMKA 4BHBA 3VYYA 3LMLA 2LMZA 1A1LA 2E72A 4GEQB 2EPXA 2CPNA 4DR2E 3T1YE 1A1FA 4B3TE 2L33A 2YZTA 2NA2A 4GZNC 2B3TB 3MHSC 4GKJE 4TUIA 2K7IA 2EN1A 3HPSA 2RS6A 2MC5A 2GLIA 2EN8A 5LMNE 1MGTA 1AAYA 3ADIA 2L8TA 1IQOA 1IQSA 2EWLA 4ZYEA 1GTKA 4JI2E 2EPCA 2EOHA 1JK1A 2EMWA 2EE8A 4O5GA 4LTYA 2B7TA 4IJDA 2PRTA 2HC5A 1TF6A 2I13A 2BBGA 3EPHA 1KYQA 2EM2A 3HQ1A 4F9AB 2UXBE 2EORA 2EJ4A 5DNYA 4DKKA 1GQEA 2EPLX 1EH7A 2L3CA 2J7JA 2EPUA 1J5EE 1ZBTA 4DR7E 2ODRC 4DV6E 4B3ME 4M2ZA 2NUGA 4R2RA 4OX9E 4B3RE 2EM9A 1JK2A 2EMZA 2EN6A 3KZZA 2RS7A 1RQ0A 2DB2A 2G7HA 1WXRA 2RSIA 4X66E 2UXCE 3C4TA 2V89A 3BGHA 3OMLA 1GZ6A 1YSAC 2MKNA 1ZR9A 2EN2A 5ADZA 2FV4B 2DGCA 2EOFA 2EM8A 2VQEE 2MC6A 4HTGA 1X49A 4R8OA 2LCEA 2WCC3 1X3CA 5KL7A 3IWBA 2EN4A 4KZSA 3ADJA 1HR0E 4KWYA 4BBYA 4KHPE 4IS1C 1KJKA 5A2QC 5T6JA 2WBUA 2DRPA 1NCSA 4JI8E 1EH6A 1YZ9A 2M1SA 4DV1E 1FKAE 2YRKA 2YTQA 3BBGA 4RH8A 3BIDA 4WXCA 4DV3E 2DSYA 2F4VE 2EL6A 3DF6A 1STUA 3EPJA 1HNZE 4LF8E 2CT1A 3H09A
chains in the Genus database with same CATH topology
5LL6R 2B9DA 2LJHA 4DR4E 4X65E 4YY3E 3VK6A 2LUQA 2KHXA 4GEQB 4DR2E 2CPNA 4AQYE 3T1YE 2DMYA 2M4IA 5LMUE 1YYKA 4B3TE 1DI2A 2L33A 1X47A 2YZTA 2NA2A 4JV5E 1UHZA 4M0VA 2B3TB 2V83A 2M7QA 4GKJE 4TUIA 4F9CB 4BC7A 2VF1A 3HPSA 4LF5E 2RS6A 2MC5A 3HPZA 4GKKE 2DIXA 5AASA 4DUYE 4I8OA 5LMNE 4WSPA 1FJGE 2LE2A 3K6QA 2L2KB 4X62E 1T4LB 4LFBE 3ADIA 2VQFE 2L8TA 2L2MA 3JAMC 2V8QB 4DUZE 4JI1E 2EWLA 5AE2A 2UUAE 1WHQA 5IT9C 3ADGA 4JI2E 5F3WA 1DQ3A 4BCAA 1IBLE 1XMQE 2E5LE 2B7VA 3J7Yp 4LTYA 3J81C 2B7TA 4JI6E 4DR3E 3DJWA 1PKPA 2V87A 4YHHE 2LUPB 1N33E 4F9BB 2V85A 1X48A 2RSMA 4DV0E 4JI5E 4DR5E 3J7AG 4J8ZA 1N34E 1SR9A 1HNXE 3HQ1A 2L2NA 4F9AB 2LBSB 4L5NC 4Q28A 1WHNA 2K4VA 4DMIA 3IWCA 1IBME 2UXBE 4L8NA 1IBKE 4BMJA 3LMLA 5DNYA 5FLXC 4F54A 4DR1E 4DKKA 1GQEA 2L3CA 1J5EE 4M30A 1QU6A 2NUEA 1ZBTA 4DR7E 3JU0A 1T4NA 2FTXB 4NXME 4DV7E 2ODRC 5BR8E 1UILA 4DV6E 4LF4E 4WPYA 1RC7A 4OOGC 4B3ME 4LF7E 4M2ZA 2NUGA 4OX9E 4B3RE 2WZOA 1J26A 2F8BA 4DV5E 2JOBA 4R03A 3C4BA 2KONA 3P1XA 2RTXA 4WFTA 2RS7A 2LTRA 5IWAE 3HXLA 1EKZA 1YYWA 2KOUA 1RQ0A 2DB2A 2JOXA 2G7HA 4JI3E 3VYXA 4JYAE 3HTXA 1WXRA 4X66E 3KWRA 3T1HE 2UXCE 1XNRE 2IHR1 3C4TA 2L92A 2JR1A 2V89A 3MSWA 1GZ6A 3OMLA 2L3JA 1YYOA 3JTZA 2V88A 4P78A 4JI4E 1HNWE 4B3SE 4JI0E 5ADZA 3OTOE 2ODRD 2UU9E 2FV4B 5AE3A 2VQEE 1N36E 2MC6A 1T4OA 1X49A 3IWDA 4R8OA 3F6HA 2L6MA 5CFFE 2H36X 3IWBA 1O0WA 2HHHE 4NXNE 4KZSA 2NUFA 2FGGA 2JVAA 1XMOE 3ADJA 4BS9A 2UUBE 2UUCE 2EZ6A 4BC9A 1N32E 3J80C 4LFCE 2UXDE 2E1MA 1HR0E 1XNQE 4BBYA 4KHPE 2V86A 4WYQB 4DV4E 5A2QC 5T6JA 3ZOQB 4LU9A 4X8WA 1I94E 2VE7C 4LF6E 1ZBQA 4X64E 3RMPA 4JI8E 3FIGA 2LTSA 1YZ9A 2M1SA 4DV1E 2JY9A 3AUZA 1FKAE 4DR6E 4LF9E 2YT4A 2MDRA 2N3GA 2JWOA 4LFAE 3AV0A 3ADLA 4DV3E 3F6GA 2DSYA 4TUGA 4DV2E 2ZM6E 2F4VE 3LLHA 5AE1A 4P7DA 4K0KE 3DF6A 3VYYA 1STUA 1HNZE 2N3HA 4JI7E 4LF8E 3H09A 2LMZA 2LRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 E;  2LJH A;  4X65 E;  4YY3 E;  2LUQ A;  2KHX A;  4DR2 E;  2CPN A;  4AQY E;  3T1Y E;  2DMY A;  5LMU E;  1YYK A;  4B3T E;  1DI2 A;  2L33 A;  1X47 A;  2NA2 A;  4JV5 E;  1UHZ A;  2B3T B;  4GKJ E;  4LF5 E;  2RS6 A;  4GKK E;  2DIX A;  4DUY E;  1FJG E;  5LMN E;  4LFB E;  2L2K B;  1T4L B;  4X62 E;  3ADI A;  2VQF E;  4DUZ E;  2L2M A;  4JI1 E;  2UUA E;  1WHQ A;  3ADG A;  4JI2 E;  1IBL E;  1XMQ E;  2E5L E;  2B7V A;  3J7Y p;  2B7T A;  4JI6 E;  4DR3 E;  1PKP A;  4YHH E;  2LUP B;  1N33 E;  4JI5 E;  1X48 A;  2RSM A;  4DV0 E;  4DR5 E;  1N34 E;  1HNX E;  2L2N A;  2LBS B;  1WHN A;  1IBM E;  2UXB E;  1IBK E;  4DR1 E;  4DKK A;  1GQE A;  2L3C A;  1J5E E;  4M30 A;  1QU6 A;  2NUE A;  1ZBT A;  4DR7 E;  1T4N A;  4NXM E;  4DV7 E;  5BR8 E;  4DV6 E;  1UIL A;  4LF4 E;  1RC7 A;  4OOG C;  4B3M E;  4LF7 E;  4M2Z A;  2NUG A;  4OX9 E;  4B3R E;  4DV5 E;  3C4B A;  3P1X A;  2RTX A;  4WFT A;  2RS7 A;  2LTR A;  5IWA E;  1EKZ A;  1YYW A;  1J26 A;  3VYX A;  1RQ0 A;  2DB2 A;  4JI3 E;  4JYA E;  3HTX A;  4X66 E;  3T1H E;  2UXC E;  1XNR E;  2IHR 1;  3C4T A;  2L3J A;  1YYO A;  4JI4 E;  1HNW E;  4B3S E;  4JI0 E;  3OTO E;  2UU9 E;  2VQE E;  1N36 E;  1T4O A;  1X49 A;  5CFF E;  1O0W A;  2HHH E;  4NXN E;  2NUF A;  2JVA A;  1XMO E;  3ADJ A;  2EZ6 A;  2UUB E;  2UUC E;  1N32 E;  4LFC E;  2UXD E;  1HR0 E;  1XNQ E;  4KHP E;  4WYQ B;  4DV4 E;  4X8W A;  1I94 E;  4LF6 E;  4X64 E;  4JI8 E;  2LTS A;  1YZ9 A;  4DV1 E;  2JY9 A;  1FKA E;  4DR6 E;  4LF9 E;  2YT4 A;  2MDR A;  2N3G A;  4LFA E;  3ADL A;  4DV3 E;  4DV2 E;  2ZM6 E;  2F4V E;  3LLH A;  4K0K E;  3VYY A;  1STU A;  1HNZ E;  2N3H A;  4JI7 E;  4LF8 E;  2LRS A; 
#chains in the Genus database with same CATH topology
 1A1J A;  2EL5 A;  4YY3 E;  2EPR A;  2DMY A;  5LMU E;  2EM4 A;  1DI2 A;  2EN7 A;  1UHZ A;  1AH5 A;  4M0V A;  2V83 A;  3THO B;  4F9C B;  4LF5 E;  2RQL A;  1YPN A;  2N8X A;  4R2D A;  1X5W A;  4DUY E;  2WBS A;  1FJG E;  2LE2 A;  4R2E A;  2L2K B;  1T4L B;  5KL4 A;  2YTF A;  2ADR A;  2L2M A;  5AE2 A;  2EOO A;  1WHQ A;  3ADG A;  5AC4 A;  5F3W A;  2GPI A;  2YTN A;  2B7V A;  2EPA A;  4WXD A;  4DR3 E;  2V87 A;  1A1K A;  3C6M A;  1N33 E;  1X48 A;  1X6E A;  4DR5 E;  2EM0 A;  2LBS B;  1A1H A;  4Q28 A;  1WHN A;  2BB8 A;  4NZV A;  3IWC A;  1SFE A;  1IBM E;  4L8N A;  2EMX A;  4BMJ A;  4DR1 E;  1DGC A;  5A6B D;  2YRM A;  3JU0 A;  4F6M A;  2EOE A;  4DV7 E;  5KL3 A;  4WPY A;  2EQ0 A;  2F8B A;  2JP9 A;  2WBT A;  2EMA A;  1MEY C;  2KON A;  1EKZ A;  3HXL A;  4BHC A;  1T39 A;  2EMG A;  4JYA E;  3HTX A;  3KWR A;  2IHR 1;  4R2Q A;  4R2A A;  3MSW A;  2EM3 A;  3JTZ A;  1YYO A;  1YUI A;  4P78 A;  2EMI A;  1HNW E;  4JI0 E;  3OTO E;  5AE3 A;  2YRH A;  1NEI A;  4F2J C;  3IWD A;  5CFF E;  2A25 A;  4NXN E;  2FGG A;  2JVA A;  5A69 A;  2UUB E;  2UUC E;  4F6N A;  2ELZ A;  2EOI A;  1N32 E;  1PJQ A;  5IXM B;  2V86 A;  4M9V C;  2HJJ A;  5IV8 B;  4X8W A;  4LF6 E;  3RMP A;  3FIG A;  1YFH A;  5KL5 A;  3AUZ A;  4HEI A;  2Q8U A;  4DR6 E;  2YT4 A;  2MDR A;  3M99 B;  3VHT B;  2ZM6 E;  2LV2 A;  4P7D A;  2MKD A;  5AE1 A;  4K0K E;  2N3H A;  4JI7 E;  2RPC A;  2DLQ A;  2B9D A;  5LL6 R;  3VK6 A;  1UBD C;  1WRJ A;  4AQY E;  1TF3 A;  2EN3 A;  2YU8 A;  2JYA A;  4BC7 A;  1B69 A;  2YTP A;  4GKK E;  2LO3 A;  3K6Q A;  5A6A A;  2R1F A;  2YPN A;  3JAM C;  2VQF E;  1WJP A;  2YSP A;  2UUA E;  4ZYD A;  5IT9 C;  3C6K A;  1DQ3 A;  4BCA A;  4RHB B;  1XMQ E;  2E5L E;  3J7Y p;  2EMY A;  4JI6 E;  2EM5 A;  1PKP A;  4YHH E;  1LLM C;  2RSM A;  4DV0 E;  4JI5 E;  4ZYH A;  2EP3 A;  2YU5 A;  1X6H A;  2EPK X;  4L5N C;  2K4V A;  2ENH A;  4DMI A;  2YTE A;  2YTJ A;  2NAB A;  2YTG A;  2YTO A;  1IBK E;  2YWQ A;  4F54 A;  1BBO A;  1PJT A;  1F2I G;  1QU6 A;  1T38 A;  2NUE A;  4MLV A;  2D9H A;  4NXM E;  4LF4 E;  2I9I A;  5BR8 E;  1UIL A;  4WX9 A;  1RC7 A;  4OOG C;  4LF7 E;  2EMF A;  5A6B A;  3ECR A;  2EMH A;  2YTD A;  2R76 A;  4DV5 E;  4R03 A;  3C4B A;  4WFT A;  2LTR A;  2EOM A;  5IWA E;  1YYW A;  2EMC A;  3VYX A;  4JI3 E;  2JOX A;  1RMD A;  4O43 A;  1A1G A;  1UN6 B;  1XNR E;  2L92 A;  4NHR A;  2ELY A;  2EM6 A;  4WSG A;  2V88 A;  5AC5 A;  4JI4 E;  2EPP A;  1PJS A;  2ODR D;  1N36 E;  2GHF A;  3F6H A;  1O0W A;  2HHH E;  5A6J A;  3L00 A;  2NUF A;  2EOJ A;  2EZ6 A;  2UXD E;  4MLQ A;  2E1M A;  1ZU1 A;  4WYQ B;  2EQ1 A;  1BB8 A;  4LU9 A;  1I94 E;  2VE7 C;  4X64 E;  1X6F A;  1G2D C;  2EOZ A;  4O24 A;  2N3G A;  2JWO A;  4LFA E;  3ADL A;  3F6G A;  4TUG A;  4R2S A;  3LLH A;  1TN9 A;  1P47 A;  3BF2 A;  2LRS A;  2EPZ A;  1QNT A;  4DR4 E;  2LJH A;  4X65 E;  2JPA A;  3TQM A;  2LUQ A;  2KHX A;  2EL4 A;  3EPK A;  2M4I A;  1YYK A;  2EML A;  1X47 A;  1EH8 A;  5KL6 A;  3EPL A;  4JV5 E;  4O4K A;  1Z1B A;  2M7Q A;  2VF1 A;  2VRD A;  2YTI A;  3HPZ A;  3EQ1 A;  5A6K A;  4R2P A;  2DIX A;  5AAS A;  4I8O A;  4LFB E;  4WSP A;  4X62 E;  1IMU A;  2EM7 A;  4DUZ E;  2V8Q B;  4JI1 E;  2CTD A;  1IBL E;  2M9A A;  2EOS A;  3KZY A;  2HGH A;  2EPM X;  3J81 C;  2EPN A;  3DJW A;  2LUP B;  4F9B B;  2V85 A;  3J7A G;  2LVH A;  4J8Z A;  1N34 E;  1SR9 A;  1A1I A;  1HNX E;  2L2N A;  3QG5 C;  2JXP A;  2YSO A;  5FLX C;  2EQ3 A;  1BBG A;  1G2F C;  4M30 A;  1T4N A;  5TSE A;  2FTX B;  3THN A;  4N4R B;  2WZO A;  2JOB A;  3MHH C;  3P1X A;  2EOQ A;  4X9J A;  2RTX A;  1J26 A;  2KOU A;  2EOX A;  1PDA A;  2EOY A;  3T1H E;  3UK3 C;  5KL2 A;  2JR1 A;  2EMB A;  4FK5 C;  2L3J A;  1ZAA C;  1YUJ A;  4B3S E;  2UU9 E;  4Q35 B;  4R2C A;  2DLK A;  2ENC A;  1T4O A;  2L6M A;  2H36 X;  2LT7 A;  2ENA A;  1XMO E;  5LLQ A;  4BS9 A;  2EPO A;  4BC9 A;  1N3G A;  3J80 C;  4LFC E;  1XNQ E;  4ZYG A;  2DMI A;  2LJU A;  4DV4 E;  2MDG A;  3ZOQ B;  1ZBQ A;  2LTS A;  2JY9 A;  4LF9 E;  3AV0 A;  2CSH A;  1L4S A;  4DV2 E;  2EMK A;  4BHB A;  3VYY A;  3LML A;  2LMZ A;  1A1L A;  2E72 A;  4GEQ B;  2EPX A;  2CPN A;  4DR2 E;  3T1Y E;  1A1F A;  4B3T E;  2L33 A;  2YZT A;  2NA2 A;  4GZN C;  2B3T B;  3MHS C;  4GKJ E;  4TUI A;  2K7I A;  2EN1 A;  3HPS A;  2RS6 A;  2MC5 A;  2GLI A;  2EN8 A;  5LMN E;  1MGT A;  1AAY A;  3ADI A;  2L8T A;  1IQO A;  1IQS A;  2EWL A;  4ZYE A;  1GTK A;  4JI2 E;  2EPC A;  2EOH A;  1JK1 A;  2EMW A;  2EE8 A;  4O5G A;  4LTY A;  2B7T A;  4IJD A;  2PRT A;  2HC5 A;  1TF6 A;  2I13 A;  2BBG A;  3EPH A;  1KYQ A;  2EM2 A;  3HQ1 A;  4F9A B;  2UXB E;  2EOR A;  2EJ4 A;  5DNY A;  4DKK A;  1GQE A;  2EPL X;  1EH7 A;  2L3C A;  2J7J A;  2EPU A;  1J5E E;  1ZBT A;  4DR7 E;  2ODR C;  4DV6 E;  4B3M E;  4M2Z A;  2NUG A;  4R2R A;  4OX9 E;  4B3R E;  2EM9 A;  1JK2 A;  2EMZ A;  2EN6 A;  3KZZ A;  2RS7 A;  1RQ0 A;  2DB2 A;  2G7H A;  1WXR A;  2RSI A;  4X66 E;  2UXC E;  3C4T A;  2V89 A;  3BGH A;  3OML A;  1GZ6 A;  1YSA C;  2MKN A;  1ZR9 A;  2EN2 A;  5ADZ A;  2FV4 B;  2DGC A;  2EOF A;  2EM8 A;  2VQE E;  2MC6 A;  4HTG A;  1X49 A;  4R8O A;  2LCE A;  2WCC 3;  1X3C A;  5KL7 A;  3IWB A;  2EN4 A;  4KZS A;  3ADJ A;  1HR0 E;  4KWY A;  4BBY A;  4KHP E;  4IS1 C;  1KJK A;  5A2Q C;  5T6J A;  2WBU A;  2DRP A;  1NCS A;  4JI8 E;  1EH6 A;  1YZ9 A;  2M1S A;  4DV1 E;  1FKA E;  2YRK A;  2YTQ A;  3BBG A;  4RH8 A;  3BID A;  4WXC A;  4DV3 E;  2DSY A;  2F4V E;  2EL6 A;  3DF6 A;  1STU A;  3EPJ A;  1HNZ E;  4LF8 E;  2CT1 A;  3H09 A; 
#chains in the Genus database with same CATH homology
 5LL6 R;  2B9D A;  2LJH A;  4DR4 E;  4X65 E;  4YY3 E;  3VK6 A;  2LUQ A;  2KHX A;  4GEQ B;  4DR2 E;  2CPN A;  4AQY E;  3T1Y E;  2DMY A;  2M4I A;  5LMU E;  1YYK A;  4B3T E;  1DI2 A;  2L33 A;  1X47 A;  2YZT A;  2NA2 A;  4JV5 E;  1UHZ A;  4M0V A;  2B3T B;  2V83 A;  2M7Q A;  4GKJ E;  4TUI A;  4F9C B;  4BC7 A;  2VF1 A;  3HPS A;  4LF5 E;  2RS6 A;  2MC5 A;  3HPZ A;  4GKK E;  2DIX A;  5AAS A;  4DUY E;  4I8O A;  5LMN E;  4WSP A;  1FJG E;  2LE2 A;  3K6Q A;  2L2K B;  4X62 E;  1T4L B;  4LFB E;  3ADI A;  2VQF E;  2L8T A;  2L2M A;  3JAM C;  2V8Q B;  4DUZ E;  4JI1 E;  2EWL A;  5AE2 A;  2UUA E;  1WHQ A;  5IT9 C;  3ADG A;  4JI2 E;  5F3W A;  1DQ3 A;  4BCA A;  1IBL E;  1XMQ E;  2E5L E;  2B7V A;  3J7Y p;  4LTY A;  3J81 C;  2B7T A;  4JI6 E;  4DR3 E;  3DJW A;  1PKP A;  2V87 A;  4YHH E;  2LUP B;  1N33 E;  4F9B B;  2V85 A;  1X48 A;  2RSM A;  4DV0 E;  4JI5 E;  4DR5 E;  3J7A G;  4J8Z A;  1N34 E;  1SR9 A;  1HNX E;  3HQ1 A;  2L2N A;  4F9A B;  2LBS B;  4L5N C;  4Q28 A;  1WHN A;  2K4V A;  4DMI A;  3IWC A;  1IBM E;  2UXB E;  4L8N A;  1IBK E;  4BMJ A;  3LML A;  5DNY A;  5FLX C;  4F54 A;  4DR1 E;  4DKK A;  1GQE A;  2L3C A;  1J5E E;  4M30 A;  1QU6 A;  2NUE A;  1ZBT A;  4DR7 E;  3JU0 A;  1T4N A;  2FTX B;  4NXM E;  4DV7 E;  2ODR C;  5BR8 E;  1UIL A;  4DV6 E;  4LF4 E;  4WPY A;  1RC7 A;  4OOG C;  4B3M E;  4LF7 E;  4M2Z A;  2NUG A;  4OX9 E;  4B3R E;  2WZO A;  1J26 A;  2F8B A;  4DV5 E;  2JOB A;  4R03 A;  3C4B A;  2KON A;  3P1X A;  2RTX A;  4WFT A;  2RS7 A;  2LTR A;  5IWA E;  3HXL A;  1EKZ A;  1YYW A;  2KOU A;  1RQ0 A;  2DB2 A;  2JOX A;  2G7H A;  4JI3 E;  3VYX A;  4JYA E;  3HTX A;  1WXR A;  4X66 E;  3KWR A;  3T1H E;  2UXC E;  1XNR E;  2IHR 1;  3C4T A;  2L92 A;  2JR1 A;  2V89 A;  3MSW A;  1GZ6 A;  3OML A;  2L3J A;  1YYO A;  3JTZ A;  2V88 A;  4P78 A;  4JI4 E;  1HNW E;  4B3S E;  4JI0 E;  5ADZ A;  3OTO E;  2ODR D;  2UU9 E;  2FV4 B;  5AE3 A;  2VQE E;  1N36 E;  2MC6 A;  1T4O A;  1X49 A;  3IWD A;  4R8O A;  3F6H A;  2L6M A;  5CFF E;  2H36 X;  3IWB A;  1O0W A;  2HHH E;  4NXN E;  4KZS A;  2NUF A;  2FGG A;  2JVA A;  1XMO E;  3ADJ A;  4BS9 A;  2UUB E;  2UUC E;  2EZ6 A;  4BC9 A;  1N32 E;  3J80 C;  4LFC E;  2UXD E;  2E1M A;  1HR0 E;  1XNQ E;  4BBY A;  4KHP E;  2V86 A;  4WYQ B;  4DV4 E;  5A2Q C;  5T6J A;  3ZOQ B;  4LU9 A;  4X8W A;  1I94 E;  2VE7 C;  4LF6 E;  1ZBQ A;  4X64 E;  3RMP A;  4JI8 E;  3FIG A;  2LTS A;  1YZ9 A;  2M1S A;  4DV1 E;  2JY9 A;  3AUZ A;  1FKA E;  4DR6 E;  4LF9 E;  2YT4 A;  2MDR A;  2N3G A;  2JWO A;  4LFA E;  3AV0 A;  3ADL A;  4DV3 E;  3F6G A;  2DSY A;  4TUG A;  4DV2 E;  2ZM6 E;  2F4V E;  3LLH A;  5AE1 A;  4P7D A;  4K0K E;  3DF6 A;  3VYY A;  1STU A;  1HNZ E;  2N3H A;  4JI7 E;  4LF8 E;  3H09 A;  2LMZ A;  2LRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...