2CPNA

Solution structure of the second dsrbd of tar rna-binding protein 2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords TAR RNA-binding protein 2
publication title Solution structure of the second dsRBD of TAR RNA-binding protein 2
rcsb
source organism Homo sapiens
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2cpnA01
1QU6A 2DMYA 4DV3E 4LF5E 2B7TA 4AQYE 2RS7A 1WHQA 1T4NA 4GKJE 1YYOA 1IBLE 1GQEA 2NUFA 2L3JA 3T1YE 1UHZA 4DR3E 1DI2A 2UXBE 3VYXA 4B3RE 2LRSA 4X62E 4LF9E 3VYYA 2UUAE 1N36E 2DB2A 4X64E 4B3ME 2UU9E 2L2KB 2UXDE 3ADLA 1WHNA 1J5EE 3OTOE 1I94E 1FKAE 2NA2A 4OOGC 4M2ZA 1ZBTA 1X49A 2L33A 5BR8E 2B3TB 2RSMA 4JI4E 4KHPE 5LMNE 4JI5E 4X8WA 2N3GA 1T4LB 1YYKA 2UXCE 4GKKE 4DV6E 4LF6E 3HTXA 2ZM6E 4WYQB 2L2MA 4LFCE 3J7Yp 2IHR1 2JY9A 1YZ9A 2LTRA 2L3CA 1RQ0A 4DR7E 2EZ6A 1HR0E 1PKPA 2E5LE 4YY3E 1XMQE 4M30A 1IBME 3C4TA 1N33E 4DV0E 5LMUE 4JI6E 4DV5E 4JI7E 1IBKE 4JI0E 4NXNE 2HHHE 4LF7E 2NUEA 4DR4E 2RTXA 2YT4A 4DV4E 4OX9E 1HNZE 4DR5E 2L2NA 4LFBE 1XNRE 2NUGA 4X66E 1EKZA 1HNWE 2RS6A 4JI2E 1N34E 2UUBE 4DR2E 3ADIA 4WFTA 1UILA 4DR6E 2N3HA 3ADJA 4DV2E 2LBSB 2LUQA 1RC7A 4B3TE 1XMOE 3P1XA 2LJHA 4JYAE 1N32E 4NXME 4JI8E 4DR1E 1O0WA 2F4VE 2KHXA 5IWAE 4YHHE 4LF8E 4JI1E 2VQFE 1X48A 4DUYE 1STUA 2LUPB 1T4OA 4DKKA 4LFAE 2CPNA 1XNQE 2JVAA 2DIXA 3ADGA 1X47A 5CFFE 4X65E 2B7VA 1J26A 3C4BA 1YYWA 2LTSA 4LF4E 4K0KE 4B3SE 4DUZE 4JV5E 1FJGE 4DV1E 2VQEE 4DV7E 2MDRA 1HNXE 2UUCE 4JI3E 3LLHA 3T1HE
chains in the Genus database with same CATH superfamily
5A2QC 1QU6A 2EPOA 5IV8B 2B7TA 2GLIA 3C6KA 2YRHA 2G7HA 4HTGA 1GQEA 2EMXA 3T1YE 1UHZA 3BIDA 5FLXC 3HPZA 3JU0A 1ZAAC 2V8QB 3VYXA 1KYQA 2GHFA 5LLQA 4BC7A 2UUAE 2KOUA 3EPHA 2EM3A 5AC4A 1I94E 1X6FA 2LT7A 1X49A 2L33A 2VRDA 2B3TB 5IT9C 1TF3A 4JI5E 2ENCA 1L4SA 2N3GA 2EN1A 4L8NA 2HC5A 1T4LB 2MKNA 1YYKA 3MHHC 2YTJA 1GTKA 1A1FA 3F6GA 2L2MA 2E72A 1PJTA 5A6AA 4WPYA 2R76A 2MC6A 1YZ9A 2EPCA 1ZBQA 2RPCA 1IQSA 4GZNC 2L3CA 3FIGA 4BMJA 2E5LE 2DMIA 4RHBB 4M30A 1XMQE 1IBME 2MDGA 1N33E 1A1GA 4DV0E 2HJJA 4JI6E 1NCSA 4JI0E 1T38A 3VHTB 2V86A 2NUEA 4DV4E 4OX9E 4DR5E 3RMPA 4WSGA 2LMZA 4LFBE 2NUGA 1NEIA 4R2DA 2JOBA 2MC5A 4DR2E 4F9AB 4LTYA 2MKDA 4WFTA 4DR6E 2EQ0A 2LBSB 3HQ1A 2LUQA 1YUIA 4R2PA 1XMOE 1QNTA 2ODRD 4JI8E 1WJPA 4P78A 4WXCA 2FTXB 2KHXA 2YU5A 3VK6A 1JK1A 2H36X 2YSPA 4F2JC 2VF1A 2M1SA 3M99B 4R8OA 2ENHA 4DKKA 2DLKA 2EOIA 2EMBA 2D9HA 1XNQE 3KZYA 2EM2A 2DIXA 2V88A 1X47A 2EMLA 2EOOA 4X65E 2YTGA 2EL5A 3C4BA 5TSEA 1YFHA 4K0KE 2EN8A 2CT1A 3LMLA 2EPRA 2ELZA 4Q28A 2JOXA 4WSPA 4ZYEA 1ZR9A 4DV7E 1HNXE 4KZSA 4JI3E 3LLHA 4O4KA 2K7IA 3AV0A 4BHCA 3BGHA 4NHRA 2EPAA 4LU9A 1X3CA 1A1JA 1KJKA 2EPZA 4GKJE 1YYOA 2EMWA 4IJDA 2NUFA 2L3JA 3EQ1A 4DR3E 3K6QA 2WZOA 4B3RE 4BS9A 2EMGA 3VYYA 2I13A 4J8ZA 5AC5A 4FK5C 2LO3A 3C6MA 2ODRC 1WHNA 1FKAE 3L00A 2EOSA 4OOGC 2EWLA 5F3WA 2RSMA 2EPPA 5LL6R 4KHPE 1BBOA 5LMNE 3IWDA 2EMFA 4X8WA 2Q8UA 2EOEA 2UXCE 2ENAA 4DV6E 1TN9A 4R2RA 2ZM6E 4WX9A 2EN2A 4WYQB 1N3GA 2EOYA 2EOJA 2YRKA 1RQ0A 2EPKX 2JR1A 4BCAA 2EMZA 4F6MA 2DLQA 2JWOA 2YRMA 2JP9A 3J7AG 5KL3A 4RH8A 2EPNA 2EM4A 1BB8A 2RTXA 1IQOA 2JYAA 1F2IG 3TQMA 4R2SA 4X66E 1EKZA 3KZZA 2YZTA 4WXDA 2LV2A 4O43A 3ADIA 2EORA 3EPKA 5KL2A 2I9IA 2M9AA 2WBUA 2N3HA 3ADJA 1PDAA 1LLMC 3BBGA 4MLVA 2ADRA 1RC7A 2EPUA 3HXLA 2EPXA 3H09A 4JYAE 2WBSA 2EM6A 2YTNA 4X9JA 5T6JA 2A25A 1YUJA 5KL4A 2NABA 5AASA 4F6NA 1STUA 3DF6A 4IS1C 2EN7A 2DSYA 1JK2A 2CPNA 2YTIA 3ZOQB 5CFFE 2YWQA 3OMLA 4B3SE 4JV5E 2VQEE 1TF6A 4R2EA 3T1HE 2L6MA 1X6EA 2DMYA 4DV3E 4LF5E 1A1KA 2RS7A 1G2DC 1T4NA 2LJUA 2EMKA 1SFEA 2E1MA 5A6JA 2EM5A 1MEYC 2LRSA 3QG5C 2EJ4A 2DB2A 4B3ME 2L2KB 3ADLA 1J5EE 5KL5A 2V89A 3OTOE 2EL4A 2NA2A 4M2ZA 1ZBTA 2V83A 2EMAA 5BR8E 1AH5A 2YTQA 4JI4E 4N4RB 1PJQA 1YPNA 2EN6A 2EMIA 3EPJA 2EE8A 4P7DA 3KWRA 4LF6E 3J80C 2EOMA 2RSIA 2EN4A 1DQ3A 1IMUA 2EL6A 2KONA 2JY9A 2M7QA 2LTRA 2EMCA 2EZ6A 2EN3A 5AE2A 3HPSA 1HR0E 5AE3A 4YY3E 4BC9A 3C4TA 1G2FC 4JI7E 4R2CA 1IBKE 5ADZA 2HHHE 4DR4E 2EQ3A 2L2NA 2EPLX 2N8XA 1XNRE 2CSHA 2YTPA 4JI2E 5AE1A 2WCC3 1N34E 4R03A 1UILA 2EM7A 1PJSA 2RQLA 3ECRA 4DMIA 2FV4B 4DV2E 2EP3A 2L8TA 2DRPA 2EOXA 4TUIA 2YSOA 2LJHA 2ELYA 1N32E 4NXME 4M9VC 1O0WA 5IWAE 2YTDA 1EH7A 4LF8E 4R2QA 3EPLA 1A1HA 2BBGA 2LUPB 1T4OA 2YPNA 4R2AA 2JVAA 3ADGA 2EM0A 2EMYA 1ZU1A 1YYWA 2LTSA 4LF4E 4DUZE 2CTDA 4DV1E 4F9BB 2MDRA 3MSWA 2M4IA 2YTEA 2GPIA 2JPAA 4AQYE 2JXPA 3THNA 1YSAC 1WHQA 2EPMX 4GEQB 1SR9A 2V85A 1P47A 1IBLE 1MGTA 1X6HA 1DI2A 3AUZA 1GZ6A 2UXBE 4X62E 4LF9E 2EOFA 2EOQA 1N36E 5A6KA 1RMDA 2EMHA 2J7JA 4X64E 4F9CB 3JTZA 2UU9E 2UXDE 1UN6B 2DGCA 4BHBA 1X5WA 3MHSC 4M0VA 5A6BD 4F54A 1EH8A 4HEIA 5A69A 2FGGA 1WRJA 2EM8A 4ZYGA 5KL7A 4BBYA 5KL6A 4GKKE 2YTFA 5IXMB 2LE2A 3HTXA 2LVHA 2F8BA 2K4VA 4ZYHA 4LFCE 3J7Yp 2IHR1 2VE7C 2YU8A 3IWCA 4NZVA 2PRTA 4DR7E 1UBDC 1PKPA 1DGCA 4ZYDA 5LMUE 4DV5E 4NXNE 2R1FA 4LF7E 4L5NC 2EQ1A 2YT4A 1HNZE 2L92A 4O24A 4TUGA 2V87A 1HNWE 3F6HA 4Q35B 2RS6A 4KWYA 2UUBE 1AAYA 1WXRA 3THOB 1Z1BA 5A6BA 1T39A 2HGHA 4B3TE 3JAMC 1BBGA 3DJWA 3P1XA 3UK3C 2BB8A 4DR1E 1EH6A 2F4VE 2EOZA 4YHHE 1A1LA 4JI1E 2EM9A 2VQFE 1A1IA 1X48A 4DUYE 3J81C 3IWBA 2WBTA 4LFAE 4MLQA 4O5GA 2YTOA 2B7VA 1J26A 2EOHA 2B9DA 1FJGE 2LCEA 1B69A 3BF2A 2UUCE 5DNYA 4I8OA
chains in the Genus database with same CATH topology
5A2QC 2L6MA 1QU6A 2DMYA 4DV3E 4LF5E 2B7TA 3AV0A 4AQYE 2RS7A 1WHQA 4LU9A 4GEQB 1SR9A 1T4NA 4GKJE 2V85A 1YYOA 2G7HA 1IBLE 1GQEA 2NUFA 2E1MA 2L3JA 3T1YE 1UHZA 4DR3E 5FLXC 3AUZA 3HPZA 3JU0A 3K6QA 1GZ6A 1DI2A 2V8QB 2WZOA 3VYXA 4B3RE 2LRSA 4BS9A 4X62E 2UXBE 4LF9E 4BC7A 3VYYA 4J8ZA 2KOUA 1N36E 2UUAE 2DB2A 4X64E 4F9CB 4B3ME 3JTZA 2UU9E 2L2KB 2UXDE 3ADLA 2ODRC 1WHNA 1J5EE 3OTOE 2V89A 1I94E 1FKAE 2NA2A 4OOGC 4M2ZA 1ZBTA 2V83A 1X49A 2L33A 4M0VA 5BR8E 2EWLA 2B3TB 5IT9C 5F3WA 2RSMA 4JI4E 4F54A 5LL6R 4KHPE 5LMNE 4JI5E 3IWDA 2FGGA 4X8WA 2N3GA 4L8NA 1T4LB 1YYKA 4BBYA 2UXCE 4GKKE 4DV6E 4P7DA 3KWRA 4LF6E 3J80C 2LE2A 3HTXA 2F8BA 2ZM6E 1DQ3A 2K4VA 3F6GA 4WYQB 2L2MA 4LFCE 3J7Yp 2IHR1 4WPYA 2KONA 2JY9A 2MC6A 2VE7C 2LTRA 1ZBQA 3IWCA 2M7QA 2UUCE 1YZ9A 2L3CA 1RQ0A 2JR1A 3FIGA 4BCAA 1HR0E 5AE2A 3HPSA 1PKPA 4BMJA 5AE3A 4YY3E 1XMQE 4M30A 4BC9A 2E5LE 1IBME 3C4TA 2JWOA 1N33E 4DV0E 5LMUE 4JI6E 4DV5E 4JI7E 3J7AG 2EZ6A 1IBKE 4JI0E 5ADZA 4NXNE 2V86A 2HHHE 4L5NC 4LF7E 2RTXA 2YT4A 4DV4E 4OX9E 2NUEA 4DR4E 1HNZE 4DR5E 3RMPA 2L92A 4TUGA 2L2NA 2LMZA 4LFBE 1XNRE 2NUGA 2V87A 4X66E 1EKZA 2JOBA 1HNWE 2YZTA 4DR7E 3F6HA 2MC5A 2RS6A 4JI2E 5AE1A 1N34E 2UUBE 4DR2E 3ADIA 4R03A 4F9AB 4LTYA 4WFTA 1UILA 1WXRA 4DR6E 2N3HA 3ADJA 4DMIA 2FV4B 4DV2E 2LBSB 3HQ1A 2LUQA 2L8TA 4TUIA 3JAMC 1XMOE 1RC7A 3DJWA 3HXLA 3P1XA 2LJHA 4B3TE 2ODRD 3H09A 4JYAE 1N32E 4NXME 4JI8E 4DR1E 4P78A 1O0WA 2F4VE 5T6JA 2FTXB 2KHXA 5IWAE 3VK6A 4YHHE 4LF8E 4JI1E 2H36X 2VQFE 2VF1A 1X48A 2M1SA 4R8OA 5AASA 3J81C 4DUYE 3IWBA 1STUA 2LUPB 3DF6A 1T4OA 4DKKA 2DSYA 4LFAE 2CPNA 1XNQE 2JVAA 3ZOQB 2DIXA 3ADGA 2V88A 1X47A 5CFFE 4X65E 2B7VA 3OMLA 1J26A 3C4BA 1YYWA 2LTSA 4LF4E 4K0KE 2B9DA 4B3SE 4DUZE 4JV5E 1FJGE 4DV1E 3LMLA 4F9BB 4Q28A 2JOXA 4WSPA 2VQEE 4DV7E 2MDRA 3MSWA 2M4IA 1HNXE 4KZSA 4JI3E 5DNYA 3LLHA 3T1HE 4I8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU6 A;  2DMY A;  4DV3 E;  4LF5 E;  2B7T A;  4AQY E;  2RS7 A;  1WHQ A;  1T4N A;  4GKJ E;  1YYO A;  1IBL E;  1GQE A;  2NUF A;  2L3J A;  3T1Y E;  1UHZ A;  4DR3 E;  1DI2 A;  2UXB E;  3VYX A;  4B3R E;  2LRS A;  4X62 E;  4LF9 E;  3VYY A;  2UUA E;  1N36 E;  2DB2 A;  4X64 E;  4B3M E;  2UU9 E;  2L2K B;  2UXD E;  3ADL A;  1WHN A;  1J5E E;  3OTO E;  1I94 E;  1FKA E;  2NA2 A;  4OOG C;  4M2Z A;  1ZBT A;  1X49 A;  2L33 A;  5BR8 E;  2B3T B;  2RSM A;  4JI4 E;  4KHP E;  5LMN E;  4JI5 E;  4X8W A;  2N3G A;  1T4L B;  1YYK A;  2UXC E;  4GKK E;  4DV6 E;  4LF6 E;  3HTX A;  2ZM6 E;  4WYQ B;  2L2M A;  4LFC E;  3J7Y p;  2IHR 1;  2JY9 A;  1YZ9 A;  2LTR A;  2L3C A;  1RQ0 A;  4DR7 E;  2EZ6 A;  1HR0 E;  1PKP A;  2E5L E;  4YY3 E;  1XMQ E;  4M30 A;  1IBM E;  3C4T A;  1N33 E;  4DV0 E;  5LMU E;  4JI6 E;  4DV5 E;  4JI7 E;  1IBK E;  4JI0 E;  4NXN E;  2HHH E;  4LF7 E;  2NUE A;  4DR4 E;  2RTX A;  2YT4 A;  4DV4 E;  4OX9 E;  1HNZ E;  4DR5 E;  2L2N A;  4LFB E;  1XNR E;  2NUG A;  4X66 E;  1EKZ A;  1HNW E;  2RS6 A;  4JI2 E;  1N34 E;  2UUB E;  4DR2 E;  3ADI A;  4WFT A;  1UIL A;  4DR6 E;  2N3H A;  3ADJ A;  4DV2 E;  2LBS B;  2LUQ A;  1RC7 A;  4B3T E;  1XMO E;  3P1X A;  2LJH A;  4JYA E;  1N32 E;  4NXM E;  4JI8 E;  4DR1 E;  1O0W A;  2F4V E;  2KHX A;  5IWA E;  4YHH E;  4LF8 E;  4JI1 E;  2VQF E;  1X48 A;  4DUY E;  1STU A;  2LUP B;  1T4O A;  4DKK A;  4LFA E;  2CPN A;  1XNQ E;  2JVA A;  2DIX A;  3ADG A;  1X47 A;  5CFF E;  4X65 E;  2B7V A;  1J26 A;  3C4B A;  1YYW A;  2LTS A;  4LF4 E;  4K0K E;  4B3S E;  4DUZ E;  4JV5 E;  1FJG E;  4DV1 E;  2VQE E;  4DV7 E;  2MDR A;  1HNX E;  2UUC E;  4JI3 E;  3LLH A;  3T1H E; 
#chains in the Genus database with same CATH topology
 5A2Q C;  1QU6 A;  2EPO A;  5IV8 B;  2B7T A;  2GLI A;  3C6K A;  2YRH A;  2G7H A;  4HTG A;  1GQE A;  2EMX A;  3T1Y E;  1UHZ A;  3BID A;  5FLX C;  3HPZ A;  3JU0 A;  1ZAA C;  2V8Q B;  3VYX A;  1KYQ A;  2GHF A;  5LLQ A;  4BC7 A;  2UUA E;  2KOU A;  3EPH A;  2EM3 A;  5AC4 A;  1I94 E;  1X6F A;  2LT7 A;  1X49 A;  2L33 A;  2VRD A;  2B3T B;  5IT9 C;  1TF3 A;  4JI5 E;  2ENC A;  1L4S A;  2N3G A;  2EN1 A;  4L8N A;  2HC5 A;  1T4L B;  2MKN A;  1YYK A;  3MHH C;  2YTJ A;  1GTK A;  1A1F A;  3F6G A;  2L2M A;  2E72 A;  1PJT A;  5A6A A;  4WPY A;  2R76 A;  2MC6 A;  1YZ9 A;  2EPC A;  1ZBQ A;  2RPC A;  1IQS A;  4GZN C;  2L3C A;  3FIG A;  4BMJ A;  2E5L E;  2DMI A;  4RHB B;  4M30 A;  1XMQ E;  1IBM E;  2MDG A;  1N33 E;  1A1G A;  4DV0 E;  2HJJ A;  4JI6 E;  1NCS A;  4JI0 E;  1T38 A;  3VHT B;  2V86 A;  2NUE A;  4DV4 E;  4OX9 E;  4DR5 E;  3RMP A;  4WSG A;  2LMZ A;  4LFB E;  2NUG A;  1NEI A;  4R2D A;  2JOB A;  2MC5 A;  4DR2 E;  4F9A B;  4LTY A;  2MKD A;  4WFT A;  4DR6 E;  2EQ0 A;  2LBS B;  3HQ1 A;  2LUQ A;  1YUI A;  4R2P A;  1XMO E;  1QNT A;  2ODR D;  4JI8 E;  1WJP A;  4P78 A;  4WXC A;  2FTX B;  2KHX A;  2YU5 A;  3VK6 A;  1JK1 A;  2H36 X;  2YSP A;  4F2J C;  2VF1 A;  2M1S A;  3M99 B;  4R8O A;  2ENH A;  4DKK A;  2DLK A;  2EOI A;  2EMB A;  2D9H A;  1XNQ E;  3KZY A;  2EM2 A;  2DIX A;  2V88 A;  1X47 A;  2EML A;  2EOO A;  4X65 E;  2YTG A;  2EL5 A;  3C4B A;  5TSE A;  1YFH A;  4K0K E;  2EN8 A;  2CT1 A;  3LML A;  2EPR A;  2ELZ A;  4Q28 A;  2JOX A;  4WSP A;  4ZYE A;  1ZR9 A;  4DV7 E;  1HNX E;  4KZS A;  4JI3 E;  3LLH A;  4O4K A;  2K7I A;  3AV0 A;  4BHC A;  3BGH A;  4NHR A;  2EPA A;  4LU9 A;  1X3C A;  1A1J A;  1KJK A;  2EPZ A;  4GKJ E;  1YYO A;  2EMW A;  4IJD A;  2NUF A;  2L3J A;  3EQ1 A;  4DR3 E;  3K6Q A;  2WZO A;  4B3R E;  4BS9 A;  2EMG A;  3VYY A;  2I13 A;  4J8Z A;  5AC5 A;  4FK5 C;  2LO3 A;  3C6M A;  2ODR C;  1WHN A;  1FKA E;  3L00 A;  2EOS A;  4OOG C;  2EWL A;  5F3W A;  2RSM A;  2EPP A;  5LL6 R;  4KHP E;  1BBO A;  5LMN E;  3IWD A;  2EMF A;  4X8W A;  2Q8U A;  2EOE A;  2UXC E;  2ENA A;  4DV6 E;  1TN9 A;  4R2R A;  2ZM6 E;  4WX9 A;  2EN2 A;  4WYQ B;  1N3G A;  2EOY A;  2EOJ A;  2YRK A;  1RQ0 A;  2EPK X;  2JR1 A;  4BCA A;  2EMZ A;  4F6M A;  2DLQ A;  2JWO A;  2YRM A;  2JP9 A;  3J7A G;  5KL3 A;  4RH8 A;  2EPN A;  2EM4 A;  1BB8 A;  2RTX A;  1IQO A;  2JYA A;  1F2I G;  3TQM A;  4R2S A;  4X66 E;  1EKZ A;  3KZZ A;  2YZT A;  4WXD A;  2LV2 A;  4O43 A;  3ADI A;  2EOR A;  3EPK A;  5KL2 A;  2I9I A;  2M9A A;  2WBU A;  2N3H A;  3ADJ A;  1PDA A;  1LLM C;  3BBG A;  4MLV A;  2ADR A;  1RC7 A;  2EPU A;  3HXL A;  2EPX A;  3H09 A;  4JYA E;  2WBS A;  2EM6 A;  2YTN A;  4X9J A;  5T6J A;  2A25 A;  1YUJ A;  5KL4 A;  2NAB A;  5AAS A;  4F6N A;  1STU A;  3DF6 A;  4IS1 C;  2EN7 A;  2DSY A;  1JK2 A;  2CPN A;  2YTI A;  3ZOQ B;  5CFF E;  2YWQ A;  3OML A;  4B3S E;  4JV5 E;  2VQE E;  1TF6 A;  4R2E A;  3T1H E;  2L6M A;  1X6E A;  2DMY A;  4DV3 E;  4LF5 E;  1A1K A;  2RS7 A;  1G2D C;  1T4N A;  2LJU A;  2EMK A;  1SFE A;  2E1M A;  5A6J A;  2EM5 A;  1MEY C;  2LRS A;  3QG5 C;  2EJ4 A;  2DB2 A;  4B3M E;  2L2K B;  3ADL A;  1J5E E;  5KL5 A;  2V89 A;  3OTO E;  2EL4 A;  2NA2 A;  4M2Z A;  1ZBT A;  2V83 A;  2EMA A;  5BR8 E;  1AH5 A;  2YTQ A;  4JI4 E;  4N4R B;  1PJQ A;  1YPN A;  2EN6 A;  2EMI A;  3EPJ A;  2EE8 A;  4P7D A;  3KWR A;  4LF6 E;  3J80 C;  2EOM A;  2RSI A;  2EN4 A;  1DQ3 A;  1IMU A;  2EL6 A;  2KON A;  2JY9 A;  2M7Q A;  2LTR A;  2EMC A;  2EZ6 A;  2EN3 A;  5AE2 A;  3HPS A;  1HR0 E;  5AE3 A;  4YY3 E;  4BC9 A;  3C4T A;  1G2F C;  4JI7 E;  4R2C A;  1IBK E;  5ADZ A;  2HHH E;  4DR4 E;  2EQ3 A;  2L2N A;  2EPL X;  2N8X A;  1XNR E;  2CSH A;  2YTP A;  4JI2 E;  5AE1 A;  2WCC 3;  1N34 E;  4R03 A;  1UIL A;  2EM7 A;  1PJS A;  2RQL A;  3ECR A;  4DMI A;  2FV4 B;  4DV2 E;  2EP3 A;  2L8T A;  2DRP A;  2EOX A;  4TUI A;  2YSO A;  2LJH A;  2ELY A;  1N32 E;  4NXM E;  4M9V C;  1O0W A;  5IWA E;  2YTD A;  1EH7 A;  4LF8 E;  4R2Q A;  3EPL A;  1A1H A;  2BBG A;  2LUP B;  1T4O A;  2YPN A;  4R2A A;  2JVA A;  3ADG A;  2EM0 A;  2EMY A;  1ZU1 A;  1YYW A;  2LTS A;  4LF4 E;  4DUZ E;  2CTD A;  4DV1 E;  4F9B B;  2MDR A;  3MSW A;  2M4I A;  2YTE A;  2GPI A;  2JPA A;  4AQY E;  2JXP A;  3THN A;  1YSA C;  1WHQ A;  2EPM X;  4GEQ B;  1SR9 A;  2V85 A;  1P47 A;  1IBL E;  1MGT A;  1X6H A;  1DI2 A;  3AUZ A;  1GZ6 A;  2UXB E;  4X62 E;  4LF9 E;  2EOF A;  2EOQ A;  1N36 E;  5A6K A;  1RMD A;  2EMH A;  2J7J A;  4X64 E;  4F9C B;  3JTZ A;  2UU9 E;  2UXD E;  1UN6 B;  2DGC A;  4BHB A;  1X5W A;  3MHS C;  4M0V A;  5A6B D;  4F54 A;  1EH8 A;  4HEI A;  5A69 A;  2FGG A;  1WRJ A;  2EM8 A;  4ZYG A;  5KL7 A;  4BBY A;  5KL6 A;  4GKK E;  2YTF A;  5IXM B;  2LE2 A;  3HTX A;  2LVH A;  2F8B A;  2K4V A;  4ZYH A;  4LFC E;  3J7Y p;  2IHR 1;  2VE7 C;  2YU8 A;  3IWC A;  4NZV A;  2PRT A;  4DR7 E;  1UBD C;  1PKP A;  1DGC A;  4ZYD A;  5LMU E;  4DV5 E;  4NXN E;  2R1F A;  4LF7 E;  4L5N C;  2EQ1 A;  2YT4 A;  1HNZ E;  2L92 A;  4O24 A;  4TUG A;  2V87 A;  1HNW E;  3F6H A;  4Q35 B;  2RS6 A;  4KWY A;  2UUB E;  1AAY A;  1WXR A;  3THO B;  1Z1B A;  5A6B A;  1T39 A;  2HGH A;  4B3T E;  3JAM C;  1BBG A;  3DJW A;  3P1X A;  3UK3 C;  2BB8 A;  4DR1 E;  1EH6 A;  2F4V E;  2EOZ A;  4YHH E;  1A1L A;  4JI1 E;  2EM9 A;  2VQF E;  1A1I A;  1X48 A;  4DUY E;  3J81 C;  3IWB A;  2WBT A;  4LFA E;  4MLQ A;  4O5G A;  2YTO A;  2B7V A;  1J26 A;  2EOH A;  2B9D A;  1FJG E;  2LCE A;  1B69 A;  3BF2 A;  2UUC E;  5DNY A;  4I8O A; 
#chains in the Genus database with same CATH homology
 5A2Q C;  2L6M A;  1QU6 A;  2DMY A;  4DV3 E;  4LF5 E;  2B7T A;  3AV0 A;  4AQY E;  2RS7 A;  1WHQ A;  4LU9 A;  4GEQ B;  1SR9 A;  1T4N A;  4GKJ E;  2V85 A;  1YYO A;  2G7H A;  1IBL E;  1GQE A;  2NUF A;  2E1M A;  2L3J A;  3T1Y E;  1UHZ A;  4DR3 E;  5FLX C;  3AUZ A;  3HPZ A;  3JU0 A;  3K6Q A;  1GZ6 A;  1DI2 A;  2V8Q B;  2WZO A;  3VYX A;  4B3R E;  2LRS A;  4BS9 A;  4X62 E;  2UXB E;  4LF9 E;  4BC7 A;  3VYY A;  4J8Z A;  2KOU A;  1N36 E;  2UUA E;  2DB2 A;  4X64 E;  4F9C B;  4B3M E;  3JTZ A;  2UU9 E;  2L2K B;  2UXD E;  3ADL A;  2ODR C;  1WHN A;  1J5E E;  3OTO E;  2V89 A;  1I94 E;  1FKA E;  2NA2 A;  4OOG C;  4M2Z A;  1ZBT A;  2V83 A;  1X49 A;  2L33 A;  4M0V A;  5BR8 E;  2EWL A;  2B3T B;  5IT9 C;  5F3W A;  2RSM A;  4JI4 E;  4F54 A;  5LL6 R;  4KHP E;  5LMN E;  4JI5 E;  3IWD A;  2FGG A;  4X8W A;  2N3G A;  4L8N A;  1T4L B;  1YYK A;  4BBY A;  2UXC E;  4GKK E;  4DV6 E;  4P7D A;  3KWR A;  4LF6 E;  3J80 C;  2LE2 A;  3HTX A;  2F8B A;  2ZM6 E;  1DQ3 A;  2K4V A;  3F6G A;  4WYQ B;  2L2M A;  4LFC E;  3J7Y p;  2IHR 1;  4WPY A;  2KON A;  2JY9 A;  2MC6 A;  2VE7 C;  2LTR A;  1ZBQ A;  3IWC A;  2M7Q A;  2UUC E;  1YZ9 A;  2L3C A;  1RQ0 A;  2JR1 A;  3FIG A;  4BCA A;  1HR0 E;  5AE2 A;  3HPS A;  1PKP A;  4BMJ A;  5AE3 A;  4YY3 E;  1XMQ E;  4M30 A;  4BC9 A;  2E5L E;  1IBM E;  3C4T A;  2JWO A;  1N33 E;  4DV0 E;  5LMU E;  4JI6 E;  4DV5 E;  4JI7 E;  3J7A G;  2EZ6 A;  1IBK E;  4JI0 E;  5ADZ A;  4NXN E;  2V86 A;  2HHH E;  4L5N C;  4LF7 E;  2RTX A;  2YT4 A;  4DV4 E;  4OX9 E;  2NUE A;  4DR4 E;  1HNZ E;  4DR5 E;  3RMP A;  2L92 A;  4TUG A;  2L2N A;  2LMZ A;  4LFB E;  1XNR E;  2NUG A;  2V87 A;  4X66 E;  1EKZ A;  2JOB A;  1HNW E;  2YZT A;  4DR7 E;  3F6H A;  2MC5 A;  2RS6 A;  4JI2 E;  5AE1 A;  1N34 E;  2UUB E;  4DR2 E;  3ADI A;  4R03 A;  4F9A B;  4LTY A;  4WFT A;  1UIL A;  1WXR A;  4DR6 E;  2N3H A;  3ADJ A;  4DMI A;  2FV4 B;  4DV2 E;  2LBS B;  3HQ1 A;  2LUQ A;  2L8T A;  4TUI A;  3JAM C;  1XMO E;  1RC7 A;  3DJW A;  3HXL A;  3P1X A;  2LJH A;  4B3T E;  2ODR D;  3H09 A;  4JYA E;  1N32 E;  4NXM E;  4JI8 E;  4DR1 E;  4P78 A;  1O0W A;  2F4V E;  5T6J A;  2FTX B;  2KHX A;  5IWA E;  3VK6 A;  4YHH E;  4LF8 E;  4JI1 E;  2H36 X;  2VQF E;  2VF1 A;  1X48 A;  2M1S A;  4R8O A;  5AAS A;  3J81 C;  4DUY E;  3IWB A;  1STU A;  2LUP B;  3DF6 A;  1T4O A;  4DKK A;  2DSY A;  4LFA E;  2CPN A;  1XNQ E;  2JVA A;  3ZOQ B;  2DIX A;  3ADG A;  2V88 A;  1X47 A;  5CFF E;  4X65 E;  2B7V A;  3OML A;  1J26 A;  3C4B A;  1YYW A;  2LTS A;  4LF4 E;  4K0K E;  2B9D A;  4B3S E;  4DUZ E;  4JV5 E;  1FJG E;  4DV1 E;  3LML A;  4F9B B;  4Q28 A;  2JOX A;  4WSP A;  2VQE E;  4DV7 E;  2MDR A;  3MSW A;  2M4I A;  1HNX E;  4KZS A;  4JI3 E;  5DNY A;  3LLH A;  3T1H E;  4I8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...