2CPNA

Solution structure of the second dsrbd of tar rna-binding protein 2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAR RNA-binding protein 2
publication title Solution structure of the second dsRBD of TAR RNA-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2cpnA01
1T4NA 1QU6A 2JY9A 4B3TE 2DMYA 2RS7A 3ADGA 2DIXA 1XNRE 4X65E 1I94E 4YY3E 3P1XA 4JI8E 4AQYE 2B7VA 1T4LB 1X49A 2LUQA 4LF5E 1X48A 4DV2E 4DV3E 5LMUE 4DR6E 2E5LE 1IBKE 2MDRA 2L3CA 2IHR1 2LTSA 1WHQA 2N3GA 4DV0E 4LF8E 3ADLA 4B3SE 4B3RE 4JI3E 4JI0E 4DR3E 4JI6E 3C4BA 4K0KE 4NXNE 3ADJA 2ZM6E 3OTOE 2EZ6A 4DR4E 2L33A 1STUA 1DI2A 2UXCE 2UUBE 2UU9E 1EKZA 1YYKA 4DUZE 4LF7E 2JVAA 4X64E 4DV5E 1YZ9A 4DR2E 1FJGE 4NXME 4GKJE 2F4VE 4DR7E 2UUCE 2LUPB 3C4TA 1J5EE 1XMOE 3HTXA 5CFFE 4DKKA 4JI7E 3T1HE 2UUAE 2NA2A 5LMNE 2UXDE 1J26A 4JI1E 4DV6E 4LFAE 3T1YE 5BR8E 1IBME 4DUYE 1N36E 2VQEE 2B7TA 1UILA 4OOGC 4DR5E 1RQ0A 2NUGA 2KHXA 4JI5E 1GQEA 1FKAE 4LF4E 4WYQB 1ZBTA 4JI4E 2NUEA 2UXBE 2L2KB 2CPNA 1HNWE 1X47A 2B3TB 4M2ZA 2NUFA 1RC7A 2DB2A 1YYOA 4X62E 4X8WA 4LFBE 1T4OA 2YT4A 2LTRA 2RSMA 4DV4E 4B3ME 1IBLE 4X66E 4DV7E 4JI2E 1N33E 2L2MA 1UHZA 4M30A 1WHNA 1HNZE 3LLHA 4YHHE 1N34E 4DV1E 3VYXA 1XNQE 4LFCE 2HHHE 4LF6E 4JV5E 2RTXA 3VYYA 4WFTA 2LJHA 1HNXE 3ADIA 2N3HA 2LBSB 1N32E 1PKPA 4JYAE 3J7Yp 4DR1E 1XMQE 4KHPE 2L2NA 4OX9E 2LRSA 2RS6A 1HR0E 2L3JA 4GKKE 1YYWA 5IWAE 4LF9E 2VQFE 1O0WA
chains in the Genus database with same CATH superfamily
3BF2A 2EOZA 1TF3A 5KL2A 2JOBA 5IXMB 3F6GA 2YTIA 1AAYA 1AH5A 2V86A 2LUQA 3MHSC 4IJDA 4DV3E 2GLIA 5DNYA 4IS1C 1N3GA 2IHR1 3J81C 2EMLA 1G2DC 2EOIA 1DQ3A 4BC7A 1TN9A 3M99B 4ZYEA 2ZM6E 3OTOE 1YFHA 3EPJA 4L5NC 2MKDA 1IQOA 3F6HA 2ELYA 4DUZE 4DMIA 2EORA 2WCC3 5AC5A 2EOFA 2EMWA 3HXLA 1A1KA 2ENHA 2LUPB 5A6KA 5AE2A 1J5EE 5FLXC 5CFFE 1BB8A 2LVHA 2EPPA 1X6FA 2VF1A 5AE3A 2NA2A 4R2RA 2UXDE 4F9BB 2EL5A 2V83A 4DV6E 4Q28A 1GZ6A 1A1LA 4DUYE 3K6QA 4GZNC 1RQ0A 4P78A 3HPSA 1FKAE 4WSPA 4HTGA 5F3WA 2L2KB 2YU8A 2NUFA 1RC7A 1JK2A 1RMDA 1ZU1A 1NCSA 1YYOA 2M1SA 2EPCA 4BHCA 2V89A 4X8WA 1T4OA 4DV4E 4B3ME 2EMIA 4X66E 4DV7E 2V87A 5KL4A 2EOHA 4F6NA 2WBUA 3KZYA 3JTZA 3LLHA 4YHHE 4DV1E 3EPLA 5A6BD 4LF6E 4BMJA 1WRJA 3VYYA 2YTDA 5A6JA 3LMLA 1WXRA 1HNXE 1X6HA 2FV4B 2LBSB 1N32E 2EM6A 2G7HA 3J7Yp 2MDGA 4DR1E 2ENCA 2EM7A 4KHPE 2EN8A 2I9IA 2YTJA 2YWQA 2R1FA 4OX9E 2MKNA 1YUIA 4NHRA 2RQLA 2YTEA 3H09A 4LF9E 2M4IA 2DMIA 2LO3A 2WBSA 2JY9A 3THNA 5TSEA 1F2IG 4YY3E 2GPIA 2D9HA 1ZBQA 4DV2E 2V88A 2LCEA 2YTGA 4ZYGA 2L3CA 2LTSA 2YPNA 4KZSA 2V8QB 2A25A 4R8OA 2EM0A 4B3SE 2EPAA 4ZYDA 4TUGA 4JI6E 2JPAA 4K0KE 2CTDA 4MLVA 1STUA 2YU5A 2JP9A 5AE1A 2UUBE 2EQ3A 2M9AA 2JVAA 2YRHA 4X64E 4LF7E 2CSHA 3AV0A 2EM2A 2EN3A 2EPRA 2EPOA 1EH6A 4O4KA 2EMYA 2N8XA 4R2AA 4DR2E 4NXME 2ODRC 4F9AB 1Z1BA 2UUCE 2EPXA 2EN2A 4R2QA 1B69A 2B9DA 1YSAC 2F8BA 4JI7E 3T1HE 3DJWA 2NABA 2ODRD 5LMNE 2EPZA 1IQSA 4ZYHA 4JI1E 2HJJA 2K7IA 5BR8E 5A6BA 4BCAA 2EQ0A 1LLMC 1PJQA 3TQMA 3UK3C 1N36E 2I13A 2B7TA 2LV2A 2NUGA 2E1MA 2EMHA 2LJUA 1KJKA 4WYQB 2YRMA 2EN7A 2BBGA 2CPNA 1HNWE 1EH8A 2MC5A 2EOQA 1NEIA 5AASA 4X62E 1PJSA 2EN6A 1PDAA 2EM5A 4I8OA 2YTOA 2EOEA 5A2QC 4WXDA 2JWOA 1N34E 1T38A 3C6MA 1XNQE 5A69A 3MHHC 4F2JC 2LJHA 3OMLA 2WZOA 2EQ1A 2L8TA 2FGGA 1PKPA 4JYAE 3HPZA 2EOYA 1KYQA 2EPNA 3KZZA 2YTPA 2DRPA 2YSPA 5KL5A 1HR0E 2L3JA 2YTQA 2DGCA 2YTNA 2YTFA 3L00A 4B3TE 1QU6A 2EL4A 2DLQA 4X65E 3P1XA 4JI8E 2EMCA 3MSWA 4LF5E 2EOMA 2EPLX 3IWCA 5LMUE 3C6KA 1MGTA 1X6EA 2WBTA 3J80C 2M7QA 1WHQA 1T39A 2N3GA 4B3RE 1A1FA 4R2DA 4JI0E 3C4BA 4M9VC 2VRDA 2EPUA 3KWRA 2HC5A 2LE2A 2EZ6A 2L33A 1X3CA 1EKZA 3EPHA 1YYKA 1YZ9A 2EMFA 3DF6A 3VK6A 2BB8A 2VE7C 3ECRA 4O43A 4BBYA 4R2CA 2F4VE 2EOXA 4DR7E 3HTXA 1ZR9A 4WXCA 4DKKA 4R2SA 2EMXA 5IT9C 2UUAE 4O5GA 1MEYC 4BS9A 4Q35B 3T1YE 2JXPA 3BIDA 2VQEE 1YUJA 1YPNA 1JK1A 2ELZA 5LL6R 4TUIA 1ZBTA 4JI4E 5ADZA 4MLQA 1X47A 2B3TB 3BBGA 1WJPA 3J7AG 1X5WA 2LTRA 1IBLE 4M0VA 4JI2E 5KL6A 2GHFA 1UHZA 2KOUA 2L92A 1WHNA 2RSIA 2JYAA 1HNZE 2ENAA 2EE8A 4LFCE 2HHHE 2KONA 5A6AA 2PRTA 2RTXA 4WFTA 4F54A 2YSOA 3IWDA 3ADIA 2J7JA 2EJ4A 5T6JA 1PJTA 2L6MA 1XMQE 4KWYA 2H36X 2JR1A 2RS6A 4BC9A 3EPKA 4GKKE 2EP3A 4NZVA 1YYWA 2EN1A 5KL3A 2EN4A 3JU0A 1O0WA 4R2EA 2MC6A 1T4NA 2DMYA 2RS7A 3ADGA 2DIXA 5KL7A 1XNRE 1I94E 3QG5C 2V85A 2EPMX 2EM9A 4AQYE 2B7VA 1T4LB 1X49A 3VHTB 4F6MA 3EQ1A 1X48A 2EL6A 1G2FC 4DR6E 4P7DA 2E5LE 4BHBA 4J8ZA 4RHBB 3AUZA 1IBKE 2MDRA 1A1HA 4N4RB 2VQFE 4DV0E 4LF8E 3FIGA 3ADLA 4R2PA 4JI3E 4WPYA 4DR3E 4NXNE 3ADJA 2YZTA 4GEQB 4DR4E 2HGHA 1DI2A 3RMPA 2UXCE 2UU9E 1UN6B 2EMZA 4X9JA 4DV5E 1A1IA 5LLQA 1FJGE 1GTKA 2EWLA 3JAMC 4GKJE 3C4TA 1BBGA 1XMOE 2EM4A 2R76A 2CT1A 2EOJA 2EMKA 2EMAA 4HEIA 2EMBA 2ADRA 4F9CB 1A1JA 1J26A 5AC4A 4LFAE 2Q8UA 1IBME 1IMUA 3IWBA 1EH7A 1UILA 4OOGC 4DR5E 2KHXA 2EOSA 4JI5E 2EM3A 1GQEA 4R03A 4LF4E 2NUEA 2UXBE 3BGHA 2EM8A 2K4VA 2E72A 2EOOA 2JOXA 4LU9A 1TF6A 4M2ZA 2DB2A 4LFBE 2YT4A 2RSMA 1SR9A 2LMZA 2RPCA 1N33E 2L2MA 4WSGA 2FTXB 4M30A 1P47A 2LT7A 4L8NA 3VYXA 2EPKX 2DLKA 4JV5E 1QNTA 2DSYA 5IV8B 3THOB 1UBDC 2N3HA 1L4SA 1BBOA 1SFEA 2YRKA 4O24A 1DGCA 4LTYA 4RH8A 4FK5C 2L2NA 2LRSA 1ZAAC 3HQ1A 1A1GA 2EMGA 3ZOQB 5IWAE 4WX9A
chains in the Genus database with same CATH topology
1T4NA 1QU6A 2JY9A 4B3TE 2DMYA 2RS7A 3ADGA 2JOBA 3F6GA 2DIXA 1XNRE 4X65E 1I94E 2V85A 4YY3E 3P1XA 4JI8E 4AQYE 2B7VA 1T4LB 1X49A 2V86A 2LUQA 1ZBQA 3MSWA 4LF5E 1X48A 4DV2E 4DV3E 3IWCA 2V88A 5LMUE 4DR6E 4P7DA 5DNYA 2E5LE 4J8ZA 3AUZA 3J80C 1IBKE 2MDRA 2M7QA 2L3CA 2IHR1 2LTSA 1WHQA 3J81C 4KZSA 2V8QB 2N3GA 4R8OA 4DV0E 3FIGA 4B3SE 4LF8E 3ADLA 4B3RE 4TUGA 4JI0E 4WPYA 4DR3E 1DQ3A 4JI3E 3C4BA 4JI6E 4NXNE 4K0KE 4BC7A 3ADJA 3KWRA 2YZTA 4GEQB 2LE2A 3OTOE 2ZM6E 2EZ6A 4DR4E 1FKAE 4L5NC 2L33A 1STUA 3RMPA 1DI2A 2UXCE 5AE1A 2UUBE 2UU9E 1EKZA 1YYKA 3F6HA 4DUZE 4LF7E 4DMIA 2JVAA 4X64E 4DV5E 3AV0A 1YZ9A 3DF6A 3VK6A 3HXLA 4DR2E 1FJGE 2VE7C 2EWLA 3JAMC 4NXME 2ODRC 4BBYA 4GKJE 4F9AB 2F4VE 4DR7E 2UUCE 2LUPB 3C4TA 5AE2A 1J5EE 5FLXC 1XMOE 3HTXA 5CFFE 2B9DA 2F8BA 4DKKA 4JI7E 2VF1A 5AE3A 3T1HE 3DJWA 5IT9C 2UUAE 2NA2A 2ODRD 5LMNE 2UXDE 4F9CB 4F9BB 1J26A 4LF4E 2V83A 4JI1E 4BS9A 4DV6E 3T1YE 4Q28A 4LFAE 5BR8E 1IBME 4BCAA 1GZ6A 3IWBA 4DUYE 1N36E 2VQEE 2B7TA 1UILA 3K6QA 4OOGC 4DR5E 1RQ0A 2NUGA 2KHXA 2E1MA 4P78A 5LL6R 4JI5E 1GQEA 3HPSA 4R03A 4WYQB 1ZBTA 4WSPA 4TUIA 5F3WA 2L2KB 2CPNA 5ADZA 4JI4E 2NUEA 1HNWE 2K4VA 1X47A 2UXBE 2B3TB 2JOXA 2MC5A 4LU9A 2NUFA 4M2ZA 1RC7A 2DB2A 1YYOA 2M1SA 3J7AG 1O0WA 2V89A 5AASA 4X62E 4X8WA 4LFBE 1T4OA 2YT4A 2LTRA 2RSMA 1SR9A 4DV4E 4B3ME 1IBLE 4X66E 4M0VA 4DV7E 4JI2E 2V87A 2LMZA 1N33E 2L2MA 4I8OA 1UHZA 2FTXB 2KOUA 1WHNA 2L92A 4M30A 5A2QC 2JWOA 3JTZA 1HNZE 3LLHA 4YHHE 4L8NA 4DV1E 1N34E 3VYXA 1XNQE 4LFCE 2HHHE 2KONA 4BMJA 4LF6E 4JV5E 2RTXA 2DSYA 3VYYA 4WFTA 4F54A 2LJHA 3LMLA 1WXRA 3IWDA 3OMLA 1HNXE 2WZOA 3ADIA 2FV4B 2L8TA 2FGGA 2N3HA 2LBSB 1N32E 1PKPA 5T6JA 4JYAE 2G7HA 3HPZA 3J7Yp 4DR1E 2L6MA 4LTYA 1XMQE 4KHPE 2L2NA 2H36X 2JR1A 4OX9E 2LRSA 2RS6A 1HR0E 4BC9A 2L3JA 4GKKE 1YYWA 3HQ1A 3H09A 3JU0A 3ZOQB 5IWAE 4LF9E 2VQFE 2M4IA 2MC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4N A;  1QU6 A;  2JY9 A;  4B3T E;  2DMY A;  2RS7 A;  3ADG A;  2DIX A;  1XNR E;  4X65 E;  1I94 E;  4YY3 E;  3P1X A;  4JI8 E;  4AQY E;  2B7V A;  1T4L B;  1X49 A;  2LUQ A;  4LF5 E;  1X48 A;  4DV2 E;  4DV3 E;  5LMU E;  4DR6 E;  2E5L E;  1IBK E;  2MDR A;  2L3C A;  2IHR 1;  2LTS A;  1WHQ A;  2N3G A;  4DV0 E;  4LF8 E;  3ADL A;  4B3S E;  4B3R E;  4JI3 E;  4JI0 E;  4DR3 E;  4JI6 E;  3C4B A;  4K0K E;  4NXN E;  3ADJ A;  2ZM6 E;  3OTO E;  2EZ6 A;  4DR4 E;  2L33 A;  1STU A;  1DI2 A;  2UXC E;  2UUB E;  2UU9 E;  1EKZ A;  1YYK A;  4DUZ E;  4LF7 E;  2JVA A;  4X64 E;  4DV5 E;  1YZ9 A;  4DR2 E;  1FJG E;  4NXM E;  4GKJ E;  2F4V E;  4DR7 E;  2UUC E;  2LUP B;  3C4T A;  1J5E E;  1XMO E;  3HTX A;  5CFF E;  4DKK A;  4JI7 E;  3T1H E;  2UUA E;  2NA2 A;  5LMN E;  2UXD E;  1J26 A;  4JI1 E;  4DV6 E;  4LFA E;  3T1Y E;  5BR8 E;  1IBM E;  4DUY E;  1N36 E;  2VQE E;  2B7T A;  1UIL A;  4OOG C;  4DR5 E;  1RQ0 A;  2NUG A;  2KHX A;  4JI5 E;  1GQE A;  1FKA E;  4LF4 E;  4WYQ B;  1ZBT A;  4JI4 E;  2NUE A;  2UXB E;  2L2K B;  2CPN A;  1HNW E;  1X47 A;  2B3T B;  4M2Z A;  2NUF A;  1RC7 A;  2DB2 A;  1YYO A;  4X62 E;  4X8W A;  4LFB E;  1T4O A;  2YT4 A;  2LTR A;  2RSM A;  4DV4 E;  4B3M E;  1IBL E;  4X66 E;  4DV7 E;  4JI2 E;  1N33 E;  2L2M A;  1UHZ A;  4M30 A;  1WHN A;  1HNZ E;  3LLH A;  4YHH E;  1N34 E;  4DV1 E;  3VYX A;  1XNQ E;  4LFC E;  2HHH E;  4LF6 E;  4JV5 E;  2RTX A;  3VYY A;  4WFT A;  2LJH A;  1HNX E;  3ADI A;  2N3H A;  2LBS B;  1N32 E;  1PKP A;  4JYA E;  3J7Y p;  4DR1 E;  1XMQ E;  4KHP E;  2L2N A;  4OX9 E;  2LRS A;  2RS6 A;  1HR0 E;  2L3J A;  4GKK E;  1YYW A;  5IWA E;  4LF9 E;  2VQF E;  1O0W A; 
#chains in the Genus database with same CATH topology
 3BF2 A;  2EOZ A;  1TF3 A;  5KL2 A;  2JOB A;  5IXM B;  3F6G A;  2YTI A;  1AAY A;  1AH5 A;  2V86 A;  2LUQ A;  3MHS C;  4IJD A;  4DV3 E;  2GLI A;  5DNY A;  4IS1 C;  1N3G A;  2IHR 1;  3J81 C;  2EML A;  1G2D C;  2EOI A;  1DQ3 A;  4BC7 A;  1TN9 A;  3M99 B;  4ZYE A;  2ZM6 E;  3OTO E;  1YFH A;  3EPJ A;  4L5N C;  2MKD A;  1IQO A;  3F6H A;  2ELY A;  4DUZ E;  4DMI A;  2EOR A;  2WCC 3;  5AC5 A;  2EOF A;  2EMW A;  3HXL A;  1A1K A;  2ENH A;  2LUP B;  5A6K A;  5AE2 A;  1J5E E;  5FLX C;  5CFF E;  1BB8 A;  2LVH A;  2EPP A;  1X6F A;  2VF1 A;  5AE3 A;  2NA2 A;  4R2R A;  2UXD E;  4F9B B;  2EL5 A;  2V83 A;  4DV6 E;  4Q28 A;  1GZ6 A;  1A1L A;  4DUY E;  3K6Q A;  4GZN C;  1RQ0 A;  4P78 A;  3HPS A;  1FKA E;  4WSP A;  4HTG A;  5F3W A;  2L2K B;  2YU8 A;  2NUF A;  1RC7 A;  1JK2 A;  1RMD A;  1ZU1 A;  1NCS A;  1YYO A;  2M1S A;  2EPC A;  4BHC A;  2V89 A;  4X8W A;  1T4O A;  4DV4 E;  4B3M E;  2EMI A;  4X66 E;  4DV7 E;  2V87 A;  5KL4 A;  2EOH A;  4F6N A;  2WBU A;  3KZY A;  3JTZ A;  3LLH A;  4YHH E;  4DV1 E;  3EPL A;  5A6B D;  4LF6 E;  4BMJ A;  1WRJ A;  3VYY A;  2YTD A;  5A6J A;  3LML A;  1WXR A;  1HNX E;  1X6H A;  2FV4 B;  2LBS B;  1N32 E;  2EM6 A;  2G7H A;  3J7Y p;  2MDG A;  4DR1 E;  2ENC A;  2EM7 A;  4KHP E;  2EN8 A;  2I9I A;  2YTJ A;  2YWQ A;  2R1F A;  4OX9 E;  2MKN A;  1YUI A;  4NHR A;  2RQL A;  2YTE A;  3H09 A;  4LF9 E;  2M4I A;  2DMI A;  2LO3 A;  2WBS A;  2JY9 A;  3THN A;  5TSE A;  1F2I G;  4YY3 E;  2GPI A;  2D9H A;  1ZBQ A;  4DV2 E;  2V88 A;  2LCE A;  2YTG A;  4ZYG A;  2L3C A;  2LTS A;  2YPN A;  4KZS A;  2V8Q B;  2A25 A;  4R8O A;  2EM0 A;  4B3S E;  2EPA A;  4ZYD A;  4TUG A;  4JI6 E;  2JPA A;  4K0K E;  2CTD A;  4MLV A;  1STU A;  2YU5 A;  2JP9 A;  5AE1 A;  2UUB E;  2EQ3 A;  2M9A A;  2JVA A;  2YRH A;  4X64 E;  4LF7 E;  2CSH A;  3AV0 A;  2EM2 A;  2EN3 A;  2EPR A;  2EPO A;  1EH6 A;  4O4K A;  2EMY A;  2N8X A;  4R2A A;  4DR2 E;  4NXM E;  2ODR C;  4F9A B;  1Z1B A;  2UUC E;  2EPX A;  2EN2 A;  4R2Q A;  1B69 A;  2B9D A;  1YSA C;  2F8B A;  4JI7 E;  3T1H E;  3DJW A;  2NAB A;  2ODR D;  5LMN E;  2EPZ A;  1IQS A;  4ZYH A;  4JI1 E;  2HJJ A;  2K7I A;  5BR8 E;  5A6B A;  4BCA A;  2EQ0 A;  1LLM C;  1PJQ A;  3TQM A;  3UK3 C;  1N36 E;  2I13 A;  2B7T A;  2LV2 A;  2NUG A;  2E1M A;  2EMH A;  2LJU A;  1KJK A;  4WYQ B;  2YRM A;  2EN7 A;  2BBG A;  2CPN A;  1HNW E;  1EH8 A;  2MC5 A;  2EOQ A;  1NEI A;  5AAS A;  4X62 E;  1PJS A;  2EN6 A;  1PDA A;  2EM5 A;  4I8O A;  2YTO A;  2EOE A;  5A2Q C;  4WXD A;  2JWO A;  1N34 E;  1T38 A;  3C6M A;  1XNQ E;  5A69 A;  3MHH C;  4F2J C;  2LJH A;  3OML A;  2WZO A;  2EQ1 A;  2L8T A;  2FGG A;  1PKP A;  4JYA E;  3HPZ A;  2EOY A;  1KYQ A;  2EPN A;  3KZZ A;  2YTP A;  2DRP A;  2YSP A;  5KL5 A;  1HR0 E;  2L3J A;  2YTQ A;  2DGC A;  2YTN A;  2YTF A;  3L00 A;  4B3T E;  1QU6 A;  2EL4 A;  2DLQ A;  4X65 E;  3P1X A;  4JI8 E;  2EMC A;  3MSW A;  4LF5 E;  2EOM A;  2EPL X;  3IWC A;  5LMU E;  3C6K A;  1MGT A;  1X6E A;  2WBT A;  3J80 C;  2M7Q A;  1WHQ A;  1T39 A;  2N3G A;  4B3R E;  1A1F A;  4R2D A;  4JI0 E;  3C4B A;  4M9V C;  2VRD A;  2EPU A;  3KWR A;  2HC5 A;  2LE2 A;  2EZ6 A;  2L33 A;  1X3C A;  1EKZ A;  3EPH A;  1YYK A;  1YZ9 A;  2EMF A;  3DF6 A;  3VK6 A;  2BB8 A;  2VE7 C;  3ECR A;  4O43 A;  4BBY A;  4R2C A;  2F4V E;  2EOX A;  4DR7 E;  3HTX A;  1ZR9 A;  4WXC A;  4DKK A;  4R2S A;  2EMX A;  5IT9 C;  2UUA E;  4O5G A;  1MEY C;  4BS9 A;  4Q35 B;  3T1Y E;  2JXP A;  3BID A;  2VQE E;  1YUJ A;  1YPN A;  1JK1 A;  2ELZ A;  5LL6 R;  4TUI A;  1ZBT A;  4JI4 E;  5ADZ A;  4MLQ A;  1X47 A;  2B3T B;  3BBG A;  1WJP A;  3J7A G;  1X5W A;  2LTR A;  1IBL E;  4M0V A;  4JI2 E;  5KL6 A;  2GHF A;  1UHZ A;  2KOU A;  2L92 A;  1WHN A;  2RSI A;  2JYA A;  1HNZ E;  2ENA A;  2EE8 A;  4LFC E;  2HHH E;  2KON A;  5A6A A;  2PRT A;  2RTX A;  4WFT A;  4F54 A;  2YSO A;  3IWD A;  3ADI A;  2J7J A;  2EJ4 A;  5T6J A;  1PJT A;  2L6M A;  1XMQ E;  4KWY A;  2H36 X;  2JR1 A;  2RS6 A;  4BC9 A;  3EPK A;  4GKK E;  2EP3 A;  4NZV A;  1YYW A;  2EN1 A;  5KL3 A;  2EN4 A;  3JU0 A;  1O0W A;  4R2E A;  2MC6 A;  1T4N A;  2DMY A;  2RS7 A;  3ADG A;  2DIX A;  5KL7 A;  1XNR E;  1I94 E;  3QG5 C;  2V85 A;  2EPM X;  2EM9 A;  4AQY E;  2B7V A;  1T4L B;  1X49 A;  3VHT B;  4F6M A;  3EQ1 A;  1X48 A;  2EL6 A;  1G2F C;  4DR6 E;  4P7D A;  2E5L E;  4BHB A;  4J8Z A;  4RHB B;  3AUZ A;  1IBK E;  2MDR A;  1A1H A;  4N4R B;  2VQF E;  4DV0 E;  4LF8 E;  3FIG A;  3ADL A;  4R2P A;  4JI3 E;  4WPY A;  4DR3 E;  4NXN E;  3ADJ A;  2YZT A;  4GEQ B;  4DR4 E;  2HGH A;  1DI2 A;  3RMP A;  2UXC E;  2UU9 E;  1UN6 B;  2EMZ A;  4X9J A;  4DV5 E;  1A1I A;  5LLQ A;  1FJG E;  1GTK A;  2EWL A;  3JAM C;  4GKJ E;  3C4T A;  1BBG A;  1XMO E;  2EM4 A;  2R76 A;  2CT1 A;  2EOJ A;  2EMK A;  2EMA A;  4HEI A;  2EMB A;  2ADR A;  4F9C B;  1A1J A;  1J26 A;  5AC4 A;  4LFA E;  2Q8U A;  1IBM E;  1IMU A;  3IWB A;  1EH7 A;  1UIL A;  4OOG C;  4DR5 E;  2KHX A;  2EOS A;  4JI5 E;  2EM3 A;  1GQE A;  4R03 A;  4LF4 E;  2NUE A;  2UXB E;  3BGH A;  2EM8 A;  2K4V A;  2E72 A;  2EOO A;  2JOX A;  4LU9 A;  1TF6 A;  4M2Z A;  2DB2 A;  4LFB E;  2YT4 A;  2RSM A;  1SR9 A;  2LMZ A;  2RPC A;  1N33 E;  2L2M A;  4WSG A;  2FTX B;  4M30 A;  1P47 A;  2LT7 A;  4L8N A;  3VYX A;  2EPK X;  2DLK A;  4JV5 E;  1QNT A;  2DSY A;  5IV8 B;  3THO B;  1UBD C;  2N3H A;  1L4S A;  1BBO A;  1SFE A;  2YRK A;  4O24 A;  1DGC A;  4LTY A;  4RH8 A;  4FK5 C;  2L2N A;  2LRS A;  1ZAA C;  3HQ1 A;  1A1G A;  2EMG A;  3ZOQ B;  5IWA E;  4WX9 A; 
#chains in the Genus database with same CATH homology
 1T4N A;  1QU6 A;  2JY9 A;  4B3T E;  2DMY A;  2RS7 A;  3ADG A;  2JOB A;  3F6G A;  2DIX A;  1XNR E;  4X65 E;  1I94 E;  2V85 A;  4YY3 E;  3P1X A;  4JI8 E;  4AQY E;  2B7V A;  1T4L B;  1X49 A;  2V86 A;  2LUQ A;  1ZBQ A;  3MSW A;  4LF5 E;  1X48 A;  4DV2 E;  4DV3 E;  3IWC A;  2V88 A;  5LMU E;  4DR6 E;  4P7D A;  5DNY A;  2E5L E;  4J8Z A;  3AUZ A;  3J80 C;  1IBK E;  2MDR A;  2M7Q A;  2L3C A;  2IHR 1;  2LTS A;  1WHQ A;  3J81 C;  4KZS A;  2V8Q B;  2N3G A;  4R8O A;  4DV0 E;  3FIG A;  4B3S E;  4LF8 E;  3ADL A;  4B3R E;  4TUG A;  4JI0 E;  4WPY A;  4DR3 E;  1DQ3 A;  4JI3 E;  3C4B A;  4JI6 E;  4NXN E;  4K0K E;  4BC7 A;  3ADJ A;  3KWR A;  2YZT A;  4GEQ B;  2LE2 A;  3OTO E;  2ZM6 E;  2EZ6 A;  4DR4 E;  1FKA E;  4L5N C;  2L33 A;  1STU A;  3RMP A;  1DI2 A;  2UXC E;  5AE1 A;  2UUB E;  2UU9 E;  1EKZ A;  1YYK A;  3F6H A;  4DUZ E;  4LF7 E;  4DMI A;  2JVA A;  4X64 E;  4DV5 E;  3AV0 A;  1YZ9 A;  3DF6 A;  3VK6 A;  3HXL A;  4DR2 E;  1FJG E;  2VE7 C;  2EWL A;  3JAM C;  4NXM E;  2ODR C;  4BBY A;  4GKJ E;  4F9A B;  2F4V E;  4DR7 E;  2UUC E;  2LUP B;  3C4T A;  5AE2 A;  1J5E E;  5FLX C;  1XMO E;  3HTX A;  5CFF E;  2B9D A;  2F8B A;  4DKK A;  4JI7 E;  2VF1 A;  5AE3 A;  3T1H E;  3DJW A;  5IT9 C;  2UUA E;  2NA2 A;  2ODR D;  5LMN E;  2UXD E;  4F9C B;  4F9B B;  1J26 A;  4LF4 E;  2V83 A;  4JI1 E;  4BS9 A;  4DV6 E;  3T1Y E;  4Q28 A;  4LFA E;  5BR8 E;  1IBM E;  4BCA A;  1GZ6 A;  3IWB A;  4DUY E;  1N36 E;  2VQE E;  2B7T A;  1UIL A;  3K6Q A;  4OOG C;  4DR5 E;  1RQ0 A;  2NUG A;  2KHX A;  2E1M A;  4P78 A;  5LL6 R;  4JI5 E;  1GQE A;  3HPS A;  4R03 A;  4WYQ B;  1ZBT A;  4WSP A;  4TUI A;  5F3W A;  2L2K B;  2CPN A;  5ADZ A;  4JI4 E;  2NUE A;  1HNW E;  2K4V A;  1X47 A;  2UXB E;  2B3T B;  2JOX A;  2MC5 A;  4LU9 A;  2NUF A;  4M2Z A;  1RC7 A;  2DB2 A;  1YYO A;  2M1S A;  3J7A G;  1O0W A;  2V89 A;  5AAS A;  4X62 E;  4X8W A;  4LFB E;  1T4O A;  2YT4 A;  2LTR A;  2RSM A;  1SR9 A;  4DV4 E;  4B3M E;  1IBL E;  4X66 E;  4M0V A;  4DV7 E;  4JI2 E;  2V87 A;  2LMZ A;  1N33 E;  2L2M A;  4I8O A;  1UHZ A;  2FTX B;  2KOU A;  1WHN A;  2L92 A;  4M30 A;  5A2Q C;  2JWO A;  3JTZ A;  1HNZ E;  3LLH A;  4YHH E;  4L8N A;  4DV1 E;  1N34 E;  3VYX A;  1XNQ E;  4LFC E;  2HHH E;  2KON A;  4BMJ A;  4LF6 E;  4JV5 E;  2RTX A;  2DSY A;  3VYY A;  4WFT A;  4F54 A;  2LJH A;  3LML A;  1WXR A;  3IWD A;  3OML A;  1HNX E;  2WZO A;  3ADI A;  2FV4 B;  2L8T A;  2FGG A;  2N3H A;  2LBS B;  1N32 E;  1PKP A;  5T6J A;  4JYA E;  2G7H A;  3HPZ A;  3J7Y p;  4DR1 E;  2L6M A;  4LTY A;  1XMQ E;  4KHP E;  2L2N A;  2H36 X;  2JR1 A;  4OX9 E;  2LRS A;  2RS6 A;  1HR0 E;  4BC9 A;  2L3J A;  4GKK E;  1YYW A;  3HQ1 A;  3H09 A;  3JU0 A;  3ZOQ B;  5IWA E;  4LF9 E;  2VQF E;  2M4I A;  2MC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...