2ELZA

Solution structure of the 17th zf-c2h2 domain from human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSVEKPYKCEDCGKGYNRRLNLDMHQRVHMGEKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the 17th zf-C2H2 domain from human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2elzA01
2EN1A 3EPHA 2EQ1A 2EMIA 2EM3A 2YRKA 2EM8A 2LT7A 1UBDC 1X6EA 2EN3A 3M99B 2MKDA 1X3CA 2LCEA 2BB8A 2EJ4A 5KL7A 2MDGA 2A25A 2EN7A 1X6FA 2NABA 1UN6B 1BBOA 4M9VC 2YTGA 3MHSC 1YSAC 5KL4A 1X5WA 2EN2A 2EPAA 4FK5C 4IS1C 3MHHC 2CSHA 2EM4A 2YSPA 4R2PA 2EL5A 2EMYA 4R2DA 4F6MA 2WBUA 2ELZA 2EOZA 1X6HA 1TN9A 1ZU1A 2DRPA 1A1HA 1JK2A 2EQ3A 2EP3A 3UK3C 2EPPA 2EM7A 2EOFA 1Z1BA 1TF3A 2J7JA 1A1FA 2I13A 2JP9A 2EMHA 2YTJA 4F2JC 2EM9A 2RPCA 1A1GA 4R2AA 2EOOA 2YRMA 2EPZA 4GZNC 2EOQA 1BB8A 2EMGA 2YTIA 2EM2A 2YTPA 1JK1A 2HGHA 1A1JA 2YTDA 2EOEA 2JPAA 2EN4A 1MEYC 1ZR9A 2EOYA 3EPJA 2EMLA 2ENCA 2EPCA 2YSOA 1B69A 2YU8A 4IJDA 2ENHA 2EL6A 2D9HA 2EN8A 2EOMA 2MKNA 2DGCA 2R1FA 2WBSA 2YRHA 4R2EA 1A1IA 2EM6A 2EL4A 2YU5A 4R2CA 1G2FC 2DLKA 2EPXA 1LLMC 1A1KA 2LO3A 2GLIA 2E72A 4X9JA 2EPRA 2EMBA 5KL3A 2WCC3 3VHTB 2EMWA 2WBTA 2EMXA 2ADRA 2YTNA 1RMDA 2EM0A 2EPUA 2CT1A 2GHFA 2ELYA 1P47A 1AAYA 5KL2A 2YTEA 5KL6A 2EMCA 2EOSA 2EQ0A 1NCSA 2EE8A 2ENAA 2EM5A 2RSIA 2VRDA 2EORA 2YTOA 1WJPA 1YUJA 2EMKA 1KJKA 1YUIA 2LV2A 2EMAA 2YTQA 1TF6A 2DMIA 1A1LA 2YTFA 4R2SA 2EOHA 2PRTA 5KL5A 1DGCA 2DLQA 2EOXA 4WSGA 3EPKA 4F6NA 2EMZA 4R2QA 2EMFA 1ZAAC 2LVHA 1F2IG 2EOIA 2M9AA 2CTDA 1G2DC 2EN6A 4R2RA 3EPLA 2EOJA
chains in the Genus database with same CATH superfamily
3AV0A 3L00A 3ADGA 5A6JA 1YYKA 2B3TB 3F6HA 2YRKA 2EN3A 1N36E 2B7VA 4LF4E 1X3CA 3IWCA 2JVAA 3KWRA 1UN6B 4P78A 5DNYA 1YSAC 1EH6A 2EN2A 4FK5C 2K4VA 4DUYE 4M30A 2LE2A 2N8XA 2EMYA 4F6MA 2UUAE 2K7IA 4GKJE 1TN9A 1PDAA 1JK2A 2N3GA 2G7HA 2KHXA 4DR7E 2EPPA 2L8TA 2EM7A 4DR4E 1Z1BA 5A69A 2L3CA 1TF3A 2J7JA 4LFAE 2JP9A 1RC7A 4F2JC 3IWDA 4WXDA 1XMQE 2EPZA 4JI0E 2YTIA 2YTPA 2EM2A 2BBGA 3C6MA 2YTDA 2E1MA 4K0KE 2EMLA 2ENCA 1PJQA 2CPNA 2EL6A 2KONA 2UXCE 2VQEE 2MKNA 4JI7E 1EKZA 4O4KA 5AC5A 1YZ9A 4F9BB 2B9DA 1L4SA 4R2CA 1YYWA 4BS9A 4YHHE 4JV5E 2EMBA 3VHTB 4WXCA 4F9AB 2HHHE 2RTXA 2LRSA 2EPMX 1AAYA 5KL2A 4DR1E 5ADZA 1IQOA 2RSIA 2EORA 1YUJA 1KJKA 1YUIA 2LV2A 2EPLX 4R2SA 2RQLA 2PRTA 3T1HE 2DLQA 4WPYA 3EPKA 4L5NC 4DMIA 2EMZA 2JOBA 4F54A 2HC5A 1ZAAC 1F2IG 4JI6E 4LF6E 4BHCA 2NUGA 5AASA 4X8WA 2CTDA 3ADIA 4DR3E 5A6BD 4JI5E 2L33A 1DQ3A 2L6MA 1ZBTA 2EQ1A 4X62E 4LF7E 1WHQA 1IBME 1YFHA 2L92A 2RS7A 4WYQB 3JAMC 2LMZA 4NXNE 2BB8A 2EJ4A 4BHBA 3ADJA 3JTZA 2A25A 3AUZA 1X6FA 2DMYA 1BBOA 2WZOA 3MHSC 1T4OA 3HQ1A 4LF9E 3IWBA 3EQ1A 2JOXA 3MHHC 4R2DA 1DI2A 1T4LB 2V89A 4YY3E 4R8OA 2WBUA 2ELZA 2EOZA 1X6HA 1ZU1A 2EQ3A 1UHZA 2F8BA 5A6AA 2EOFA 5BR8E 1J26A 2EMHA 2EM9A 1QU6A 4R2AA 4J8ZA 4GZNC 2LUQA 1GTKA 1EH8A 4F9CB 1PJSA 2HGHA 1STUA 4I8OA 2EN4A 3F6GA 1ZR9A 2EOYA 1SFEA 2EPCA 3LMLA 2YSOA 2YU8A 2R76A 2EOMA 1A1IA 2V86A 4GKKE 3HTXA 2V85A 4M0VA 1LLMC 2LO3A 1HNWE 2L2NA 3BF2A 5LMNE 2WBTA 4WFTA 2MC6A 1O0WA 2RS6A 2EPUA 5IWAE 2GHFA 2ELYA 1RQ0A 1P47A 2YPNA 4OX9E 2ODRC 5KL6A 2VRDA 2EQ0A 2YTOA 4HTGA 3EPLA 2N3HA 4NHRA 1HNZE 3J7AG 2EMAA 2DMIA 1A1LA 2EOHA 4RH8A 4TUIA 5AE2A 3ZOQB 4LFCE 2DB2A 3HPZA 4Q35B 1DGCA 2EOXA 5TSEA 2NUFA 4F6NA 4O24A 2EMFA 4BMJA 2EOIA 4DKKA 2UUCE 5LLQA 2M9AA 2L2KB 3T1YE 3DJWA 4DV3E 1FJGE 1X49A 1N34E 1T39A 2EMIA 1PKPA 4B3ME 2EM8A 2YT4A 2YWQA 1XMOE 3M99B 3BGHA 4BCAA 2LCEA 3HXLA 2FV4B 3C4BA 5LMUE 2EN7A 4Q28A 5A2QC 4M9VC 2GPIA 2JXPA 4BC7A 4DV2E 2MDRA 4IS1C 1T4NA 4JI8E 2LJHA 3P1XA 2CSHA 2EM4A 2YSPA 4R2PA 3VYXA 4AQYE 2I9IA 4ZYHA 1A1HA 5IT9C 2EPNA 2M7QA 4B3RE 2EP3A 3UK3C 2M4IA 4KHPE 5T6JA 4MLVA 1A1FA 2V83A 2JWOA 4DUZE 4X65E 4O5GA 1A1GA 4LF5E 1IQSA 3J81C 1BB8A 1JK1A 2L3JA 2UUBE 2M1SA 2EOEA 2JPAA 5AE1A 1N3GA 2VE7C 1SR9A 1B69A 4DR2E 2YZTA 2ENHA 4DV0E 1WRJA 3JU0A 2DGCA 2R1FA 2WBSA 4ZYDA 4JI1E 4M2ZA 1QNTA 2EL4A 2VF1A 3DF6A 1A1KA 4GEQB 2WCC3 3ECRA 1GZ6A 2EMXA 3J7Yp 1J5EE 2FGGA 2EM0A 2CT1A 1BBGA 2Q8UA 1EH7A 4B3TE 2YRMA 2EE8A 3TQMA 2EM5A 3VK6A 1WJPA 2LTSA 1IMUA 4ZYEA 2LUPB 1TF6A 1WHNA 4DV5E 5IV8B 2EZ6A 3BBGA 1XNQE 4BBYA 2B7TA 5A6KA 5F3WA 1G2DC 4O43A 2JR1A 4HEIA 4KWYA 3KZZA 1UILA 5IXMB 1I94E 1ZBQA 2DSYA 2EN1A 3EPHA 2V87A 2H36X 5AE3A 2EM3A 2LT7A 1UBDC 1X6EA 2NUEA 2LJUA 2MKDA 4NZVA 5KL7A 1XNRE 2MDGA 2FTXB 4JI3E 3VYYA 2NABA 2YTGA 3J80C 4DV7E 5KL4A 1X5WA 2EPAA 5A6BA 3OMLA 2F4VE 4X64E 2EL5A 3MSWA 1YPNA 1T38A 4P7DA 4RHBB 4N4RB 3RMPA 3LLHA 1NEIA 3THOB 5AC4A 2KOUA 2DRPA 3C4TA 4WX9A 4LFBE 1WXRA 5CFFE 2ZM6E 2UXDE 2UU9E 2I13A 2YTJA 2LBSB 4DV6E 2RPCA 2EOOA 2EOQA 2JYAA 2EMGA 3KZYA 4X66E 2ODRD 1A1JA 2VQFE 2V8QB 2EWLA 3HPSA 1MEYC 3QG5C 5LL6R 3EPJA 1HR0E 4IJDA 1IBKE 4JI4E 2D9HA 2EN8A 2EPOA 2E5LE 2V88A 2RSMA 1X47A 4LU9A 2MC5A 2NA2A 2YRHA 4R2EA 4DR5E 2EM6A 3THNA 2YU5A 4LTYA 1G2FC 2DLKA 2EPXA 2L2MA 2GLIA 2E72A 4X9JA 1X48A 2EPRA 5KL3A 2EMWA 4WSPA 2ADRA 1GQEA 1MGTA 4TUGA 4L8NA 2YTNA 1RMDA 1FKAE 4BC9A 4MLQA 2HJJA 1KYQA 3K6QA 4OOGC 2DIXA 2YTEA 5FLXC 2EMCA 2EOSA 1NCSA 2ENAA 2EPKX 1IBLE 2JY9A 1HNXE 3C6KA 2EMKA 2LTRA 4DV4E 2YTQA 4DV1E 1N32E 3ADLA 2YTFA 4B3SE 4DR6E 1N33E 2UXBE 1YYOA 5KL5A 4JI2E 4JYAE 4WSGA 4NXME 1PJTA 3BIDA 4R2QA 2LVHA 3H09A 3FIGA 2EN6A 2IHR1 1AH5A 4LF8E 4ZYGA 3OTOE 4KZSA 4R2RA 4R03A 2EOJA
chains in the Genus database with same CATH topology
2EN1A 3EPHA 2EQ1A 2EMIA 2EM3A 2YRKA 2EM8A 2LT7A 1UBDC 1X6EA 2EN3A 3M99B 2MKDA 1X3CA 2LCEA 2BB8A 2EJ4A 5KL7A 2MDGA 2A25A 2EN7A 1X6FA 2NABA 1UN6B 1BBOA 4M9VC 2YTGA 3MHSC 1YSAC 5KL4A 1X5WA 2EN2A 2EPAA 4FK5C 4IS1C 3MHHC 2CSHA 2EM4A 2YSPA 4R2PA 2EL5A 2EMYA 4R2DA 4F6MA 2WBUA 2ELZA 2EOZA 1X6HA 1TN9A 1ZU1A 2DRPA 1A1HA 1JK2A 2EQ3A 2EP3A 3UK3C 2EPPA 2EM7A 2EOFA 1Z1BA 1TF3A 2J7JA 1A1FA 2I13A 2JP9A 2EMHA 2YTJA 4F2JC 2EM9A 2RPCA 1A1GA 4R2AA 2EOOA 2YRMA 2EPZA 4GZNC 2EOQA 1BB8A 2EMGA 2YTIA 2EM2A 2YTPA 1JK1A 2HGHA 1A1JA 2YTDA 2EOEA 2JPAA 2EN4A 1MEYC 1ZR9A 2EOYA 3EPJA 2EMLA 2ENCA 2EPCA 2YSOA 1B69A 2YU8A 4IJDA 2ENHA 2EL6A 2D9HA 2EN8A 2EOMA 2MKNA 2DGCA 2R1FA 2WBSA 2YRHA 4R2EA 1A1IA 2EM6A 2EL4A 2YU5A 4R2CA 1G2FC 2DLKA 2EPXA 1LLMC 1A1KA 2LO3A 2GLIA 2E72A 4X9JA 2EPRA 2EMBA 5KL3A 2WCC3 3VHTB 2EMWA 2WBTA 2EMXA 2ADRA 2YTNA 1RMDA 2EM0A 2EPUA 2CT1A 2GHFA 2ELYA 1P47A 1AAYA 5KL2A 2YTEA 5KL6A 2EMCA 2EOSA 2EQ0A 1NCSA 2EE8A 2ENAA 2EM5A 2RSIA 2VRDA 2EORA 2YTOA 1WJPA 1YUJA 2EMKA 1KJKA 1YUIA 2LV2A 2EMAA 2YTQA 1TF6A 2DMIA 1A1LA 2YTFA 4R2SA 2EOHA 2PRTA 5KL5A 1DGCA 2DLQA 2EOXA 4WSGA 3EPKA 4F6NA 2EMZA 4R2QA 2EMFA 1ZAAC 2LVHA 1F2IG 2EOIA 2M9AA 2CTDA 1G2DC 2EN6A 4R2RA 3EPLA 2EOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN1 A;  3EPH A;  2EQ1 A;  2EMI A;  2EM3 A;  2YRK A;  2EM8 A;  2LT7 A;  1UBD C;  1X6E A;  2EN3 A;  3M99 B;  2MKD A;  1X3C A;  2LCE A;  2BB8 A;  2EJ4 A;  5KL7 A;  2MDG A;  2A25 A;  2EN7 A;  1X6F A;  2NAB A;  1UN6 B;  1BBO A;  4M9V C;  2YTG A;  3MHS C;  1YSA C;  5KL4 A;  1X5W A;  2EN2 A;  2EPA A;  4FK5 C;  4IS1 C;  3MHH C;  2CSH A;  2EM4 A;  2YSP A;  4R2P A;  2EL5 A;  2EMY A;  4R2D A;  4F6M A;  2WBU A;  2ELZ A;  2EOZ A;  1X6H A;  1TN9 A;  1ZU1 A;  2DRP A;  1A1H A;  1JK2 A;  2EQ3 A;  2EP3 A;  3UK3 C;  2EPP A;  2EM7 A;  2EOF A;  1Z1B A;  1TF3 A;  2J7J A;  1A1F A;  2I13 A;  2JP9 A;  2EMH A;  2YTJ A;  4F2J C;  2EM9 A;  2RPC A;  1A1G A;  4R2A A;  2EOO A;  2YRM A;  2EPZ A;  4GZN C;  2EOQ A;  1BB8 A;  2EMG A;  2YTI A;  2EM2 A;  2YTP A;  1JK1 A;  2HGH A;  1A1J A;  2YTD A;  2EOE A;  2JPA A;  2EN4 A;  1MEY C;  1ZR9 A;  2EOY A;  3EPJ A;  2EML A;  2ENC A;  2EPC A;  2YSO A;  1B69 A;  2YU8 A;  4IJD A;  2ENH A;  2EL6 A;  2D9H A;  2EN8 A;  2EOM A;  2MKN A;  2DGC A;  2R1F A;  2WBS A;  2YRH A;  4R2E A;  1A1I A;  2EM6 A;  2EL4 A;  2YU5 A;  4R2C A;  1G2F C;  2DLK A;  2EPX A;  1LLM C;  1A1K A;  2LO3 A;  2GLI A;  2E72 A;  4X9J A;  2EPR A;  2EMB A;  5KL3 A;  2WCC 3;  3VHT B;  2EMW A;  2WBT A;  2EMX A;  2ADR A;  2YTN A;  1RMD A;  2EM0 A;  2EPU A;  2CT1 A;  2GHF A;  2ELY A;  1P47 A;  1AAY A;  5KL2 A;  2YTE A;  5KL6 A;  2EMC A;  2EOS A;  2EQ0 A;  1NCS A;  2EE8 A;  2ENA A;  2EM5 A;  2RSI A;  2VRD A;  2EOR A;  2YTO A;  1WJP A;  1YUJ A;  2EMK A;  1KJK A;  1YUI A;  2LV2 A;  2EMA A;  2YTQ A;  1TF6 A;  2DMI A;  1A1L A;  2YTF A;  4R2S A;  2EOH A;  2PRT A;  5KL5 A;  1DGC A;  2DLQ A;  2EOX A;  4WSG A;  3EPK A;  4F6N A;  2EMZ A;  4R2Q A;  2EMF A;  1ZAA C;  2LVH A;  1F2I G;  2EOI A;  2M9A A;  2CTD A;  1G2D C;  2EN6 A;  4R2R A;  3EPL A;  2EOJ A; 
#chains in the Genus database with same CATH topology
 3AV0 A;  3L00 A;  3ADG A;  5A6J A;  1YYK A;  2B3T B;  3F6H A;  2YRK A;  2EN3 A;  1N36 E;  2B7V A;  4LF4 E;  1X3C A;  3IWC A;  2JVA A;  3KWR A;  1UN6 B;  4P78 A;  5DNY A;  1YSA C;  1EH6 A;  2EN2 A;  4FK5 C;  2K4V A;  4DUY E;  4M30 A;  2LE2 A;  2N8X A;  2EMY A;  4F6M A;  2UUA E;  2K7I A;  4GKJ E;  1TN9 A;  1PDA A;  1JK2 A;  2N3G A;  2G7H A;  2KHX A;  4DR7 E;  2EPP A;  2L8T A;  2EM7 A;  4DR4 E;  1Z1B A;  5A69 A;  2L3C A;  1TF3 A;  2J7J A;  4LFA E;  2JP9 A;  1RC7 A;  4F2J C;  3IWD A;  4WXD A;  1XMQ E;  2EPZ A;  4JI0 E;  2YTI A;  2YTP A;  2EM2 A;  2BBG A;  3C6M A;  2YTD A;  2E1M A;  4K0K E;  2EML A;  2ENC A;  1PJQ A;  2CPN A;  2EL6 A;  2KON A;  2UXC E;  2VQE E;  2MKN A;  4JI7 E;  1EKZ A;  4O4K A;  5AC5 A;  1YZ9 A;  4F9B B;  2B9D A;  1L4S A;  4R2C A;  1YYW A;  4BS9 A;  4YHH E;  4JV5 E;  2EMB A;  3VHT B;  4WXC A;  4F9A B;  2HHH E;  2RTX A;  2LRS A;  2EPM X;  1AAY A;  5KL2 A;  4DR1 E;  5ADZ A;  1IQO A;  2RSI A;  2EOR A;  1YUJ A;  1KJK A;  1YUI A;  2LV2 A;  2EPL X;  4R2S A;  2RQL A;  2PRT A;  3T1H E;  2DLQ A;  4WPY A;  3EPK A;  4L5N C;  4DMI A;  2EMZ A;  2JOB A;  4F54 A;  2HC5 A;  1ZAA C;  1F2I G;  4JI6 E;  4LF6 E;  4BHC A;  2NUG A;  5AAS A;  4X8W A;  2CTD A;  3ADI A;  4DR3 E;  5A6B D;  4JI5 E;  2L33 A;  1DQ3 A;  2L6M A;  1ZBT A;  2EQ1 A;  4X62 E;  4LF7 E;  1WHQ A;  1IBM E;  1YFH A;  2L92 A;  2RS7 A;  4WYQ B;  3JAM C;  2LMZ A;  4NXN E;  2BB8 A;  2EJ4 A;  4BHB A;  3ADJ A;  3JTZ A;  2A25 A;  3AUZ A;  1X6F A;  2DMY A;  1BBO A;  2WZO A;  3MHS C;  1T4O A;  3HQ1 A;  4LF9 E;  3IWB A;  3EQ1 A;  2JOX A;  3MHH C;  4R2D A;  1DI2 A;  1T4L B;  2V89 A;  4YY3 E;  4R8O A;  2WBU A;  2ELZ A;  2EOZ A;  1X6H A;  1ZU1 A;  2EQ3 A;  1UHZ A;  2F8B A;  5A6A A;  2EOF A;  5BR8 E;  1J26 A;  2EMH A;  2EM9 A;  1QU6 A;  4R2A A;  4J8Z A;  4GZN C;  2LUQ A;  1GTK A;  1EH8 A;  4F9C B;  1PJS A;  2HGH A;  1STU A;  4I8O A;  2EN4 A;  3F6G A;  1ZR9 A;  2EOY A;  1SFE A;  2EPC A;  3LML A;  2YSO A;  2YU8 A;  2R76 A;  2EOM A;  1A1I A;  2V86 A;  4GKK E;  3HTX A;  2V85 A;  4M0V A;  1LLM C;  2LO3 A;  1HNW E;  2L2N A;  3BF2 A;  5LMN E;  2WBT A;  4WFT A;  2MC6 A;  1O0W A;  2RS6 A;  2EPU A;  5IWA E;  2GHF A;  2ELY A;  1RQ0 A;  1P47 A;  2YPN A;  4OX9 E;  2ODR C;  5KL6 A;  2VRD A;  2EQ0 A;  2YTO A;  4HTG A;  3EPL A;  2N3H A;  4NHR A;  1HNZ E;  3J7A G;  2EMA A;  2DMI A;  1A1L A;  2EOH A;  4RH8 A;  4TUI A;  5AE2 A;  3ZOQ B;  4LFC E;  2DB2 A;  3HPZ A;  4Q35 B;  1DGC A;  2EOX A;  5TSE A;  2NUF A;  4F6N A;  4O24 A;  2EMF A;  4BMJ A;  2EOI A;  4DKK A;  2UUC E;  5LLQ A;  2M9A A;  2L2K B;  3T1Y E;  3DJW A;  4DV3 E;  1FJG E;  1X49 A;  1N34 E;  1T39 A;  2EMI A;  1PKP A;  4B3M E;  2EM8 A;  2YT4 A;  2YWQ A;  1XMO E;  3M99 B;  3BGH A;  4BCA A;  2LCE A;  3HXL A;  2FV4 B;  3C4B A;  5LMU E;  2EN7 A;  4Q28 A;  5A2Q C;  4M9V C;  2GPI A;  2JXP A;  4BC7 A;  4DV2 E;  2MDR A;  4IS1 C;  1T4N A;  4JI8 E;  2LJH A;  3P1X A;  2CSH A;  2EM4 A;  2YSP A;  4R2P A;  3VYX A;  4AQY E;  2I9I A;  4ZYH A;  1A1H A;  5IT9 C;  2EPN A;  2M7Q A;  4B3R E;  2EP3 A;  3UK3 C;  2M4I A;  4KHP E;  5T6J A;  4MLV A;  1A1F A;  2V83 A;  2JWO A;  4DUZ E;  4X65 E;  4O5G A;  1A1G A;  4LF5 E;  1IQS A;  3J81 C;  1BB8 A;  1JK1 A;  2L3J A;  2UUB E;  2M1S A;  2EOE A;  2JPA A;  5AE1 A;  1N3G A;  2VE7 C;  1SR9 A;  1B69 A;  4DR2 E;  2YZT A;  2ENH A;  4DV0 E;  1WRJ A;  3JU0 A;  2DGC A;  2R1F A;  2WBS A;  4ZYD A;  4JI1 E;  4M2Z A;  1QNT A;  2EL4 A;  2VF1 A;  3DF6 A;  1A1K A;  4GEQ B;  2WCC 3;  3ECR A;  1GZ6 A;  2EMX A;  3J7Y p;  1J5E E;  2FGG A;  2EM0 A;  2CT1 A;  1BBG A;  2Q8U A;  1EH7 A;  4B3T E;  2YRM A;  2EE8 A;  3TQM A;  2EM5 A;  3VK6 A;  1WJP A;  2LTS A;  1IMU A;  4ZYE A;  2LUP B;  1TF6 A;  1WHN A;  4DV5 E;  5IV8 B;  2EZ6 A;  3BBG A;  1XNQ E;  4BBY A;  2B7T A;  5A6K A;  5F3W A;  1G2D C;  4O43 A;  2JR1 A;  4HEI A;  4KWY A;  3KZZ A;  1UIL A;  5IXM B;  1I94 E;  1ZBQ A;  2DSY A;  2EN1 A;  3EPH A;  2V87 A;  2H36 X;  5AE3 A;  2EM3 A;  2LT7 A;  1UBD C;  1X6E A;  2NUE A;  2LJU A;  2MKD A;  4NZV A;  5KL7 A;  1XNR E;  2MDG A;  2FTX B;  4JI3 E;  3VYY A;  2NAB A;  2YTG A;  3J80 C;  4DV7 E;  5KL4 A;  1X5W A;  2EPA A;  5A6B A;  3OML A;  2F4V E;  4X64 E;  2EL5 A;  3MSW A;  1YPN A;  1T38 A;  4P7D A;  4RHB B;  4N4R B;  3RMP A;  3LLH A;  1NEI A;  3THO B;  5AC4 A;  2KOU A;  2DRP A;  3C4T A;  4WX9 A;  4LFB E;  1WXR A;  5CFF E;  2ZM6 E;  2UXD E;  2UU9 E;  2I13 A;  2YTJ A;  2LBS B;  4DV6 E;  2RPC A;  2EOO A;  2EOQ A;  2JYA A;  2EMG A;  3KZY A;  4X66 E;  2ODR D;  1A1J A;  2VQF E;  2V8Q B;  2EWL A;  3HPS A;  1MEY C;  3QG5 C;  5LL6 R;  3EPJ A;  1HR0 E;  4IJD A;  1IBK E;  4JI4 E;  2D9H A;  2EN8 A;  2EPO A;  2E5L E;  2V88 A;  2RSM A;  1X47 A;  4LU9 A;  2MC5 A;  2NA2 A;  2YRH A;  4R2E A;  4DR5 E;  2EM6 A;  3THN A;  2YU5 A;  4LTY A;  1G2F C;  2DLK A;  2EPX A;  2L2M A;  2GLI A;  2E72 A;  4X9J A;  1X48 A;  2EPR A;  5KL3 A;  2EMW A;  4WSP A;  2ADR A;  1GQE A;  1MGT A;  4TUG A;  4L8N A;  2YTN A;  1RMD A;  1FKA E;  4BC9 A;  4MLQ A;  2HJJ A;  1KYQ A;  3K6Q A;  4OOG C;  2DIX A;  2YTE A;  5FLX C;  2EMC A;  2EOS A;  1NCS A;  2ENA A;  2EPK X;  1IBL E;  2JY9 A;  1HNX E;  3C6K A;  2EMK A;  2LTR A;  4DV4 E;  2YTQ A;  4DV1 E;  1N32 E;  3ADL A;  2YTF A;  4B3S E;  4DR6 E;  1N33 E;  2UXB E;  1YYO A;  5KL5 A;  4JI2 E;  4JYA E;  4WSG A;  4NXM E;  1PJT A;  3BID A;  4R2Q A;  2LVH A;  3H09 A;  3FIG A;  2EN6 A;  2IHR 1;  1AH5 A;  4LF8 E;  4ZYG A;  3OTO E;  4KZS A;  4R2R A;  4R03 A;  2EOJ A; 
#chains in the Genus database with same CATH homology
 2EN1 A;  3EPH A;  2EQ1 A;  2EMI A;  2EM3 A;  2YRK A;  2EM8 A;  2LT7 A;  1UBD C;  1X6E A;  2EN3 A;  3M99 B;  2MKD A;  1X3C A;  2LCE A;  2BB8 A;  2EJ4 A;  5KL7 A;  2MDG A;  2A25 A;  2EN7 A;  1X6F A;  2NAB A;  1UN6 B;  1BBO A;  4M9V C;  2YTG A;  3MHS C;  1YSA C;  5KL4 A;  1X5W A;  2EN2 A;  2EPA A;  4FK5 C;  4IS1 C;  3MHH C;  2CSH A;  2EM4 A;  2YSP A;  4R2P A;  2EL5 A;  2EMY A;  4R2D A;  4F6M A;  2WBU A;  2ELZ A;  2EOZ A;  1X6H A;  1TN9 A;  1ZU1 A;  2DRP A;  1A1H A;  1JK2 A;  2EQ3 A;  2EP3 A;  3UK3 C;  2EPP A;  2EM7 A;  2EOF A;  1Z1B A;  1TF3 A;  2J7J A;  1A1F A;  2I13 A;  2JP9 A;  2EMH A;  2YTJ A;  4F2J C;  2EM9 A;  2RPC A;  1A1G A;  4R2A A;  2EOO A;  2YRM A;  2EPZ A;  4GZN C;  2EOQ A;  1BB8 A;  2EMG A;  2YTI A;  2EM2 A;  2YTP A;  1JK1 A;  2HGH A;  1A1J A;  2YTD A;  2EOE A;  2JPA A;  2EN4 A;  1MEY C;  1ZR9 A;  2EOY A;  3EPJ A;  2EML A;  2ENC A;  2EPC A;  2YSO A;  1B69 A;  2YU8 A;  4IJD A;  2ENH A;  2EL6 A;  2D9H A;  2EN8 A;  2EOM A;  2MKN A;  2DGC A;  2R1F A;  2WBS A;  2YRH A;  4R2E A;  1A1I A;  2EM6 A;  2EL4 A;  2YU5 A;  4R2C A;  1G2F C;  2DLK A;  2EPX A;  1LLM C;  1A1K A;  2LO3 A;  2GLI A;  2E72 A;  4X9J A;  2EPR A;  2EMB A;  5KL3 A;  2WCC 3;  3VHT B;  2EMW A;  2WBT A;  2EMX A;  2ADR A;  2YTN A;  1RMD A;  2EM0 A;  2EPU A;  2CT1 A;  2GHF A;  2ELY A;  1P47 A;  1AAY A;  5KL2 A;  2YTE A;  5KL6 A;  2EMC A;  2EOS A;  2EQ0 A;  1NCS A;  2EE8 A;  2ENA A;  2EM5 A;  2RSI A;  2VRD A;  2EOR A;  2YTO A;  1WJP A;  1YUJ A;  2EMK A;  1KJK A;  1YUI A;  2LV2 A;  2EMA A;  2YTQ A;  1TF6 A;  2DMI A;  1A1L A;  2YTF A;  4R2S A;  2EOH A;  2PRT A;  5KL5 A;  1DGC A;  2DLQ A;  2EOX A;  4WSG A;  3EPK A;  4F6N A;  2EMZ A;  4R2Q A;  2EMF A;  1ZAA C;  2LVH A;  1F2I G;  2EOI A;  2M9A A;  2CTD A;  1G2D C;  2EN6 A;  4R2R A;  3EPL A;  2EOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...