2CPNA

Solution structure of the second dsrbd of tar rna-binding protein 2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAR RNA-binding protein 2
publication title Solution structure of the second dsRBD of TAR RNA-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2cpnA01
2ZM6E 2LBSB 1XMOE 4AQYE 1DI2A 2LJHA 2NA2A 2B7VA 4DV4E 2LUPB 1WHQA 2B3TB 4B3ME 1N34E 1IBKE 5LMUE 4JI5E 4JYAE 1YYKA 4DUYE 4KHPE 1XNQE 1X48A 4LF5E 2B7TA 4DV1E 4M2ZA 2MDRA 2RTXA 3C4BA 2NUEA 1GQEA 4DR4E 4LFBE 3VYYA 2IHR1 4WFTA 2UXDE 1T4OA 1IBME 2VQFE 3ADLA 1RQ0A 4YHHE 4DR1E 1T4LB 2JY9A 4OX9E 4LFCE 2EZ6A 4DV0E 4JV5E 4K0KE 1O0WA 2L2NA 4LF4E 2L2KB 2JVAA 4DV5E 4JI2E 4DR3E 1PKPA 2L2MA 3T1YE 1J5EE 3ADIA 4DR5E 1YYWA 1HNWE 1IBLE 4NXME 2F4VE 4YY3E 1STUA 3OTOE 2CPNA 2E5LE 2UXBE 1XMQE 4JI3E 4DUZE 4NXNE 4DV3E 4DV7E 1X47A 2UU9E 3C4TA 4M30A 2HHHE 2UUCE 1YZ9A 4JI8E 4DV2E 2DIXA 4B3SE 1N32E 4LF7E 4X8WA 3J7Yp 5LMNE 4B3RE 1HNZE 2L33A 1I94E 2DB2A 5CFFE 4WYQB 1N36E 1EKZA 1T4NA 4JI4E 4DV6E 1X49A 4JI0E 4LF6E 1RC7A 1ZBTA 4GKJE 2YT4A 2LTRA 4LFAE 3P1XA 4DR7E 2KHXA 1J26A 4B3TE 2VQEE 1N33E 1FJGE 4JI6E 5BR8E 1HNXE 2NUFA 4OOGC 5IWAE 2UUAE 2RSMA 2UUBE 4X65E 2N3HA 3ADGA 2RS7A 3LLHA 2UXCE 4JI7E 2DMYA 2LUQA 4X62E 4DR6E 4JI1E 4LF9E 2N3GA 4GKKE 4X66E 2L3JA 2LRSA 2RS6A 4DR2E 1YYOA 3T1HE 1FKAE 2NUGA 4X64E 1WHNA 1UHZA 1UILA 2L3CA 1QU6A 4LF8E 3VYXA 3HTXA 4DKKA 2LTSA 1HR0E 3ADJA 1XNRE
chains in the Genus database with same CATH superfamily
2ZM6E 1RMDA 2EN7A 3L00A 1A1FA 2LJHA 2EMYA 2NA2A 1ZR9A 2VF1A 2YTDA 5AE2A 3KZZA 2V86A 4R2CA 2B3TB 1MGTA 4M0VA 2YTNA 2V88A 4F6NA 2EL6A 4JI5E 4JYAE 2EMBA 2EMZA 2EOZA 5KL6A 2YRKA 2Q8UA 2L92A 2MDRA 2B9DA 1N3GA 3VYYA 2UXDE 4RH8A 2VQFE 3ADLA 2DMIA 2VE7C 4F9BB 1T4LB 2D9HA 2EM7A 2YU8A 2WBUA 1O0WA 2EPMX 2EOJA 1X3CA 2L2KB 2ENAA 2EM2A 2L6MA 2JR1A 4JI2E 1PKPA 3KWRA 1GTKA 1SR9A 3BIDA 2YSPA 1BB8A 4DR5E 1A1HA 2YU5A 2LMZA 4R8OA 5KL2A 4JI3E 2EPOA 4NXNE 3THNA 1IQSA 4ZYDA 2V83A 4M30A 2EQ0A 3ECRA 3QG5C 1X6FA 2EE8A 3BBGA 2ELZA 2EWLA 3HXLA 1LLMC 2V89A 2ODRC 4X8WA 4F9CB 4LF7E 4I8OA 3AV0A 2DB2A 1B69A 4WYQB 1EKZA 4ZYGA 1EH6A 2LE2A 2YTJA 1X49A 3HQ1A 1NEIA 4JI0E 4JI4E 5AE3A 2EPRA 4HTGA 4TUGA 1WJPA 4DR7E 2KHXA 1J26A 2VQEE 3THOB 3DF6A 1TN9A 1GZ6A 1T38A 1HNXE 2EMIA 2UUAE 2KONA 1BBGA 1JK1A 2EPPA 3ADGA 2RS7A 5IXMB 4R2PA 2EM5A 4GKKE 2MDGA 4X66E 3AUZA 2EM3A 2EN4A 2V87A 2L3JA 1MEYC 2YWQA 2RS6A 3T1HE 2LCEA 2K7IA 1UHZA 1UILA 2JYAA 4GEQB 1EH8A 2EMHA 2LTSA 3ADJA 4O5GA 3UK3C 2WBTA 3C6KA 2LBSB 1A1IA 4BC9A 2EN6A 2B7VA 2JPAA 5A6JA 2YSOA 4WXDA 1N34E 2I13A 1L4SA 5LMUE 1YYKA 2DSYA 4RHBB 4TUIA 2M1SA 1KJKA 1A1GA 3C4BA 2EOXA 1IBME 1RQ0A 4OX9E 2EM9A 2GPIA 4LFCE 2EZ6A 2ODRD 4BS9A 2BB8A 2LT7A 2EM6A 2V85A 2JVAA 1QNTA 4DV5E 3BF2A 2L2MA 3ADIA 1HNWE 3J7AG 4NXME 1IQOA 5AE1A 3OTOE 2UXBE 1PJSA 1XMQE 4DV3E 4DV7E 3C4TA 4R03A 2VRDA 1UN6B 2FTXB 2NABA 4LTYA 4JI8E 5A6AA 4WX9A 4DV2E 2YRHA 5KL5A 2L33A 2EM4A 2EOFA 1X6EA 3M99B 3JAMC 5CFFE 5KL3A 2EPLX 2WCC3 2EP3A 1AAYA 2ENCA 4LF6E 1RC7A 4GKJE 2YT4A 2LTRA 3RMPA 4O4KA 2LV2A 4N4RB 4BHBA 2EQ3A 1P47A 1FJGE 2MC6A 4HEIA 2ELYA 1F2IG 4OOGC 5IWAE 2UUBE 3EQ1A 4X65E 4MLVA 2CTDA 1X6HA 2R76A 2UXCE 2YRMA 4JI7E 2G7HA 3VK6A 3MSWA 4NZVA 1YPNA 4ZYHA 4LF9E 1UBDC 5LLQA 2LRSA 2EOEA 4DR2E 4R2RA 1YYOA 4F9AB 1T39A 1WHNA 5T6JA 5TSEA 3DJWA 4DMIA 1WXRA 1QU6A 2EM0A 2EOYA 1YSAC 3VYXA 2A25A 2DRPA 2EPCA 2JOBA 2EOOA 1JK2A 2M7QA 1BBOA 1XMOE 1ZAAC 1G2DC 2DGCA 4DV4E 2YTQA 2DLKA 3ZOQB 4M9VC 2RSIA 3TQMA 2EOIA 2YTFA 2PRTA 4BC7A 4DUYE 4IJDA 2EPNA 4WSGA 2EN8A 1X48A 3J80C 4LF5E 3IWDA 2E1MA 2LVHA 4M2ZA 4DR4E 1GQEA 3BGHA 1T4OA 2EMCA 2I9IA 4DR1E 5A69A 4R2EA 3EPHA 5FLXC 2JP9A 4JV5E 2EM8A 2EORA 2L2NA 1A1JA 4LF4E 4K0KE 2EPZA 2EMKA 5IT9C 4DR3E 2WZOA 5F3WA 3T1YE 2YZTA 1IBLE 5AC4A 2F4VE 1G2FC 1STUA 2CPNA 2MKNA 2YTPA 4DUZE 1X47A 5LL6R 4R2AA 5A6BD 2EMXA 2UUCE 1YZ9A 4BHCA 4GZNC 2DIXA 4Q28A 4B3SE 1A1LA 1NCSA 2HJJA 3J7Yp 4B3RE 4IS1C 1HNZE 1I94E 2R1FA 4J8ZA 4O24A 2EMAA 4DV6E 1PJTA 3IWCA 1ZBTA 3EPLA 3P1XA 1KYQA 5DNYA 4L8NA 1N33E 2EOQA 4KWYA 4P78A 2JOXA 5A2QC 2NUFA 4FK5C 3VHTB 2E72A 5A6KA 2BBGA 2N3HA 2ENHA 2YTOA 2GLIA 4DR6E 4JI1E 2N3GA 4LU9A 2J7JA 1FKAE 2NUGA 4O43A 2M9AA 4X64E 2EPKX 4MLQA 2N8XA 2GHFA 3HTXA 1XNRE 1DQ3A 2YTGA 2HC5A 3F6GA 5AASA 1DI2A 4AQYE 1YFHA 2EOMA 1IMUA 2EN1A 2LUPB 1WHQA 2F8BA 4B3ME 1IBKE 2EOSA 3F6HA 1DGCA 1TF3A 2DLQA 2WBSA 2HGHA 2M4IA 4KHPE 3J81C 1XNQE 3OMLA 2B7TA 4DV1E 3C6MA 2EMGA 2RTXA 3JU0A 2NUEA 3H09A 3MHSC 2CT1A 4LFBE 2IHR1 4WFTA 1AH5A 2EPUA 2FGGA 4YHHE 2JY9A 3LMLA 4DV0E 1YUIA 4BMJA 4X9JA 2LO3A 2CSHA 2MC5A 5ADZA 5IV8B 4BCAA 2JWOA 1J5EE 4R2DA 1TF6A 1YYWA 4YY3E 2E5LE 1ZBQA 2EN3A 4BBYA 2EN2A 2V8QB 4Q35B 2YTEA 2UU9E 2K4VA 1PDAA 1WRJA 1X5WA 2HHHE 2EMLA 1ZU1A 1N32E 2EPAA 4NHRA 2YTIA 4WPYA 5LMNE 3K6QA 2EMWA 2EJ4A 5AC5A 3KZYA 4KZSA 1N36E 1T4NA 2RPCA 4L5NC 3MHHC 4ZYEA 1SFEA 2EL5A 4R2SA 4LFAE 4WSPA 1PJQA 2FV4B 4WXCA 4B3TE 2KOUA 4JI6E 2JXPA 5BR8E 2EOHA 2EQ1A 2RSMA 3EPJA 3IWBA 4F2JC 2L8TA 3HPZA 3JTZA 3LLHA 2EMFA 3EPKA 1Z1BA 1YUJA 2DMYA 2ADRA 1A1KA 3HPSA 2LUQA 4F54A 4X62E 5A6BA 2H36X 2YPNA 4F6MA 3FIGA 4P7DA 5KL7A 4R2QA 2L3CA 4LF8E 5KL4A 1EH7A 2RQLA 2MKDA 4DKKA 2EL4A 1HR0E 2EPXA 2LJUA
chains in the Genus database with same CATH topology
2ZM6E 3F6GA 5AASA 2LBSB 4AQYE 1XMOE 1DI2A 4BC9A 2LJHA 2NA2A 2B7VA 2VF1A 5AE2A 4DV4E 2LUPB 1WHQA 2V86A 2B3TB 2F8BA 4M0VA 4B3ME 1N34E 3ZOQB 1IBKE 2V88A 3F6HA 5LMUE 4JI5E 4JYAE 4BC7A 1HNWE 1YYKA 2DSYA 4TUIA 4DUYE 2M4IA 4KHPE 3J81C 3J80C 2M1SA 1X48A 3OMLA 4LF5E 2B7TA 1XNQE 3IWDA 4DV1E 2E1MA 2L92A 4M2ZA 2MDRA 2B9DA 2RTXA 3C4BA 3JU0A 1GQEA 3H09A 2NUEA 4DR4E 4LFBE 3VYYA 2IHR1 4WFTA 2UXDE 1T4OA 1IBME 2VQFE 3ADLA 1RQ0A 2FGGA 2VE7C 4F9BB 4YHHE 2JY9A 4DR1E 1T4LB 4LFCE 4OX9E 2EZ6A 2ODRD 5FLXC 3LMLA 4DV0E 4BS9A 4JV5E 4K0KE 1O0WA 2L2NA 4LF4E 2L2KB 2V85A 4BMJA 2JVAA 2L6MA 5IT9C 2JR1A 4DV5E 4JI2E 4DR3E 2MC5A 1PKPA 2WZOA 3KWRA 2L2MA 4BCAA 2JWOA 1SR9A 5ADZA 5F3WA 3T1YE 1J5EE 3ADIA 2YZTA 4DR5E 1YYWA 3J7AG 1IBLE 2LMZA 4NXME 5AE1A 4YY3E 1STUA 4R8OA 3OTOE 2CPNA 2E5LE 2F4VE 1ZBQA 2UXBE 4BBYA 1XMQE 4DUZE 4JI3E 2V8QB 4DV3E 4NXNE 4DV7E 1X47A 2UU9E 2K4VA 3C4TA 5LL6R 4R03A 2V83A 4M30A 2HHHE 2UUCE 1YZ9A 2FTXB 4LTYA 4JI8E 4DV2E 2DIXA 2EWLA 3HXLA 4Q28A 4B3SE 1N32E 2V89A 2ODRC 4X8WA 4F9CB 4LF7E 3J7Yp 4I8OA 4WPYA 5LMNE 3K6QA 3AV0A 4B3RE 1HNZE 2L33A 1I94E 2DB2A 5CFFE 4WYQB 4KZSA 3JAMC 4J8ZA 1N36E 1EKZA 1T4NA 4JI4E 2LE2A 3HQ1A 1X49A 4DV6E 4JI0E 4L5NC 5AE3A 3IWCA 1RC7A 4LF6E 1ZBTA 4GKJE 2YT4A 2LTRA 3RMPA 4TUGA 4LFAE 4WSPA 3P1XA 2FV4B 5DNYA 2KHXA 4DR7E 1J26A 4L8NA 2VQEE 4B3TE 1N33E 2KOUA 3DF6A 4P78A 5BR8E 4JI6E 1FJGE 2MC6A 1GZ6A 2JOXA 5A2QC 1HNXE 2NUFA 4OOGC 5IWAE 2UUAE 2RSMA 2KONA 2UUBE 4X65E 3IWBA 2N3HA 2L8TA 2RS7A 3ADGA 3HPZA 3JTZA 3LLHA 2UXCE 4JI7E 2DMYA 3HPSA 2LUQA 4F54A 4X62E 4DR6E 2G7HA 3VK6A 3MSWA 4JI1E 4LF9E 2N3GA 2H36X 3FIGA 4GKKE 4X66E 3AUZA 4P7DA 4LU9A 2V87A 2L3JA 2LRSA 2RS6A 4DR2E 1YYOA 3T1HE 1FKAE 2NUGA 4F9AB 4X64E 1WHNA 1UHZA 5T6JA 1UILA 3DJWA 4DMIA 2L3CA 1WXRA 1QU6A 4LF8E 4GEQB 3VYXA 3HTXA 2JOBA 4DKKA 2LTSA 1HR0E 3ADJA 1XNRE 1DQ3A 2M7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 E;  2LBS B;  1XMO E;  4AQY E;  1DI2 A;  2LJH A;  2NA2 A;  2B7V A;  4DV4 E;  2LUP B;  1WHQ A;  2B3T B;  4B3M E;  1N34 E;  1IBK E;  5LMU E;  4JI5 E;  4JYA E;  1YYK A;  4DUY E;  4KHP E;  1XNQ E;  1X48 A;  4LF5 E;  2B7T A;  4DV1 E;  4M2Z A;  2MDR A;  2RTX A;  3C4B A;  2NUE A;  1GQE A;  4DR4 E;  4LFB E;  3VYY A;  2IHR 1;  4WFT A;  2UXD E;  1T4O A;  1IBM E;  2VQF E;  3ADL A;  1RQ0 A;  4YHH E;  4DR1 E;  1T4L B;  2JY9 A;  4OX9 E;  4LFC E;  2EZ6 A;  4DV0 E;  4JV5 E;  4K0K E;  1O0W A;  2L2N A;  4LF4 E;  2L2K B;  2JVA A;  4DV5 E;  4JI2 E;  4DR3 E;  1PKP A;  2L2M A;  3T1Y E;  1J5E E;  3ADI A;  4DR5 E;  1YYW A;  1HNW E;  1IBL E;  4NXM E;  2F4V E;  4YY3 E;  1STU A;  3OTO E;  2CPN A;  2E5L E;  2UXB E;  1XMQ E;  4JI3 E;  4DUZ E;  4NXN E;  4DV3 E;  4DV7 E;  1X47 A;  2UU9 E;  3C4T A;  4M30 A;  2HHH E;  2UUC E;  1YZ9 A;  4JI8 E;  4DV2 E;  2DIX A;  4B3S E;  1N32 E;  4LF7 E;  4X8W A;  3J7Y p;  5LMN E;  4B3R E;  1HNZ E;  2L33 A;  1I94 E;  2DB2 A;  5CFF E;  4WYQ B;  1N36 E;  1EKZ A;  1T4N A;  4JI4 E;  4DV6 E;  1X49 A;  4JI0 E;  4LF6 E;  1RC7 A;  1ZBT A;  4GKJ E;  2YT4 A;  2LTR A;  4LFA E;  3P1X A;  4DR7 E;  2KHX A;  1J26 A;  4B3T E;  2VQE E;  1N33 E;  1FJG E;  4JI6 E;  5BR8 E;  1HNX E;  2NUF A;  4OOG C;  5IWA E;  2UUA E;  2RSM A;  2UUB E;  4X65 E;  2N3H A;  3ADG A;  2RS7 A;  3LLH A;  2UXC E;  4JI7 E;  2DMY A;  2LUQ A;  4X62 E;  4DR6 E;  4JI1 E;  4LF9 E;  2N3G A;  4GKK E;  4X66 E;  2L3J A;  2LRS A;  2RS6 A;  4DR2 E;  1YYO A;  3T1H E;  1FKA E;  2NUG A;  4X64 E;  1WHN A;  1UHZ A;  1UIL A;  2L3C A;  1QU6 A;  4LF8 E;  3VYX A;  3HTX A;  4DKK A;  2LTS A;  1HR0 E;  3ADJ A;  1XNR E; 
#chains in the Genus database with same CATH topology
 2ZM6 E;  1RMD A;  2EN7 A;  3L00 A;  1A1F A;  2LJH A;  2EMY A;  2NA2 A;  1ZR9 A;  2VF1 A;  2YTD A;  5AE2 A;  3KZZ A;  2V86 A;  4R2C A;  2B3T B;  1MGT A;  4M0V A;  2YTN A;  2V88 A;  4F6N A;  2EL6 A;  4JI5 E;  4JYA E;  2EMB A;  2EMZ A;  2EOZ A;  5KL6 A;  2YRK A;  2Q8U A;  2L92 A;  2MDR A;  2B9D A;  1N3G A;  3VYY A;  2UXD E;  4RH8 A;  2VQF E;  3ADL A;  2DMI A;  2VE7 C;  4F9B B;  1T4L B;  2D9H A;  2EM7 A;  2YU8 A;  2WBU A;  1O0W A;  2EPM X;  2EOJ A;  1X3C A;  2L2K B;  2ENA A;  2EM2 A;  2L6M A;  2JR1 A;  4JI2 E;  1PKP A;  3KWR A;  1GTK A;  1SR9 A;  3BID A;  2YSP A;  1BB8 A;  4DR5 E;  1A1H A;  2YU5 A;  2LMZ A;  4R8O A;  5KL2 A;  4JI3 E;  2EPO A;  4NXN E;  3THN A;  1IQS A;  4ZYD A;  2V83 A;  4M30 A;  2EQ0 A;  3ECR A;  3QG5 C;  1X6F A;  2EE8 A;  3BBG A;  2ELZ A;  2EWL A;  3HXL A;  1LLM C;  2V89 A;  2ODR C;  4X8W A;  4F9C B;  4LF7 E;  4I8O A;  3AV0 A;  2DB2 A;  1B69 A;  4WYQ B;  1EKZ A;  4ZYG A;  1EH6 A;  2LE2 A;  2YTJ A;  1X49 A;  3HQ1 A;  1NEI A;  4JI0 E;  4JI4 E;  5AE3 A;  2EPR A;  4HTG A;  4TUG A;  1WJP A;  4DR7 E;  2KHX A;  1J26 A;  2VQE E;  3THO B;  3DF6 A;  1TN9 A;  1GZ6 A;  1T38 A;  1HNX E;  2EMI A;  2UUA E;  2KON A;  1BBG A;  1JK1 A;  2EPP A;  3ADG A;  2RS7 A;  5IXM B;  4R2P A;  2EM5 A;  4GKK E;  2MDG A;  4X66 E;  3AUZ A;  2EM3 A;  2EN4 A;  2V87 A;  2L3J A;  1MEY C;  2YWQ A;  2RS6 A;  3T1H E;  2LCE A;  2K7I A;  1UHZ A;  1UIL A;  2JYA A;  4GEQ B;  1EH8 A;  2EMH A;  2LTS A;  3ADJ A;  4O5G A;  3UK3 C;  2WBT A;  3C6K A;  2LBS B;  1A1I A;  4BC9 A;  2EN6 A;  2B7V A;  2JPA A;  5A6J A;  2YSO A;  4WXD A;  1N34 E;  2I13 A;  1L4S A;  5LMU E;  1YYK A;  2DSY A;  4RHB B;  4TUI A;  2M1S A;  1KJK A;  1A1G A;  3C4B A;  2EOX A;  1IBM E;  1RQ0 A;  4OX9 E;  2EM9 A;  2GPI A;  4LFC E;  2EZ6 A;  2ODR D;  4BS9 A;  2BB8 A;  2LT7 A;  2EM6 A;  2V85 A;  2JVA A;  1QNT A;  4DV5 E;  3BF2 A;  2L2M A;  3ADI A;  1HNW E;  3J7A G;  4NXM E;  1IQO A;  5AE1 A;  3OTO E;  2UXB E;  1PJS A;  1XMQ E;  4DV3 E;  4DV7 E;  3C4T A;  4R03 A;  2VRD A;  1UN6 B;  2FTX B;  2NAB A;  4LTY A;  4JI8 E;  5A6A A;  4WX9 A;  4DV2 E;  2YRH A;  5KL5 A;  2L33 A;  2EM4 A;  2EOF A;  1X6E A;  3M99 B;  3JAM C;  5CFF E;  5KL3 A;  2EPL X;  2WCC 3;  2EP3 A;  1AAY A;  2ENC A;  4LF6 E;  1RC7 A;  4GKJ E;  2YT4 A;  2LTR A;  3RMP A;  4O4K A;  2LV2 A;  4N4R B;  4BHB A;  2EQ3 A;  1P47 A;  1FJG E;  2MC6 A;  4HEI A;  2ELY A;  1F2I G;  4OOG C;  5IWA E;  2UUB E;  3EQ1 A;  4X65 E;  4MLV A;  2CTD A;  1X6H A;  2R76 A;  2UXC E;  2YRM A;  4JI7 E;  2G7H A;  3VK6 A;  3MSW A;  4NZV A;  1YPN A;  4ZYH A;  4LF9 E;  1UBD C;  5LLQ A;  2LRS A;  2EOE A;  4DR2 E;  4R2R A;  1YYO A;  4F9A B;  1T39 A;  1WHN A;  5T6J A;  5TSE A;  3DJW A;  4DMI A;  1WXR A;  1QU6 A;  2EM0 A;  2EOY A;  1YSA C;  3VYX A;  2A25 A;  2DRP A;  2EPC A;  2JOB A;  2EOO A;  1JK2 A;  2M7Q A;  1BBO A;  1XMO E;  1ZAA C;  1G2D C;  2DGC A;  4DV4 E;  2YTQ A;  2DLK A;  3ZOQ B;  4M9V C;  2RSI A;  3TQM A;  2EOI A;  2YTF A;  2PRT A;  4BC7 A;  4DUY E;  4IJD A;  2EPN A;  4WSG A;  2EN8 A;  1X48 A;  3J80 C;  4LF5 E;  3IWD A;  2E1M A;  2LVH A;  4M2Z A;  4DR4 E;  1GQE A;  3BGH A;  1T4O A;  2EMC A;  2I9I A;  4DR1 E;  5A69 A;  4R2E A;  3EPH A;  5FLX C;  2JP9 A;  4JV5 E;  2EM8 A;  2EOR A;  2L2N A;  1A1J A;  4LF4 E;  4K0K E;  2EPZ A;  2EMK A;  5IT9 C;  4DR3 E;  2WZO A;  5F3W A;  3T1Y E;  2YZT A;  1IBL E;  5AC4 A;  2F4V E;  1G2F C;  1STU A;  2CPN A;  2MKN A;  2YTP A;  4DUZ E;  1X47 A;  5LL6 R;  4R2A A;  5A6B D;  2EMX A;  2UUC E;  1YZ9 A;  4BHC A;  4GZN C;  2DIX A;  4Q28 A;  4B3S E;  1A1L A;  1NCS A;  2HJJ A;  3J7Y p;  4B3R E;  4IS1 C;  1HNZ E;  1I94 E;  2R1F A;  4J8Z A;  4O24 A;  2EMA A;  4DV6 E;  1PJT A;  3IWC A;  1ZBT A;  3EPL A;  3P1X A;  1KYQ A;  5DNY A;  4L8N A;  1N33 E;  2EOQ A;  4KWY A;  4P78 A;  2JOX A;  5A2Q C;  2NUF A;  4FK5 C;  3VHT B;  2E72 A;  5A6K A;  2BBG A;  2N3H A;  2ENH A;  2YTO A;  2GLI A;  4DR6 E;  4JI1 E;  2N3G A;  4LU9 A;  2J7J A;  1FKA E;  2NUG A;  4O43 A;  2M9A A;  4X64 E;  2EPK X;  4MLQ A;  2N8X A;  2GHF A;  3HTX A;  1XNR E;  1DQ3 A;  2YTG A;  2HC5 A;  3F6G A;  5AAS A;  1DI2 A;  4AQY E;  1YFH A;  2EOM A;  1IMU A;  2EN1 A;  2LUP B;  1WHQ A;  2F8B A;  4B3M E;  1IBK E;  2EOS A;  3F6H A;  1DGC A;  1TF3 A;  2DLQ A;  2WBS A;  2HGH A;  2M4I A;  4KHP E;  3J81 C;  1XNQ E;  3OML A;  2B7T A;  4DV1 E;  3C6M A;  2EMG A;  2RTX A;  3JU0 A;  2NUE A;  3H09 A;  3MHS C;  2CT1 A;  4LFB E;  2IHR 1;  4WFT A;  1AH5 A;  2EPU A;  2FGG A;  4YHH E;  2JY9 A;  3LML A;  4DV0 E;  1YUI A;  4BMJ A;  4X9J A;  2LO3 A;  2CSH A;  2MC5 A;  5ADZ A;  5IV8 B;  4BCA A;  2JWO A;  1J5E E;  4R2D A;  1TF6 A;  1YYW A;  4YY3 E;  2E5L E;  1ZBQ A;  2EN3 A;  4BBY A;  2EN2 A;  2V8Q B;  4Q35 B;  2YTE A;  2UU9 E;  2K4V A;  1PDA A;  1WRJ A;  1X5W A;  2HHH E;  2EML A;  1ZU1 A;  1N32 E;  2EPA A;  4NHR A;  2YTI A;  4WPY A;  5LMN E;  3K6Q A;  2EMW A;  2EJ4 A;  5AC5 A;  3KZY A;  4KZS A;  1N36 E;  1T4N A;  2RPC A;  4L5N C;  3MHH C;  4ZYE A;  1SFE A;  2EL5 A;  4R2S A;  4LFA E;  4WSP A;  1PJQ A;  2FV4 B;  4WXC A;  4B3T E;  2KOU A;  4JI6 E;  2JXP A;  5BR8 E;  2EOH A;  2EQ1 A;  2RSM A;  3EPJ A;  3IWB A;  4F2J C;  2L8T A;  3HPZ A;  3JTZ A;  3LLH A;  2EMF A;  3EPK A;  1Z1B A;  1YUJ A;  2DMY A;  2ADR A;  1A1K A;  3HPS A;  2LUQ A;  4F54 A;  4X62 E;  5A6B A;  2H36 X;  2YPN A;  4F6M A;  3FIG A;  4P7D A;  5KL7 A;  4R2Q A;  2L3C A;  4LF8 E;  5KL4 A;  1EH7 A;  2RQL A;  2MKD A;  4DKK A;  2EL4 A;  1HR0 E;  2EPX A;  2LJU A; 
#chains in the Genus database with same CATH homology
 2ZM6 E;  3F6G A;  5AAS A;  2LBS B;  4AQY E;  1XMO E;  1DI2 A;  4BC9 A;  2LJH A;  2NA2 A;  2B7V A;  2VF1 A;  5AE2 A;  4DV4 E;  2LUP B;  1WHQ A;  2V86 A;  2B3T B;  2F8B A;  4M0V A;  4B3M E;  1N34 E;  3ZOQ B;  1IBK E;  2V88 A;  3F6H A;  5LMU E;  4JI5 E;  4JYA E;  4BC7 A;  1HNW E;  1YYK A;  2DSY A;  4TUI A;  4DUY E;  2M4I A;  4KHP E;  3J81 C;  3J80 C;  2M1S A;  1X48 A;  3OML A;  4LF5 E;  2B7T A;  1XNQ E;  3IWD A;  4DV1 E;  2E1M A;  2L92 A;  4M2Z A;  2MDR A;  2B9D A;  2RTX A;  3C4B A;  3JU0 A;  1GQE A;  3H09 A;  2NUE A;  4DR4 E;  4LFB E;  3VYY A;  2IHR 1;  4WFT A;  2UXD E;  1T4O A;  1IBM E;  2VQF E;  3ADL A;  1RQ0 A;  2FGG A;  2VE7 C;  4F9B B;  4YHH E;  2JY9 A;  4DR1 E;  1T4L B;  4LFC E;  4OX9 E;  2EZ6 A;  2ODR D;  5FLX C;  3LML A;  4DV0 E;  4BS9 A;  4JV5 E;  4K0K E;  1O0W A;  2L2N A;  4LF4 E;  2L2K B;  2V85 A;  4BMJ A;  2JVA A;  2L6M A;  5IT9 C;  2JR1 A;  4DV5 E;  4JI2 E;  4DR3 E;  2MC5 A;  1PKP A;  2WZO A;  3KWR A;  2L2M A;  4BCA A;  2JWO A;  1SR9 A;  5ADZ A;  5F3W A;  3T1Y E;  1J5E E;  3ADI A;  2YZT A;  4DR5 E;  1YYW A;  3J7A G;  1IBL E;  2LMZ A;  4NXM E;  5AE1 A;  4YY3 E;  1STU A;  4R8O A;  3OTO E;  2CPN A;  2E5L E;  2F4V E;  1ZBQ A;  2UXB E;  4BBY A;  1XMQ E;  4DUZ E;  4JI3 E;  2V8Q B;  4DV3 E;  4NXN E;  4DV7 E;  1X47 A;  2UU9 E;  2K4V A;  3C4T A;  5LL6 R;  4R03 A;  2V83 A;  4M30 A;  2HHH E;  2UUC E;  1YZ9 A;  2FTX B;  4LTY A;  4JI8 E;  4DV2 E;  2DIX A;  2EWL A;  3HXL A;  4Q28 A;  4B3S E;  1N32 E;  2V89 A;  2ODR C;  4X8W A;  4F9C B;  4LF7 E;  3J7Y p;  4I8O A;  4WPY A;  5LMN E;  3K6Q A;  3AV0 A;  4B3R E;  1HNZ E;  2L33 A;  1I94 E;  2DB2 A;  5CFF E;  4WYQ B;  4KZS A;  3JAM C;  4J8Z A;  1N36 E;  1EKZ A;  1T4N A;  4JI4 E;  2LE2 A;  3HQ1 A;  1X49 A;  4DV6 E;  4JI0 E;  4L5N C;  5AE3 A;  3IWC A;  1RC7 A;  4LF6 E;  1ZBT A;  4GKJ E;  2YT4 A;  2LTR A;  3RMP A;  4TUG A;  4LFA E;  4WSP A;  3P1X A;  2FV4 B;  5DNY A;  2KHX A;  4DR7 E;  1J26 A;  4L8N A;  2VQE E;  4B3T E;  1N33 E;  2KOU A;  3DF6 A;  4P78 A;  5BR8 E;  4JI6 E;  1FJG E;  2MC6 A;  1GZ6 A;  2JOX A;  5A2Q C;  1HNX E;  2NUF A;  4OOG C;  5IWA E;  2UUA E;  2RSM A;  2KON A;  2UUB E;  4X65 E;  3IWB A;  2N3H A;  2L8T A;  2RS7 A;  3ADG A;  3HPZ A;  3JTZ A;  3LLH A;  2UXC E;  4JI7 E;  2DMY A;  3HPS A;  2LUQ A;  4F54 A;  4X62 E;  4DR6 E;  2G7H A;  3VK6 A;  3MSW A;  4JI1 E;  4LF9 E;  2N3G A;  2H36 X;  3FIG A;  4GKK E;  4X66 E;  3AUZ A;  4P7D A;  4LU9 A;  2V87 A;  2L3J A;  2LRS A;  2RS6 A;  4DR2 E;  1YYO A;  3T1H E;  1FKA E;  2NUG A;  4F9A B;  4X64 E;  1WHN A;  1UHZ A;  5T6J A;  1UIL A;  3DJW A;  4DMI A;  2L3C A;  1WXR A;  1QU6 A;  4LF8 E;  4GEQ B;  3VYX A;  3HTX A;  2JOB A;  4DKK A;  2LTS A;  1HR0 E;  3ADJ A;  1XNR E;  1DQ3 A;  2M7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...