2CPNA

Solution structure of the second dsrbd of tar rna-binding protein 2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the second dsRBD of TAR RNA-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords TAR RNA-binding protein 2
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2cpnA01
2NUEA 2UXCE 3HTXA 4M30A 4DV3E 2LTSA 2CPNA 1EKZA 2RS6A 1YYOA 4X65E 1HNZE 2LBSB 2N3HA 2JVAA 1WHQA 2L3JA 4WFTA 2LUPB 3ADLA 4DR7E 1HR0E 2YT4A 2UUCE 4LF9E 2B7TA 1STUA 1T4LB 2L3CA 4JI5E 4DUYE 1QU6A 1T4NA 5LMNE 2LTRA 4JI0E 1XNQE 2L2NA 4M2ZA 2L33A 2JY9A 1RQ0A 2RTXA 1XMQE 5LMUE 1YZ9A 3LLHA 4DKKA 4LF4E 2LJHA 3P1XA 4DR6E 1XMOE 1N33E 1YYKA 2VQFE 2KHXA 4JI7E 4DUZE 4B3ME 2B3TB 4OX9E 4NXNE 2F4VE 4K0KE 1J5EE 2ZM6E 1IBKE 3VYYA 2DB2A 2VQEE 1HNXE 1UHZA 3VYXA 4DV4E 2E5LE 1RC7A 2L2KB 4JI6E 1N36E 4LF8E 4NXME 1N32E 2EZ6A 3ADIA 2UUBE 4GKKE 4DV0E 1FKAE 4DR5E 4AQYE 4B3SE 4DV7E 4JYAE 2DIXA 3ADGA 4JI1E 2LUQA 4DR3E 1IBME 1T4OA 4JI4E 4DV5E 3T1YE 2UXBE 3J7Yp 4DR2E 4OOGC 2RSMA 1GQEA 4LF7E 4DV6E 4X66E 1HNWE 1PKPA 2UUAE 4JI2E 4YY3E 4GKJE 1UILA 4DV2E 1N34E 1WHNA 4X64E 4JI3E 1X47A 3ADJA 1IBLE 4LFBE 4LFCE 2RS7A 3C4BA 4X8WA 4DV1E 2NUGA 1DI2A 1O0WA 4X62E 4JI8E 3OTOE 4LFAE 1X48A 2L2MA 3C4TA 2HHHE 5IWAE 4WYQB 2UXDE 5CFFE 2MDRA 1J26A 2B7VA 4B3TE 3T1HE 1XNRE 1X49A 4LF6E 4JV5E 1FJGE 5BR8E 2N3GA 2UU9E 4KHPE 1YYWA 4DR1E 2NUFA 2LRSA 4B3RE 1ZBTA 2DMYA 4DR4E 4LF5E 4YHHE 1I94E 2NA2A 2IHR1
chains in the Genus database with same CATH superfamily
2NUEA 2YSOA 4TUIA 2K4VA 2EPRA 3IWCA 2YTDA 3BIDA 2G7HA 2L8TA 3AV0A 2L3JA 2DRPA 1PJSA 2M4IA 2UUCE 2EMZA 4F9BB 2L3CA 2EMKA 4IS1C 4ZYDA 5A6JA 2LTRA 4J8ZA 3TQMA 2YU5A 4F54A 1YFHA 4O4KA 1QNTA 4O5GA 4R2AA 2EPMX 3P1XA 4DR6E 1WJPA 1N33E 2EOHA 1X6HA 2VQFE 4GZNC 1A1IA 4WSPA 2EPUA 4M9VC 1J5EE 2EM0A 2ELYA 3VYYA 1BB8A 2E72A 2VQEE 3OMLA 2EL5A 2DLQA 2YU8A 4M0VA 3VYXA 1X6FA 4JI6E 3J80C 1N36E 3ADIA 2EP3A 2UUBE 2K7IA 4DV0E 2EM6A 2RSIA 4BHBA 3AUZA 4B3SE 2H36X 3MHHC 5AE2A 3J7Yp 4DR2E 1T38A 2RSMA 4LF7E 1A1FA 3EPHA 5F3WA 1KYQA 2ENCA 3VHTB 1X47A 2DGCA 4BHCA 2EN7A 1O0WA 3K6QA 3MSWA 4FK5C 2FTXB 3C4TA 2GPIA 4R2RA 3DF6A 2YTPA 1PJQA 4L5NC 4GEQB 2E1MA 1FJGE 5BR8E 4R2DA 2EMYA 2YPNA 3LMLA 4KHPE 4WPYA 2EOOA 4B3RE 1YPNA 1YUIA 5IT9C 2DMYA 2YTGA 4LF5E 5AE1A 4WXCA 4KZSA 2UXCE 4LU9A 2MC6A 1MGTA 1EKZA 5A6KA 2EOMA 2JOXA 2J7JA 2RS6A 1YYOA 1A1GA 1DQ3A 2EMWA 1HNZE 2EOXA 4ZYEA 1EH6A 1P47A 2FV4B 2LUPB 1AH5A 2YT4A 3KWRA 2YWQA 1TF6A 1T4LB 4JI5E 4DUYE 1T4NA 4N4RB 3EPLA 1WRJA 4JI0E 2ODRD 5DNYA 2JY9A 1RQ0A 2LO3A 2EPKX 2VE7C 4R2CA 3EPKA 1XMQE 3MHSC 2EPXA 4DKKA 2YTOA 2GHFA 4KWYA 1EH8A 2YTJA 1IMUA 1YYKA 2KHXA 2CTDA 4OX9E 2EPZA 3RMPA 2M7QA 5AE3A 2EOIA 2YRKA 2EN4A 2ZM6E 2V83A 1IBKE 2EM9A 2EOSA 3H09A 2CSHA 1HNXE 1BBOA 2E5LE 1N32E 4LF8E 4NXME 2EZ6A 4GKKE 2WBTA 2EOJA 4AQYE 4X9JA 2ENHA 1KJKA 1SFEA 2ODRC 3THNA 2DIXA 3ADGA 2LUQA 2KOUA 4I8OA 4JI4E 4DV5E 4NHRA 4OOGC 1GQEA 5A69A 2L6MA 2R76A 1PKPA 2UUAE 2CT1A 3JAMC 4O24A 4GKJE 4YHHE 2Q8UA 2EN2A 1PJTA 2EN3A 4X64E 4JI3E 2R1FA 2DLKA 3ADJA 1X5WA 4LFCE 2WZOA 4DV1E 1DI2A 4NZVA 2LV2A 4LFAE 4P78A 2HGHA 1X48A 4MLQA 3VK6A 2EPCA 5IWAE 2JWOA 2MDRA 5KL2A 3KZZA 2JP9A 1XNRE 2DSYA 2EMLA 4LF6E 4JV5E 2B9DA 4L8NA 1JK2A 2EOQA 4F9CB 5KL6A 2EM8A 3HPSA 4DR1E 2LRSA 2MC5A 1ZBTA 4DR4E 4MLVA 2M9AA 1I94E 2EWLA 1TN9A 2EM3A 4M30A 3IWBA 4F9AB 2V87A 1A1LA 3DJWA 3EPJA 1UBDC 4X65E 2EN1A 2RQLA 2N3HA 5KL3A 2JR1A 2JVAA 5LLQA 2VF1A 1LLMC 5A2QC 1MEYC 2B7TA 4R2PA 1STUA 1Z1BA 2PRTA 1X6EA 2YRMA 1QU6A 2FGGA 5A6BD 1EH7A 4BC7A 2D9HA 2MKDA 2EOFA 2LVHA 2EPNA 2RTXA 4RH8A 5LMUE 4LF4E 4ZYHA 2LJHA 1YSAC 1GZ6A 3JTZA 1IQOA 2YZTA 4WXDA 1XMOE 1BBGA 4Q28A 2EM2A 2LE2A 4JI7E 1F2IG 2MKNA 2GLIA 2B3TB 4NXNE 2F4VE 4K0KE 3HPZA 2ENAA 2DB2A 3UK3C 4BC9A 1UHZA 2EMFA 4F2JC 2LCEA 4DV4E 2MDGA 4HTGA 2L2KB 2WCC3 1RC7A 2HJJA 4IJDA 5TSEA 4DV7E 2JOBA 4LTYA 5AC5A 4R8OA 4ZYGA 4JI1E 1ZU1A 2F8BA 4DR3E 1IBME 1N3GA 3BF2A 5LL6R 2UXBE 1X3CA 2BBGA 5KL4A 2EQ3A 2V88A 1B69A 2JYAA 2EOEA 4JI2E 1L4SA 4YY3E 3JU0A 4BMJA 2EMIA 1N34E 1WHNA 2M1SA 4WX9A 2EL6A 2EN8A 2RS7A 4X8WA 1JK1A 1TF3A 5KL5A 4JI8E 1PDAA 2EMCA 3OTOE 4WSGA 2EPAA 2L2MA 2JXPA 2KONA 2EOYA 2WBUA 4WYQB 5CFFE 1ZAAC 3HXLA 4BCAA 2DMIA 3T1HE 2N8XA 2EN6A 2UU9E 2EORA 5A6BA 2YTIA 2NA2A 1ZR9A 2A25A 3HTXA 4R2SA 4DV3E 2LTSA 3HQ1A 2CPNA 1A1KA 2YTEA 3KZYA 2LBSB 5A6AA 1WHQA 2EM7A 1NCSA 3C6KA 4WFTA 3FIGA 3ADLA 4DR7E 1HR0E 1G2DC 4LF9E 4BS9A 2YSPA 3C6MA 5LMNE 1XNQE 2L2NA 4M2ZA 2L33A 1IQSA 3J81C 3EQ1A 1YUJA 1RMDA 3ZOQB 4P7DA 3BGHA 3LLHA 2EE8A 5IV8B 2EMGA 1YZ9A 3BBGA 1A1JA 2ELZA 2V89A 5KL7A 2EPPA 5AC4A 2ADRA 2BB8A 1SR9A 4DUZE 2WBSA 4B3ME 3QG5C 4HEIA 5IXMB 4DMIA 2V8QB 5AASA 3THOB 3L00A 2EJ4A 2RPCA 4R03A 2HC5A 2YTQA 1AAYA 3J7AG 2EQ0A 1A1HA 3ECRA 2V85A 2EM4A 2V86A 2LJUA 5ADZA 4DR5E 1FKAE 1NEIA 4F6NA 4TUGA 2LMZA 4F6MA 4JYAE 4Q35B 2EMXA 1DGCA 2NABA 1T4OA 4O43A 2EPLX 2YTNA 5FLXC 4R2QA 3T1YE 2EMHA 4R2EA 4RHBB 4DV6E 4X66E 2EL4A 1HNWE 5T6JA 1WXRA 2LT7A 3IWDA 1UILA 1GTKA 4DV2E 4BBYA 2I13A 1UN6B 2L92A 2YTFA 1IBLE 4LFBE 3C4BA 1G2FC 2NUGA 4X62E 2I9IA 2EM5A 1ZBQA 3F6GA 2EMBA 2HHHE 2JPAA 2UXDE 1J26A 2B7VA 4B3TE 3M99B 1X49A 2N3GA 1YYWA 3F6HA 2NUFA 2EPOA 2YRHA 2EQ1A 2EOZA 2VRDA 2EMAA 1T39A 2IHR1
chains in the Genus database with same CATH topology
2NUEA 2EWLA 4KZSA 2UXCE 4LU9A 2MC6A 4TUIA 4M30A 3HTXA 4DV3E 2K4VA 2LTSA 3HQ1A 3IWBA 2CPNA 4F9AB 1EKZA 2V87A 3IWCA 2JOXA 3DJWA 2RS6A 1YYOA 4X65E 1DQ3A 1HNZE 2LBSB 2N3HA 2G7HA 2L8TA 3AV0A 2FV4B 2JR1A 1WHQA 2JVAA 4WFTA 2L3JA 2LUPB 2M4IA 2VF1A 3FIGA 3ADLA 4DR7E 1HR0E 2YT4A 3KWRA 4BS9A 5A2QC 2UUCE 4LF9E 2B7TA 4F9BB 1STUA 1T4LB 2L3CA 4JI5E 4DUYE 1QU6A 2FGGA 1T4NA 5LMNE 2LTRA 4J8ZA 4BC7A 4JI0E 2ODRD 1XNQE 5DNYA 2L2NA 4M2ZA 2L33A 4F54A 2JY9A 1RQ0A 2VE7C 3J81C 2RTXA 1XMQE 3ZOQB 4P7DA 5LMUE 3LLHA 1YZ9A 4DKKA 4LF4E 2LJHA 1GZ6A 2V89A 3JTZA 2YZTA 3P1XA 4DR6E 1XMOE 1N33E 1YYKA 2VQFE 4Q28A 1SR9A 2KHXA 2LE2A 4JI7E 4DUZE 4B3ME 2B3TB 4OX9E 4WSPA 3RMPA 2M7QA 5AE3A 4NXNE 2F4VE 4K0KE 1J5EE 4DMIA 2V83A 2V8QB 5AASA 3HPZA 2ZM6E 1IBKE 3VYYA 2DB2A 2VQEE 3OMLA 3H09A 4R03A 4BC9A 1HNXE 4M0VA 1UHZA 3VYXA 3J7AG 4DV4E 2E5LE 1RC7A 2L2KB 4JI6E 3J80C 1N36E 4LF8E 4NXME 1N32E 2EZ6A 3ADIA 2V85A 2UUBE 4GKKE 4DV0E 2V86A 5ADZA 1FKAE 4DR5E 4AQYE 4TUGA 2LMZA 3AUZA 4B3SE 4DV7E 2JOBA 4LTYA 4JYAE 2ODRC 4R8OA 2DIXA 3ADGA 2H36X 4JI1E 2LUQA 2F8BA 2KOUA 4DR3E 1IBME 1T4OA 4I8OA 5AE2A 5FLXC 4JI4E 5LL6R 4DV5E 3T1YE 2UXBE 3J7Yp 4DR2E 4OOGC 2RSMA 1GQEA 4LF7E 4DV6E 2V88A 4X66E 2L6MA 1HNWE 5T6JA 1PKPA 1WXRA 2UUAE 4JI2E 3JAMC 5F3WA 4YY3E 3JU0A 4BMJA 3IWDA 4YHHE 4GKJE 1UILA 4DV2E 1N34E 1WHNA 2M1SA 4BBYA 4X64E 4JI3E 1X47A 2L92A 3ADJA 1IBLE 4LFBE 4LFCE 2WZOA 2RS7A 3C4BA 4X8WA 4DV1E 2NUGA 1DI2A 1O0WA 4X62E 3K6QA 3MSWA 4JI8E 3OTOE 4LFAE 4P78A 2FTXB 1ZBQA 3F6GA 1X48A 2L2MA 3C4TA 2HHHE 3VK6A 2KONA 5IWAE 4WYQB 2UXDE 2JWOA 5CFFE 2MDRA 1J26A 3HXLA 2B7VA 3DF6A 4BCAA 4B3TE 3T1HE 1XNRE 2DSYA 1X49A 4L5NC 4LF6E 4JV5E 2B9DA 4GEQB 2E1MA 4L8NA 1FJGE 5BR8E 2N3GA 2UU9E 3LMLA 4F9CB 1YYWA 4DR1E 4WPYA 3HPSA 4KHPE 3F6HA 2NUFA 2LRSA 4B3RE 2MC5A 5IT9C 1ZBTA 2DMYA 4DR4E 4LF5E 5AE1A 1I94E 2NA2A 2IHR1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUE A;  2UXC E;  3HTX A;  4M30 A;  4DV3 E;  2LTS A;  2CPN A;  1EKZ A;  2RS6 A;  1YYO A;  4X65 E;  1HNZ E;  2LBS B;  2N3H A;  2JVA A;  1WHQ A;  2L3J A;  4WFT A;  2LUP B;  3ADL A;  4DR7 E;  1HR0 E;  2YT4 A;  2UUC E;  4LF9 E;  2B7T A;  1STU A;  1T4L B;  2L3C A;  4JI5 E;  4DUY E;  1QU6 A;  1T4N A;  5LMN E;  2LTR A;  4JI0 E;  1XNQ E;  2L2N A;  4M2Z A;  2L33 A;  2JY9 A;  1RQ0 A;  2RTX A;  1XMQ E;  5LMU E;  1YZ9 A;  3LLH A;  4DKK A;  4LF4 E;  2LJH A;  3P1X A;  4DR6 E;  1XMO E;  1N33 E;  1YYK A;  2VQF E;  2KHX A;  4JI7 E;  4DUZ E;  4B3M E;  2B3T B;  4OX9 E;  4NXN E;  2F4V E;  4K0K E;  1J5E E;  2ZM6 E;  1IBK E;  3VYY A;  2DB2 A;  2VQE E;  1HNX E;  1UHZ A;  3VYX A;  4DV4 E;  2E5L E;  1RC7 A;  2L2K B;  4JI6 E;  1N36 E;  4LF8 E;  4NXM E;  1N32 E;  2EZ6 A;  3ADI A;  2UUB E;  4GKK E;  4DV0 E;  1FKA E;  4DR5 E;  4AQY E;  4B3S E;  4DV7 E;  4JYA E;  2DIX A;  3ADG A;  4JI1 E;  2LUQ A;  4DR3 E;  1IBM E;  1T4O A;  4JI4 E;  4DV5 E;  3T1Y E;  2UXB E;  3J7Y p;  4DR2 E;  4OOG C;  2RSM A;  1GQE A;  4LF7 E;  4DV6 E;  4X66 E;  1HNW E;  1PKP A;  2UUA E;  4JI2 E;  4YY3 E;  4GKJ E;  1UIL A;  4DV2 E;  1N34 E;  1WHN A;  4X64 E;  4JI3 E;  1X47 A;  3ADJ A;  1IBL E;  4LFB E;  4LFC E;  2RS7 A;  3C4B A;  4X8W A;  4DV1 E;  2NUG A;  1DI2 A;  1O0W A;  4X62 E;  4JI8 E;  3OTO E;  4LFA E;  1X48 A;  2L2M A;  3C4T A;  2HHH E;  5IWA E;  4WYQ B;  2UXD E;  5CFF E;  2MDR A;  1J26 A;  2B7V A;  4B3T E;  3T1H E;  1XNR E;  1X49 A;  4LF6 E;  4JV5 E;  1FJG E;  5BR8 E;  2N3G A;  2UU9 E;  4KHP E;  1YYW A;  4DR1 E;  2NUF A;  2LRS A;  4B3R E;  1ZBT A;  2DMY A;  4DR4 E;  4LF5 E;  4YHH E;  1I94 E;  2NA2 A;  2IHR 1; 
#chains in the Genus database with same CATH topology
 2NUE A;  2YSO A;  4TUI A;  2K4V A;  2EPR A;  3IWC A;  2YTD A;  3BID A;  2G7H A;  2L8T A;  3AV0 A;  2L3J A;  2DRP A;  1PJS A;  2M4I A;  2UUC E;  2EMZ A;  4F9B B;  2L3C A;  2EMK A;  4IS1 C;  4ZYD A;  5A6J A;  2LTR A;  4J8Z A;  3TQM A;  2YU5 A;  4F54 A;  1YFH A;  4O4K A;  1QNT A;  4O5G A;  4R2A A;  2EPM X;  3P1X A;  4DR6 E;  1WJP A;  1N33 E;  2EOH A;  1X6H A;  2VQF E;  4GZN C;  1A1I A;  4WSP A;  2EPU A;  4M9V C;  1J5E E;  2EM0 A;  2ELY A;  3VYY A;  1BB8 A;  2E72 A;  2VQE E;  3OML A;  2EL5 A;  2DLQ A;  2YU8 A;  4M0V A;  3VYX A;  1X6F A;  4JI6 E;  3J80 C;  1N36 E;  3ADI A;  2EP3 A;  2UUB E;  2K7I A;  4DV0 E;  2EM6 A;  2RSI A;  4BHB A;  3AUZ A;  4B3S E;  2H36 X;  3MHH C;  5AE2 A;  3J7Y p;  4DR2 E;  1T38 A;  2RSM A;  4LF7 E;  1A1F A;  3EPH A;  5F3W A;  1KYQ A;  2ENC A;  3VHT B;  1X47 A;  2DGC A;  4BHC A;  2EN7 A;  1O0W A;  3K6Q A;  3MSW A;  4FK5 C;  2FTX B;  3C4T A;  2GPI A;  4R2R A;  3DF6 A;  2YTP A;  1PJQ A;  4L5N C;  4GEQ B;  2E1M A;  1FJG E;  5BR8 E;  4R2D A;  2EMY A;  2YPN A;  3LML A;  4KHP E;  4WPY A;  2EOO A;  4B3R E;  1YPN A;  1YUI A;  5IT9 C;  2DMY A;  2YTG A;  4LF5 E;  5AE1 A;  4WXC A;  4KZS A;  2UXC E;  4LU9 A;  2MC6 A;  1MGT A;  1EKZ A;  5A6K A;  2EOM A;  2JOX A;  2J7J A;  2RS6 A;  1YYO A;  1A1G A;  1DQ3 A;  2EMW A;  1HNZ E;  2EOX A;  4ZYE A;  1EH6 A;  1P47 A;  2FV4 B;  2LUP B;  1AH5 A;  2YT4 A;  3KWR A;  2YWQ A;  1TF6 A;  1T4L B;  4JI5 E;  4DUY E;  1T4N A;  4N4R B;  3EPL A;  1WRJ A;  4JI0 E;  2ODR D;  5DNY A;  2JY9 A;  1RQ0 A;  2LO3 A;  2EPK X;  2VE7 C;  4R2C A;  3EPK A;  1XMQ E;  3MHS C;  2EPX A;  4DKK A;  2YTO A;  2GHF A;  4KWY A;  1EH8 A;  2YTJ A;  1IMU A;  1YYK A;  2KHX A;  2CTD A;  4OX9 E;  2EPZ A;  3RMP A;  2M7Q A;  5AE3 A;  2EOI A;  2YRK A;  2EN4 A;  2ZM6 E;  2V83 A;  1IBK E;  2EM9 A;  2EOS A;  3H09 A;  2CSH A;  1HNX E;  1BBO A;  2E5L E;  1N32 E;  4LF8 E;  4NXM E;  2EZ6 A;  4GKK E;  2WBT A;  2EOJ A;  4AQY E;  4X9J A;  2ENH A;  1KJK A;  1SFE A;  2ODR C;  3THN A;  2DIX A;  3ADG A;  2LUQ A;  2KOU A;  4I8O A;  4JI4 E;  4DV5 E;  4NHR A;  4OOG C;  1GQE A;  5A69 A;  2L6M A;  2R76 A;  1PKP A;  2UUA E;  2CT1 A;  3JAM C;  4O24 A;  4GKJ E;  4YHH E;  2Q8U A;  2EN2 A;  1PJT A;  2EN3 A;  4X64 E;  4JI3 E;  2R1F A;  2DLK A;  3ADJ A;  1X5W A;  4LFC E;  2WZO A;  4DV1 E;  1DI2 A;  4NZV A;  2LV2 A;  4LFA E;  4P78 A;  2HGH A;  1X48 A;  4MLQ A;  3VK6 A;  2EPC A;  5IWA E;  2JWO A;  2MDR A;  5KL2 A;  3KZZ A;  2JP9 A;  1XNR E;  2DSY A;  2EML A;  4LF6 E;  4JV5 E;  2B9D A;  4L8N A;  1JK2 A;  2EOQ A;  4F9C B;  5KL6 A;  2EM8 A;  3HPS A;  4DR1 E;  2LRS A;  2MC5 A;  1ZBT A;  4DR4 E;  4MLV A;  2M9A A;  1I94 E;  2EWL A;  1TN9 A;  2EM3 A;  4M30 A;  3IWB A;  4F9A B;  2V87 A;  1A1L A;  3DJW A;  3EPJ A;  1UBD C;  4X65 E;  2EN1 A;  2RQL A;  2N3H A;  5KL3 A;  2JR1 A;  2JVA A;  5LLQ A;  2VF1 A;  1LLM C;  5A2Q C;  1MEY C;  2B7T A;  4R2P A;  1STU A;  1Z1B A;  2PRT A;  1X6E A;  2YRM A;  1QU6 A;  2FGG A;  5A6B D;  1EH7 A;  4BC7 A;  2D9H A;  2MKD A;  2EOF A;  2LVH A;  2EPN A;  2RTX A;  4RH8 A;  5LMU E;  4LF4 E;  4ZYH A;  2LJH A;  1YSA C;  1GZ6 A;  3JTZ A;  1IQO A;  2YZT A;  4WXD A;  1XMO E;  1BBG A;  4Q28 A;  2EM2 A;  2LE2 A;  4JI7 E;  1F2I G;  2MKN A;  2GLI A;  2B3T B;  4NXN E;  2F4V E;  4K0K E;  3HPZ A;  2ENA A;  2DB2 A;  3UK3 C;  4BC9 A;  1UHZ A;  2EMF A;  4F2J C;  2LCE A;  4DV4 E;  2MDG A;  4HTG A;  2L2K B;  2WCC 3;  1RC7 A;  2HJJ A;  4IJD A;  5TSE A;  4DV7 E;  2JOB A;  4LTY A;  5AC5 A;  4R8O A;  4ZYG A;  4JI1 E;  1ZU1 A;  2F8B A;  4DR3 E;  1IBM E;  1N3G A;  3BF2 A;  5LL6 R;  2UXB E;  1X3C A;  2BBG A;  5KL4 A;  2EQ3 A;  2V88 A;  1B69 A;  2JYA A;  2EOE A;  4JI2 E;  1L4S A;  4YY3 E;  3JU0 A;  4BMJ A;  2EMI A;  1N34 E;  1WHN A;  2M1S A;  4WX9 A;  2EL6 A;  2EN8 A;  2RS7 A;  4X8W A;  1JK1 A;  1TF3 A;  5KL5 A;  4JI8 E;  1PDA A;  2EMC A;  3OTO E;  4WSG A;  2EPA A;  2L2M A;  2JXP A;  2KON A;  2EOY A;  2WBU A;  4WYQ B;  5CFF E;  1ZAA C;  3HXL A;  4BCA A;  2DMI A;  3T1H E;  2N8X A;  2EN6 A;  2UU9 E;  2EOR A;  5A6B A;  2YTI A;  2NA2 A;  1ZR9 A;  2A25 A;  3HTX A;  4R2S A;  4DV3 E;  2LTS A;  3HQ1 A;  2CPN A;  1A1K A;  2YTE A;  3KZY A;  2LBS B;  5A6A A;  1WHQ A;  2EM7 A;  1NCS A;  3C6K A;  4WFT A;  3FIG A;  3ADL A;  4DR7 E;  1HR0 E;  1G2D C;  4LF9 E;  4BS9 A;  2YSP A;  3C6M A;  5LMN E;  1XNQ E;  2L2N A;  4M2Z A;  2L33 A;  1IQS A;  3J81 C;  3EQ1 A;  1YUJ A;  1RMD A;  3ZOQ B;  4P7D A;  3BGH A;  3LLH A;  2EE8 A;  5IV8 B;  2EMG A;  1YZ9 A;  3BBG A;  1A1J A;  2ELZ A;  2V89 A;  5KL7 A;  2EPP A;  5AC4 A;  2ADR A;  2BB8 A;  1SR9 A;  4DUZ E;  2WBS A;  4B3M E;  3QG5 C;  4HEI A;  5IXM B;  4DMI A;  2V8Q B;  5AAS A;  3THO B;  3L00 A;  2EJ4 A;  2RPC A;  4R03 A;  2HC5 A;  2YTQ A;  1AAY A;  3J7A G;  2EQ0 A;  1A1H A;  3ECR A;  2V85 A;  2EM4 A;  2V86 A;  2LJU A;  5ADZ A;  4DR5 E;  1FKA E;  1NEI A;  4F6N A;  4TUG A;  2LMZ A;  4F6M A;  4JYA E;  4Q35 B;  2EMX A;  1DGC A;  2NAB A;  1T4O A;  4O43 A;  2EPL X;  2YTN A;  5FLX C;  4R2Q A;  3T1Y E;  2EMH A;  4R2E A;  4RHB B;  4DV6 E;  4X66 E;  2EL4 A;  1HNW E;  5T6J A;  1WXR A;  2LT7 A;  3IWD A;  1UIL A;  1GTK A;  4DV2 E;  4BBY A;  2I13 A;  1UN6 B;  2L92 A;  2YTF A;  1IBL E;  4LFB E;  3C4B A;  1G2F C;  2NUG A;  4X62 E;  2I9I A;  2EM5 A;  1ZBQ A;  3F6G A;  2EMB A;  2HHH E;  2JPA A;  2UXD E;  1J26 A;  2B7V A;  4B3T E;  3M99 B;  1X49 A;  2N3G A;  1YYW A;  3F6H A;  2NUF A;  2EPO A;  2YRH A;  2EQ1 A;  2EOZ A;  2VRD A;  2EMA A;  1T39 A;  2IHR 1; 
#chains in the Genus database with same CATH homology
 2NUE A;  2EWL A;  4KZS A;  2UXC E;  4LU9 A;  2MC6 A;  4TUI A;  4M30 A;  3HTX A;  4DV3 E;  2K4V A;  2LTS A;  3HQ1 A;  3IWB A;  2CPN A;  4F9A B;  1EKZ A;  2V87 A;  3IWC A;  2JOX A;  3DJW A;  2RS6 A;  1YYO A;  4X65 E;  1DQ3 A;  1HNZ E;  2LBS B;  2N3H A;  2G7H A;  2L8T A;  3AV0 A;  2FV4 B;  2JR1 A;  1WHQ A;  2JVA A;  4WFT A;  2L3J A;  2LUP B;  2M4I A;  2VF1 A;  3FIG A;  3ADL A;  4DR7 E;  1HR0 E;  2YT4 A;  3KWR A;  4BS9 A;  5A2Q C;  2UUC E;  4LF9 E;  2B7T A;  4F9B B;  1STU A;  1T4L B;  2L3C A;  4JI5 E;  4DUY E;  1QU6 A;  2FGG A;  1T4N A;  5LMN E;  2LTR A;  4J8Z A;  4BC7 A;  4JI0 E;  2ODR D;  1XNQ E;  5DNY A;  2L2N A;  4M2Z A;  2L33 A;  4F54 A;  2JY9 A;  1RQ0 A;  2VE7 C;  3J81 C;  2RTX A;  1XMQ E;  3ZOQ B;  4P7D A;  5LMU E;  3LLH A;  1YZ9 A;  4DKK A;  4LF4 E;  2LJH A;  1GZ6 A;  2V89 A;  3JTZ A;  2YZT A;  3P1X A;  4DR6 E;  1XMO E;  1N33 E;  1YYK A;  2VQF E;  4Q28 A;  1SR9 A;  2KHX A;  2LE2 A;  4JI7 E;  4DUZ E;  4B3M E;  2B3T B;  4OX9 E;  4WSP A;  3RMP A;  2M7Q A;  5AE3 A;  4NXN E;  2F4V E;  4K0K E;  1J5E E;  4DMI A;  2V83 A;  2V8Q B;  5AAS A;  3HPZ A;  2ZM6 E;  1IBK E;  3VYY A;  2DB2 A;  2VQE E;  3OML A;  3H09 A;  4R03 A;  4BC9 A;  1HNX E;  4M0V A;  1UHZ A;  3VYX A;  3J7A G;  4DV4 E;  2E5L E;  1RC7 A;  2L2K B;  4JI6 E;  3J80 C;  1N36 E;  4LF8 E;  4NXM E;  1N32 E;  2EZ6 A;  3ADI A;  2V85 A;  2UUB E;  4GKK E;  4DV0 E;  2V86 A;  5ADZ A;  1FKA E;  4DR5 E;  4AQY E;  4TUG A;  2LMZ A;  3AUZ A;  4B3S E;  4DV7 E;  2JOB A;  4LTY A;  4JYA E;  2ODR C;  4R8O A;  2DIX A;  3ADG A;  2H36 X;  4JI1 E;  2LUQ A;  2F8B A;  2KOU A;  4DR3 E;  1IBM E;  1T4O A;  4I8O A;  5AE2 A;  5FLX C;  4JI4 E;  5LL6 R;  4DV5 E;  3T1Y E;  2UXB E;  3J7Y p;  4DR2 E;  4OOG C;  2RSM A;  1GQE A;  4LF7 E;  4DV6 E;  2V88 A;  4X66 E;  2L6M A;  1HNW E;  5T6J A;  1PKP A;  1WXR A;  2UUA E;  4JI2 E;  3JAM C;  5F3W A;  4YY3 E;  3JU0 A;  4BMJ A;  3IWD A;  4YHH E;  4GKJ E;  1UIL A;  4DV2 E;  1N34 E;  1WHN A;  2M1S A;  4BBY A;  4X64 E;  4JI3 E;  1X47 A;  2L92 A;  3ADJ A;  1IBL E;  4LFB E;  4LFC E;  2WZO A;  2RS7 A;  3C4B A;  4X8W A;  4DV1 E;  2NUG A;  1DI2 A;  1O0W A;  4X62 E;  3K6Q A;  3MSW A;  4JI8 E;  3OTO E;  4LFA E;  4P78 A;  2FTX B;  1ZBQ A;  3F6G A;  1X48 A;  2L2M A;  3C4T A;  2HHH E;  3VK6 A;  2KON A;  5IWA E;  4WYQ B;  2UXD E;  2JWO A;  5CFF E;  2MDR A;  1J26 A;  3HXL A;  2B7V A;  3DF6 A;  4BCA A;  4B3T E;  3T1H E;  1XNR E;  2DSY A;  1X49 A;  4L5N C;  4LF6 E;  4JV5 E;  2B9D A;  4GEQ B;  2E1M A;  4L8N A;  1FJG E;  5BR8 E;  2N3G A;  2UU9 E;  3LML A;  4F9C B;  1YYW A;  4DR1 E;  4WPY A;  3HPS A;  4KHP E;  3F6H A;  2NUF A;  2LRS A;  4B3R E;  2MC5 A;  5IT9 C;  1ZBT A;  2DMY A;  4DR4 E;  4LF5 E;  5AE1 A;  1I94 E;  2NA2 A;  2IHR 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...