2ELZA

Solution structure of the 17th zf-c2h2 domain from human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGSVEKPYKCEDCGKGYNRRLNLDMHQRVHMGEKTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the 17th zf-C2H2 domain from human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2elzA01
2YTPA 2EM3A 2EMAA 1X3CA 2EPAA 5KL7A 2ENAA 1A1FA 2E72A 2GHFA 4F6MA 1WJPA 2YRMA 2EOZA 2YTIA 2R1FA 3M99B 4F6NA 1A1LA 1ZAAC 4F2JC 2ADRA 1UBDC 2EOYA 2ENCA 2GLIA 4GZNC 2J7JA 2RSIA 2YTJA 1G2FC 1RMDA 3EPKA 2EQ1A 2EM9A 2YTOA 2EMLA 1MEYC 1BB8A 2YTGA 4X9JA 2EOQA 2EPZA 4R2RA 2EOFA 2ELYA 2DGCA 2VRDA 4IS1C 1A1HA 2EN3A 2EM7A 2EN2A 3MHHC 4FK5C 5KL5A 1Z1BA 2EQ3A 2CTDA 4R2PA 2PRTA 2EN1A 2YRHA 1B69A 4R2QA 3UK3C 2EJ4A 1ZU1A 4IJDA 2EPUA 1A1KA 3EPJA 2D9HA 2EOMA 2YRKA 2BB8A 2YTNA 2A25A 2EM2A 1BBOA 2EN7A 2ENHA 2EN6A 2EPPA 1UN6B 2CT1A 2EPCA 1X5WA 1JK1A 2EL6A 1NCSA 2YSOA 2MKDA 1YSAC 2YU8A 2EM8A 1X6HA 2EOSA 1KJKA 1A1IA 1ZR9A 2EOEA 1A1JA 2EOXA 2ELZA 2EMBA 2EMYA 2EOOA 1X6FA 2LCEA 4R2SA 2EOJA 2EMZA 2MKNA 2EL4A 2EMGA 3MHSC 2YTDA 2WBSA 1F2IG 1DGCA 2EOHA 2EMHA 5KL4A 2EM4A 4R2DA 2LV2A 2MDGA 2WBTA 2YTEA 2YTFA 4R2EA 2JPAA 5KL3A 2EN4A 1YUIA 2EQ0A 5KL2A 2YU5A 4R2CA 1P47A 2LT7A 2EMXA 2M9AA 4WSGA 2RPCA 3EPLA 2EMWA 2DRPA 2NABA 2WCC3 2CSHA 2LO3A 2WBUA 1G2DC 2EMFA 1LLMC 1TF6A 2EOIA 2EORA 2I13A 2EN8A 2EP3A 3VHTB 2YTQA 2EMCA 2DLKA 1YUJA 3EPHA 2EPRA 2EMKA 2EM6A 1TF3A 1JK2A 2EE8A 2EL5A 4M9VC 2LVHA 4R2AA 2HGHA 1AAYA 5KL6A 2YSPA 2JP9A 1X6EA 2DMIA 2DLQA 2EM0A 2EPXA 2EMIA 1TN9A 2EM5A 1A1GA
chains in the Genus database with same CATH superfamily
2EMAA 1X3CA 1YYWA 2V86A 2EPAA 1A1FA 4F6MA 3HPZA 2YRMA 4YHHE 5T6JA 4I8OA 4ZYGA 1A1LA 1UBDC 2EOYA 3HTXA 1XMQE 4NZVA 1PJQA 2EQ1A 2NUFA 2EMLA 1MEYC 2M7QA 2H36X 3EQ1A 5A2QC 1ZBTA 2YTGA 2LUPB 2UUBE 3F6GA 3HPSA 4B3TE 4B3SE 5IV8B 5KL5A 4FK5C 2CTDA 2YRHA 3AV0A 4R2QA 3UK3C 4DR4E 2EPUA 2LTSA 4DV7E 4LF7E 3EPJA 2D9HA 1ZBQA 4X62E 4F9BB 4DR7E 2A25A 1EH7A 3QG5C 4BBYA 2MC6A 1IBME 4JI2E 1UN6B 1X5WA 1YYOA 2EL6A 2MKDA 4P78A 2YU8A 1KJKA 1X6HA 3THOB 2DB2A 4J8ZA 4BCAA 2JOBA 2ELZA 2EMYA 2LCEA 4JI4E 1N32E 1YPNA 3OMLA 2NUEA 1F2IG 2YTDA 4LFCE 4HEIA 2MDGA 4JI7E 4JI1E 2LUQA 4MLQA 2JY9A 1PJTA 1YFHA 2F8BA 3BBGA 4WXDA 1N33E 5A6JA 4NXME 2UXBE 4WSGA 3OTOE 2VF1A 2EMWA 3ZOQB 1YZ9A 3J80C 2WCC3 2LO3A 2EPMX 4DMIA 1X47A 3ECRA 3VHTB 2EMCA 3EPHA 4WX9A 2ZM6E 2EM6A 2UUCE 5IXMB 2Q8UA 3THNA 2EPXA 2EMIA 5LL6R 4DV2E 1A1GA 4TUGA 2EM3A 2UXCE 2DMYA 3IWCA 5KL7A 2ENAA 4LFAE 1GTKA 2GHFA 1WJPA 4BHCA 5IWAE 1T38A 2UXDE 4M30A 2L2NA 4JI5E 5AE2A 1ZAAC 4OX9E 2ODRC 2ADRA 4L5NC 4DV5E 4M2ZA 2L8TA 2YTJA 1G2FC 2JVAA 5IT9C 1BB8A 2E5LE 2EPKX 4X9JA 4R2RA 3IWDA 2RS6A 4WFTA 1STUA 4IS1C 3L00A 1FKAE 5LLQA 1DQ3A 2M1SA 3MHHC 3T1HE 3DF6A 1B69A 2EN1A 4N4RB 2L33A 1A1KA 1IBKE 2EOMA 2YRKA 2BB8A 2YTNA 2EM2A 1BBOA 2EN7A 2MDRA 2EN6A 2V8QB 4Q35B 4JYAE 2CT1A 1MGTA 2EPOA 1YSAC 2MC5A 1FJGE 2DSYA 2EM8A 2EOSA 3J7Yp 1EH8A 4DKKA 2EMBA 1X6FA 2NA2A 1RC7A 2EMZA 1XNQE 2RQLA 1UHZA 2EMGA 4DR6E 2B7TA 4YY3E 2L2MA 4KWYA 1J26A 4JI6E 4KHPE 3J7AG 3P1XA 2B9DA 4BC7A 4R2EA 2YTFA 2JPAA 2EN4A 1T4OA 4WYQB 1YUIA 3F6HA 2EQ0A 4TUIA 3HQ1A 5KL2A 2YU5A 4DR5E 2LTRA 2LJHA 4WXCA 4GEQB 1LLMC 1J5EE 2EPRA 3KZZA 1T4NA 4NXNE 1YYKA 2EL5A 1AAYA 1RQ0A 5KL6A 2YSPA 1N3GA 1X6EA 2ODRD 3IWBA 3ADJA 2GPIA 1EKZA 2DLQA 2EM0A 4BC9A 2YT4A 1T4LB 2E1MA 1TN9A 2IHR1 3C4TA 4JV5E 2FTXB 2YWQA 2E72A 5A6BA 3J81C 4LF4E 2EOZA 3LLHA 2R1FA 4F6NA 4X66E 4DV6E 5AC5A 2L2KB 2HHHE 4F2JC 2GLIA 4GZNC 2J7JA 4B3ME 1XNRE 2YTOA 2EM9A 2RSMA 4O4KA 1X48A 3FIGA 3K6QA 2EPZA 2EOFA 2VRDA 4LTYA 1A1HA 3VYYA 4OOGC 2EN2A 4K0KE 2KHXA 1Z1BA 2EQ3A 1SR9A 4AQYE 4IJDA 1ZU1A 2K4VA 2KONA 4LF6E 1O0WA 2V87A 2EPLX 2VE7C 1XMOE 1I94E 4LF8E 4WPYA 2RS7A 5AASA 1X49A 1GZ6A 2EPPA 2WZOA 3JU0A 4RH8A 4KZSA 2EPCA 1JK1A 2EWLA 1PJSA 2YSOA 2I9IA 4GKJE 3ADLA 3H09A 4Q28A 1NEIA 5ADZA 1ZR9A 2UUAE 2LBSB 1A1JA 5A6KA 2VQFE 4R2SA 2DIXA 2EOJA 4ZYEA 2N3GA 2UU9E 1GQEA 2B3TB 2L3JA 2WBSA 4B3RE 4R03A 2M4IA 2EOHA 1DGCA 2EMHA 2JOXA 2EM4A 5KL4A 4ZYDA 2R76A 3AUZA 4LFBE 2EMXA 2M9AA 3HXLA 3EPLA 2DRPA 2N8XA 1KYQA 2NABA 2CSHA 2WBUA 4DV0E 3BF2A 1QNTA 4F54A 2EORA 2I13A 2F4VE 2N3HA 5TSEA 1N34E 1HNZE 4DV1E 2EE8A 1TF3A 2LJUA 2V85A 2HGHA 2CPNA 3BIDA 4DV3E 5CFFE 2DMIA 1HR0E 2V83A 1T39A 2EM5A 2B7VA 1EH6A 2EZ6A 1PKPA 2YTPA 3C6MA 4F9CB 4WSPA 3ADGA 4F9AB 4DR2E 4MLVA 2L3CA 2KOUA 4GKKE 5AE3A 1BBGA 2YTIA 3C4BA 2JWOA 1N36E 1IQSA 3M99B 2JR1A 1HNWE 4DR1E 2YZTA 2ENCA 4JI8E 2RSIA 4X8WA 4BHBA 4RHBB 1RMDA 3EPKA 4JI3E 3JAMC 4X65E 1AH5A 5AE1A 1WXRA 2V88A 3ADIA 2EOQA 3TQMA 4DV4E 2ELYA 2V89A 3KZYA 2DGCA 4L8NA 1DI2A 2EN3A 2EM7A 1WRJA 2VQEE 3C6KA 4R2PA 3LMLA 2PRTA 2L6MA 1IBLE 2EJ4A 2K7IA 1WHNA 2JXPA 3VYXA 3VK6A 1IMUA 2JYAA 2HC5A 2FGGA 4P7DA 2ENHA 4LF9E 2RTXA 1UILA 4M0VA 3DJWA 1NCSA 2HJJA 5LMNE 5AC4A 4DR3E 1A1IA 2EOEA 2EOXA 3KWRA 4LU9A 2EPNA 4HTGA 2EOOA 5A6BD 2LMZA 5BR8E 1HNXE 4DUYE 5FLXC 2YPNA 5F3WA 2MKNA 4JI0E 1IQOA 4O24A 3MSWA 2EL4A 4DUZE 3MHSC 3JTZA 2G7HA 4R2DA 1L4SA 2LV2A 2WBTA 4BS9A 2YTEA 5A69A 5KL3A 2FV4B 5A6AA 1WHQA 4NHRA 4R2CA 1P47A 2LT7A 4ZYHA 1SFEA 1PDAA 2RPCA 5DNYA 3T1YE 4O43A 4O5GA 4BMJA 1G2DC 2EMFA 1TF6A 5LMUE 3RMPA 2EOIA 2EN8A 2EP3A 2L92A 1QU6A 2YTQA 2DLKA 1YUJA 2NUGA 4LF5E 2EMKA 1JK2A 4M9VC 2LVHA 4X64E 4R2AA 2JP9A 4R8OA 2BBGA 3BGHA 2LE2A 2LRSA
chains in the Genus database with same CATH topology
2YTPA 2EM3A 2EMAA 1X3CA 2EPAA 5KL7A 2ENAA 1A1FA 2E72A 2GHFA 4F6MA 1WJPA 2YRMA 2EOZA 2YTIA 2R1FA 3M99B 4F6NA 1A1LA 1ZAAC 4F2JC 2ADRA 1UBDC 2EOYA 2ENCA 2GLIA 4GZNC 2J7JA 2RSIA 2YTJA 1G2FC 1RMDA 3EPKA 2EQ1A 2EM9A 2YTOA 2EMLA 1MEYC 1BB8A 2YTGA 4X9JA 2EOQA 2EPZA 4R2RA 2EOFA 2ELYA 2DGCA 2VRDA 4IS1C 1A1HA 2EN3A 2EM7A 2EN2A 3MHHC 4FK5C 5KL5A 1Z1BA 2EQ3A 2CTDA 4R2PA 2PRTA 2EN1A 2YRHA 1B69A 4R2QA 3UK3C 2EJ4A 1ZU1A 4IJDA 2EPUA 1A1KA 3EPJA 2D9HA 2EOMA 2YRKA 2BB8A 2YTNA 2A25A 2EM2A 1BBOA 2EN7A 2ENHA 2EN6A 2EPPA 1UN6B 2CT1A 2EPCA 1X5WA 1JK1A 2EL6A 1NCSA 2YSOA 2MKDA 1YSAC 2YU8A 2EM8A 1X6HA 2EOSA 1KJKA 1A1IA 1ZR9A 2EOEA 1A1JA 2EOXA 2ELZA 2EMBA 2EMYA 2EOOA 1X6FA 2LCEA 4R2SA 2EOJA 2EMZA 2MKNA 2EL4A 2EMGA 3MHSC 2YTDA 2WBSA 1F2IG 1DGCA 2EOHA 2EMHA 5KL4A 2EM4A 4R2DA 2LV2A 2MDGA 2WBTA 2YTEA 2YTFA 4R2EA 2JPAA 5KL3A 2EN4A 1YUIA 2EQ0A 5KL2A 2YU5A 4R2CA 1P47A 2LT7A 2EMXA 2M9AA 4WSGA 2RPCA 3EPLA 2EMWA 2DRPA 2NABA 2WCC3 2CSHA 2LO3A 2WBUA 1G2DC 2EMFA 1LLMC 1TF6A 2EOIA 2EORA 2I13A 2EN8A 2EP3A 3VHTB 2YTQA 2EMCA 2DLKA 1YUJA 3EPHA 2EPRA 2EMKA 2EM6A 1TF3A 1JK2A 2EE8A 2EL5A 4M9VC 2LVHA 4R2AA 2HGHA 1AAYA 5KL6A 2YSPA 2JP9A 1X6EA 2DMIA 2DLQA 2EM0A 2EPXA 2EMIA 1TN9A 2EM5A 1A1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTP A;  2EM3 A;  2EMA A;  1X3C A;  2EPA A;  5KL7 A;  2ENA A;  1A1F A;  2E72 A;  2GHF A;  4F6M A;  1WJP A;  2YRM A;  2EOZ A;  2YTI A;  2R1F A;  3M99 B;  4F6N A;  1A1L A;  1ZAA C;  4F2J C;  2ADR A;  1UBD C;  2EOY A;  2ENC A;  2GLI A;  4GZN C;  2J7J A;  2RSI A;  2YTJ A;  1G2F C;  1RMD A;  3EPK A;  2EQ1 A;  2EM9 A;  2YTO A;  2EML A;  1MEY C;  1BB8 A;  2YTG A;  4X9J A;  2EOQ A;  2EPZ A;  4R2R A;  2EOF A;  2ELY A;  2DGC A;  2VRD A;  4IS1 C;  1A1H A;  2EN3 A;  2EM7 A;  2EN2 A;  3MHH C;  4FK5 C;  5KL5 A;  1Z1B A;  2EQ3 A;  2CTD A;  4R2P A;  2PRT A;  2EN1 A;  2YRH A;  1B69 A;  4R2Q A;  3UK3 C;  2EJ4 A;  1ZU1 A;  4IJD A;  2EPU A;  1A1K A;  3EPJ A;  2D9H A;  2EOM A;  2YRK A;  2BB8 A;  2YTN A;  2A25 A;  2EM2 A;  1BBO A;  2EN7 A;  2ENH A;  2EN6 A;  2EPP A;  1UN6 B;  2CT1 A;  2EPC A;  1X5W A;  1JK1 A;  2EL6 A;  1NCS A;  2YSO A;  2MKD A;  1YSA C;  2YU8 A;  2EM8 A;  1X6H A;  2EOS A;  1KJK A;  1A1I A;  1ZR9 A;  2EOE A;  1A1J A;  2EOX A;  2ELZ A;  2EMB A;  2EMY A;  2EOO A;  1X6F A;  2LCE A;  4R2S A;  2EOJ A;  2EMZ A;  2MKN A;  2EL4 A;  2EMG A;  3MHS C;  2YTD A;  2WBS A;  1F2I G;  1DGC A;  2EOH A;  2EMH A;  5KL4 A;  2EM4 A;  4R2D A;  2LV2 A;  2MDG A;  2WBT A;  2YTE A;  2YTF A;  4R2E A;  2JPA A;  5KL3 A;  2EN4 A;  1YUI A;  2EQ0 A;  5KL2 A;  2YU5 A;  4R2C A;  1P47 A;  2LT7 A;  2EMX A;  2M9A A;  4WSG A;  2RPC A;  3EPL A;  2EMW A;  2DRP A;  2NAB A;  2WCC 3;  2CSH A;  2LO3 A;  2WBU A;  1G2D C;  2EMF A;  1LLM C;  1TF6 A;  2EOI A;  2EOR A;  2I13 A;  2EN8 A;  2EP3 A;  3VHT B;  2YTQ A;  2EMC A;  2DLK A;  1YUJ A;  3EPH A;  2EPR A;  2EMK A;  2EM6 A;  1TF3 A;  1JK2 A;  2EE8 A;  2EL5 A;  4M9V C;  2LVH A;  4R2A A;  2HGH A;  1AAY A;  5KL6 A;  2YSP A;  2JP9 A;  1X6E A;  2DMI A;  2DLQ A;  2EM0 A;  2EPX A;  2EMI A;  1TN9 A;  2EM5 A;  1A1G A; 
#chains in the Genus database with same CATH topology
 2EMA A;  1X3C A;  1YYW A;  2V86 A;  2EPA A;  1A1F A;  4F6M A;  3HPZ A;  2YRM A;  4YHH E;  5T6J A;  4I8O A;  4ZYG A;  1A1L A;  1UBD C;  2EOY A;  3HTX A;  1XMQ E;  4NZV A;  1PJQ A;  2EQ1 A;  2NUF A;  2EML A;  1MEY C;  2M7Q A;  2H36 X;  3EQ1 A;  5A2Q C;  1ZBT A;  2YTG A;  2LUP B;  2UUB E;  3F6G A;  3HPS A;  4B3T E;  4B3S E;  5IV8 B;  5KL5 A;  4FK5 C;  2CTD A;  2YRH A;  3AV0 A;  4R2Q A;  3UK3 C;  4DR4 E;  2EPU A;  2LTS A;  4DV7 E;  4LF7 E;  3EPJ A;  2D9H A;  1ZBQ A;  4X62 E;  4F9B B;  4DR7 E;  2A25 A;  1EH7 A;  3QG5 C;  4BBY A;  2MC6 A;  1IBM E;  4JI2 E;  1UN6 B;  1X5W A;  1YYO A;  2EL6 A;  2MKD A;  4P78 A;  2YU8 A;  1KJK A;  1X6H A;  3THO B;  2DB2 A;  4J8Z A;  4BCA A;  2JOB A;  2ELZ A;  2EMY A;  2LCE A;  4JI4 E;  1N32 E;  1YPN A;  3OML A;  2NUE A;  1F2I G;  2YTD A;  4LFC E;  4HEI A;  2MDG A;  4JI7 E;  4JI1 E;  2LUQ A;  4MLQ A;  2JY9 A;  1PJT A;  1YFH A;  2F8B A;  3BBG A;  4WXD A;  1N33 E;  5A6J A;  4NXM E;  2UXB E;  4WSG A;  3OTO E;  2VF1 A;  2EMW A;  3ZOQ B;  1YZ9 A;  3J80 C;  2WCC 3;  2LO3 A;  2EPM X;  4DMI A;  1X47 A;  3ECR A;  3VHT B;  2EMC A;  3EPH A;  4WX9 A;  2ZM6 E;  2EM6 A;  2UUC E;  5IXM B;  2Q8U A;  3THN A;  2EPX A;  2EMI A;  5LL6 R;  4DV2 E;  1A1G A;  4TUG A;  2EM3 A;  2UXC E;  2DMY A;  3IWC A;  5KL7 A;  2ENA A;  4LFA E;  1GTK A;  2GHF A;  1WJP A;  4BHC A;  5IWA E;  1T38 A;  2UXD E;  4M30 A;  2L2N A;  4JI5 E;  5AE2 A;  1ZAA C;  4OX9 E;  2ODR C;  2ADR A;  4L5N C;  4DV5 E;  4M2Z A;  2L8T A;  2YTJ A;  1G2F C;  2JVA A;  5IT9 C;  1BB8 A;  2E5L E;  2EPK X;  4X9J A;  4R2R A;  3IWD A;  2RS6 A;  4WFT A;  1STU A;  4IS1 C;  3L00 A;  1FKA E;  5LLQ A;  1DQ3 A;  2M1S A;  3MHH C;  3T1H E;  3DF6 A;  1B69 A;  2EN1 A;  4N4R B;  2L33 A;  1A1K A;  1IBK E;  2EOM A;  2YRK A;  2BB8 A;  2YTN A;  2EM2 A;  1BBO A;  2EN7 A;  2MDR A;  2EN6 A;  2V8Q B;  4Q35 B;  4JYA E;  2CT1 A;  1MGT A;  2EPO A;  1YSA C;  2MC5 A;  1FJG E;  2DSY A;  2EM8 A;  2EOS A;  3J7Y p;  1EH8 A;  4DKK A;  2EMB A;  1X6F A;  2NA2 A;  1RC7 A;  2EMZ A;  1XNQ E;  2RQL A;  1UHZ A;  2EMG A;  4DR6 E;  2B7T A;  4YY3 E;  2L2M A;  4KWY A;  1J26 A;  4JI6 E;  4KHP E;  3J7A G;  3P1X A;  2B9D A;  4BC7 A;  4R2E A;  2YTF A;  2JPA A;  2EN4 A;  1T4O A;  4WYQ B;  1YUI A;  3F6H A;  2EQ0 A;  4TUI A;  3HQ1 A;  5KL2 A;  2YU5 A;  4DR5 E;  2LTR A;  2LJH A;  4WXC A;  4GEQ B;  1LLM C;  1J5E E;  2EPR A;  3KZZ A;  1T4N A;  4NXN E;  1YYK A;  2EL5 A;  1AAY A;  1RQ0 A;  5KL6 A;  2YSP A;  1N3G A;  1X6E A;  2ODR D;  3IWB A;  3ADJ A;  2GPI A;  1EKZ A;  2DLQ A;  2EM0 A;  4BC9 A;  2YT4 A;  1T4L B;  2E1M A;  1TN9 A;  2IHR 1;  3C4T A;  4JV5 E;  2FTX B;  2YWQ A;  2E72 A;  5A6B A;  3J81 C;  4LF4 E;  2EOZ A;  3LLH A;  2R1F A;  4F6N A;  4X66 E;  4DV6 E;  5AC5 A;  2L2K B;  2HHH E;  4F2J C;  2GLI A;  4GZN C;  2J7J A;  4B3M E;  1XNR E;  2YTO A;  2EM9 A;  2RSM A;  4O4K A;  1X48 A;  3FIG A;  3K6Q A;  2EPZ A;  2EOF A;  2VRD A;  4LTY A;  1A1H A;  3VYY A;  4OOG C;  2EN2 A;  4K0K E;  2KHX A;  1Z1B A;  2EQ3 A;  1SR9 A;  4AQY E;  4IJD A;  1ZU1 A;  2K4V A;  2KON A;  4LF6 E;  1O0W A;  2V87 A;  2EPL X;  2VE7 C;  1XMO E;  1I94 E;  4LF8 E;  4WPY A;  2RS7 A;  5AAS A;  1X49 A;  1GZ6 A;  2EPP A;  2WZO A;  3JU0 A;  4RH8 A;  4KZS A;  2EPC A;  1JK1 A;  2EWL A;  1PJS A;  2YSO A;  2I9I A;  4GKJ E;  3ADL A;  3H09 A;  4Q28 A;  1NEI A;  5ADZ A;  1ZR9 A;  2UUA E;  2LBS B;  1A1J A;  5A6K A;  2VQF E;  4R2S A;  2DIX A;  2EOJ A;  4ZYE A;  2N3G A;  2UU9 E;  1GQE A;  2B3T B;  2L3J A;  2WBS A;  4B3R E;  4R03 A;  2M4I A;  2EOH A;  1DGC A;  2EMH A;  2JOX A;  2EM4 A;  5KL4 A;  4ZYD A;  2R76 A;  3AUZ A;  4LFB E;  2EMX A;  2M9A A;  3HXL A;  3EPL A;  2DRP A;  2N8X A;  1KYQ A;  2NAB A;  2CSH A;  2WBU A;  4DV0 E;  3BF2 A;  1QNT A;  4F54 A;  2EOR A;  2I13 A;  2F4V E;  2N3H A;  5TSE A;  1N34 E;  1HNZ E;  4DV1 E;  2EE8 A;  1TF3 A;  2LJU A;  2V85 A;  2HGH A;  2CPN A;  3BID A;  4DV3 E;  5CFF E;  2DMI A;  1HR0 E;  2V83 A;  1T39 A;  2EM5 A;  2B7V A;  1EH6 A;  2EZ6 A;  1PKP A;  2YTP A;  3C6M A;  4F9C B;  4WSP A;  3ADG A;  4F9A B;  4DR2 E;  4MLV A;  2L3C A;  2KOU A;  4GKK E;  5AE3 A;  1BBG A;  2YTI A;  3C4B A;  2JWO A;  1N36 E;  1IQS A;  3M99 B;  2JR1 A;  1HNW E;  4DR1 E;  2YZT A;  2ENC A;  4JI8 E;  2RSI A;  4X8W A;  4BHB A;  4RHB B;  1RMD A;  3EPK A;  4JI3 E;  3JAM C;  4X65 E;  1AH5 A;  5AE1 A;  1WXR A;  2V88 A;  3ADI A;  2EOQ A;  3TQM A;  4DV4 E;  2ELY A;  2V89 A;  3KZY A;  2DGC A;  4L8N A;  1DI2 A;  2EN3 A;  2EM7 A;  1WRJ A;  2VQE E;  3C6K A;  4R2P A;  3LML A;  2PRT A;  2L6M A;  1IBL E;  2EJ4 A;  2K7I A;  1WHN A;  2JXP A;  3VYX A;  3VK6 A;  1IMU A;  2JYA A;  2HC5 A;  2FGG A;  4P7D A;  2ENH A;  4LF9 E;  2RTX A;  1UIL A;  4M0V A;  3DJW A;  1NCS A;  2HJJ A;  5LMN E;  5AC4 A;  4DR3 E;  1A1I A;  2EOE A;  2EOX A;  3KWR A;  4LU9 A;  2EPN A;  4HTG A;  2EOO A;  5A6B D;  2LMZ A;  5BR8 E;  1HNX E;  4DUY E;  5FLX C;  2YPN A;  5F3W A;  2MKN A;  4JI0 E;  1IQO A;  4O24 A;  3MSW A;  2EL4 A;  4DUZ E;  3MHS C;  3JTZ A;  2G7H A;  4R2D A;  1L4S A;  2LV2 A;  2WBT A;  4BS9 A;  2YTE A;  5A69 A;  5KL3 A;  2FV4 B;  5A6A A;  1WHQ A;  4NHR A;  4R2C A;  1P47 A;  2LT7 A;  4ZYH A;  1SFE A;  1PDA A;  2RPC A;  5DNY A;  3T1Y E;  4O43 A;  4O5G A;  4BMJ A;  1G2D C;  2EMF A;  1TF6 A;  5LMU E;  3RMP A;  2EOI A;  2EN8 A;  2EP3 A;  2L92 A;  1QU6 A;  2YTQ A;  2DLK A;  1YUJ A;  2NUG A;  4LF5 E;  2EMK A;  1JK2 A;  4M9V C;  2LVH A;  4X64 E;  4R2A A;  2JP9 A;  4R8O A;  2BBG A;  3BGH A;  2LE2 A;  2LRS A; 
#chains in the Genus database with same CATH homology
 2YTP A;  2EM3 A;  2EMA A;  1X3C A;  2EPA A;  5KL7 A;  2ENA A;  1A1F A;  2E72 A;  2GHF A;  4F6M A;  1WJP A;  2YRM A;  2EOZ A;  2YTI A;  2R1F A;  3M99 B;  4F6N A;  1A1L A;  1ZAA C;  4F2J C;  2ADR A;  1UBD C;  2EOY A;  2ENC A;  2GLI A;  4GZN C;  2J7J A;  2RSI A;  2YTJ A;  1G2F C;  1RMD A;  3EPK A;  2EQ1 A;  2EM9 A;  2YTO A;  2EML A;  1MEY C;  1BB8 A;  2YTG A;  4X9J A;  2EOQ A;  2EPZ A;  4R2R A;  2EOF A;  2ELY A;  2DGC A;  2VRD A;  4IS1 C;  1A1H A;  2EN3 A;  2EM7 A;  2EN2 A;  3MHH C;  4FK5 C;  5KL5 A;  1Z1B A;  2EQ3 A;  2CTD A;  4R2P A;  2PRT A;  2EN1 A;  2YRH A;  1B69 A;  4R2Q A;  3UK3 C;  2EJ4 A;  1ZU1 A;  4IJD A;  2EPU A;  1A1K A;  3EPJ A;  2D9H A;  2EOM A;  2YRK A;  2BB8 A;  2YTN A;  2A25 A;  2EM2 A;  1BBO A;  2EN7 A;  2ENH A;  2EN6 A;  2EPP A;  1UN6 B;  2CT1 A;  2EPC A;  1X5W A;  1JK1 A;  2EL6 A;  1NCS A;  2YSO A;  2MKD A;  1YSA C;  2YU8 A;  2EM8 A;  1X6H A;  2EOS A;  1KJK A;  1A1I A;  1ZR9 A;  2EOE A;  1A1J A;  2EOX A;  2ELZ A;  2EMB A;  2EMY A;  2EOO A;  1X6F A;  2LCE A;  4R2S A;  2EOJ A;  2EMZ A;  2MKN A;  2EL4 A;  2EMG A;  3MHS C;  2YTD A;  2WBS A;  1F2I G;  1DGC A;  2EOH A;  2EMH A;  5KL4 A;  2EM4 A;  4R2D A;  2LV2 A;  2MDG A;  2WBT A;  2YTE A;  2YTF A;  4R2E A;  2JPA A;  5KL3 A;  2EN4 A;  1YUI A;  2EQ0 A;  5KL2 A;  2YU5 A;  4R2C A;  1P47 A;  2LT7 A;  2EMX A;  2M9A A;  4WSG A;  2RPC A;  3EPL A;  2EMW A;  2DRP A;  2NAB A;  2WCC 3;  2CSH A;  2LO3 A;  2WBU A;  1G2D C;  2EMF A;  1LLM C;  1TF6 A;  2EOI A;  2EOR A;  2I13 A;  2EN8 A;  2EP3 A;  3VHT B;  2YTQ A;  2EMC A;  2DLK A;  1YUJ A;  3EPH A;  2EPR A;  2EMK A;  2EM6 A;  1TF3 A;  1JK2 A;  2EE8 A;  2EL5 A;  4M9V C;  2LVH A;  4R2A A;  2HGH A;  1AAY A;  5KL6 A;  2YSP A;  2JP9 A;  1X6E A;  2DMI A;  2DLQ A;  2EM0 A;  2EPX A;  2EMI A;  1TN9 A;  2EM5 A;  1A1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...