2ELZA

Solution structure of the 17th zf-c2h2 domain from human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSVEKPYKCEDCGKGYNRRLNLDMHQRVHMGEKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 17th zf-C2H2 domain from human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2elzA01
2A25A 2EPCA 2EN4A 2NABA 2EORA 1KJKA 2D9HA 2YTEA 1A1JA 1AAYA 4R2AA 2YSPA 2WBTA 1TF3A 2EQ0A 2EM5A 2EL6A 2VRDA 2EPPA 2EMWA 4M9VC 3EPLA 1G2FC 2LCEA 2PRTA 2YSOA 1G2DC 2EPXA 2EL5A 2EPZA 2J7JA 1A1LA 4F6NA 1MEYC 2CSHA 2RPCA 3VHTB 1RMDA 5KL5A 2EMAA 2GHFA 1JK2A 2DGCA 1X5WA 5KL6A 2BB8A 2EN2A 2EE8A 2EM7A 1A1FA 2ENCA 1X6EA 3MHSC 4IJDA 2EOSA 4R2CA 2I13A 2EP3A 1JK1A 2YRHA 2EMCA 2LO3A 1X3CA 1TN9A 1A1HA 4R2PA 1DGCA 2YTQA 2EN3A 2DMIA 2EL4A 5KL3A 2JPAA 3EPHA 4R2QA 2EMKA 2EN7A 2M9AA 2DRPA 2YTJA 1LLMC 2EMIA 2ENAA 2CT1A 2JP9A 2YRMA 2EQ3A 5KL4A 2EM0A 4FK5C 4F2JC 2LVHA 1X6HA 2RSIA 1TF6A 2YTNA 2EM4A 3EPKA 4IS1C 1WJPA 2EOYA 2EMLA 2EM6A 5KL7A 2EPAA 4R2EA 2CTDA 1ZR9A 4R2SA 2E72A 2R1FA 3UK3C 2EQ1A 1UBDC 4F6MA 2EMFA 2LV2A 2EOIA 2DLKA 1B69A 2HGHA 1F2IG 2ELYA 2EOXA 3MHHC 2LT7A 1A1GA 1ZAAC 2EOZA 2EMHA 2EOMA 2YTFA 5KL2A 2EJ4A 2YTOA 1Z1BA 2YRKA 1NCSA 2YTIA 2YTDA 2MKNA 2EM3A 2WBUA 3M99B 2ELZA 1X6FA 2EPUA 2EOHA 2GLIA 1ZU1A 2EN8A 2EMYA 2YU8A 1YSAC 2DLQA 1YUJA 2MKDA 2YTGA 2EOEA 2YTPA 1A1IA 2EM8A 2WCC3 2EOQA 2ADRA 2EN6A 2EMZA 4WSGA 2EM2A 4GZNC 2ENHA 1BBOA 2YU5A 2MDGA 2WBSA 2EOFA 4X9JA 3EPJA 1UN6B 1BB8A 2EMBA 2EOJA 2EPRA 4R2DA 4R2RA 2EM9A 2EOOA 2EMXA 2EN1A 1P47A 2EMGA 1A1KA 1YUIA
chains in the Genus database with same CATH superfamily
2VQFE 2A25A 2EN4A 3OTOE 5TSEA 5LMNE 4JI1E 2JOXA 5AE2A 1AAYA 1J5EE 4R2AA 2NA2A 2YSPA 1SFEA 2WBTA 2B3TB 2MC5A 2V86A 4GEQB 2EQ0A 2JR1A 5F3WA 2E5LE 2M7QA 2EPPA 2V89A 2EMWA 4M9VC 4NXME 4DV1E 2LCEA 5A69A 2EPXA 2J7JA 4DR2E 3LMLA 3HPSA 2DSYA 2EMAA 1QNTA 5KL6A 4BS9A 2EN2A 4WFTA 3TQMA 1PJQA 3HTXA 3BIDA 4DR6E 4IJDA 1O0WA 2EOSA 2GPIA 2YRHA 2EMCA 2LO3A 1RQ0A 1YYWA 2FTXB 4WX9A 3ADIA 1PJTA 1ZBTA 2RQLA 4JI5E 2MC6A 2DMIA 2EZ6A 2JPAA 3C6KA 1T38A 2EMKA 2UXCE 4OOGC 2EN7A 2M9AA 2DRPA 2YTJA 2ENAA 2HC5A 2CT1A 4BHCA 2YRMA 4JI3E 2M4IA 2JY9A 4X66E 1X6HA 1TF6A 2NUEA 2YTNA 2EM4A 2EMLA 2LTRA 2VF1A 2EPAA 2MDRA 4R2EA 1NEIA 3JU0A 4AQYE 1ZR9A 2UU9E 5ADZA 3ZOQB 4KZSA 2EQ1A 4JI0E 4F6MA 2LV2A 1DI2A 4K0KE 2FV4B 1T39A 4LF4E 3THOB 3MHHC 4YY3E 2LT7A 4LFCE 1IMUA 4NHRA 2FGGA 2B9DA 1N32E 1Z1BA 2KOUA 2YRKA 3DF6A 3THNA 3HPZA 4DR7E 4DV0E 4R03A 5T6JA 4MLVA 4X65E 2JWOA 2GLIA 3L00A 2EN8A 2YU8A 3QG5C 2DLQA 2UUAE 2HHHE 1A1IA 2EOQA 2ADRA 4M30A 4JI8E 4JI2E 2EMZA 2JVAA 4MLQA 4GZNC 1X48A 2MDGA 4JYAE 2WBSA 1I94E 1N34E 5LL6R 1YZ9A 1UN6B 3EPJA 2Q8UA 4TUIA 2EOOA 2EMXA 1GQEA 1HNWE 1P47A 1TF3A 3H09A 4DV2E 2HJJA 2LUQA 4B3SE 1FKAE 4M0VA 5AE3A 4LFBE 1KJKA 2LUPB 2VQEE 4DV6E 2EM5A 2VRDA 3JAMC 2YPNA 4DUZE 1G2FC 1MEYC 2YSOA 4LF7E 2EL5A 2EPZA 2UUBE 4KWYA 2RPCA 2L2KB 5IT9C 2N3GA 5KL5A 4JI4E 4WPYA 1JK2A 1GZ6A 1IBLE 1EH6A 4GKKE 1X5WA 2BB8A 4I8OA 4BHBA 2EM7A 3BGHA 3K6QA 1A1FA 4HTGA 4GKJE 2K4VA 4X8WA 1EKZA 1DQ3A 5IWAE 4NZVA 2EP3A 1JK1A 4F9CB 2ZM6E 4X62E 1A1HA 3C4TA 2YTQA 2EL4A 3J7Yp 3RMPA 5AASA 3HQ1A 5IV8B 1XNQE 2V8QB 1LLMC 5IXMB 3LLHA 1N36E 2JP9A 4F9BB 2V83A 2UUCE 4WXCA 3EPKA 4IS1C 1ZBQA 2L3JA 5KL7A 3ADLA 4F9AB 2L3CA 2CTDA 2F8BA 2E72A 1QU6A 3C4BA 5BR8E 2EMFA 4O5GA 1B69A 2HGHA 1F2IG 4RH8A 5A6JA 2EOXA 1IBKE 1A1GA 3J7AG 5A2QC 2EOMA 1HNXE 2H36X 2V88A 4P7DA 5A6BD 2YTIA 3VYXA 2WBUA 3M99B 1X6FA 4Q28A 2M1SA 1T4OA 1UHZA 4ZYGA 2YTGA 2EOEA 1STUA 4LTYA 4BCAA 3OMLA 2EN6A 2L33A 4WSGA 1GTKA 2ENHA 1BBOA 4X9JA 4DV5E 4DV3E 3IWDA 4DKKA 3FIGA 2EMGA 1A1KA 2N3HA 3IWBA 2EPCA 2NABA 2R76A 2EORA 1A1JA 4DV4E 3IWCA 2EPOA 3J81C 1L4SA 4ZYDA 2WZOA 2EL6A 2KONA 2CPNA 2VE7C 4DUYE 4LF9E 4DMIA 4M2ZA 4YHHE 2PRTA 5A6KA 1A1LA 3KZZA 2LMZA 3AV0A 4WSPA 3VHTB 1EH7A 4B3RE 1MGTA 2RTXA 4NXNE 2GHFA 2JOBA 3VK6A 2DGCA 4F54A 2DMYA 1T4LB 4BC7A 2LE2A 1X6EA 3BF2A 3MHSC 4HEIA 4RHBB 4TUGA 1N3GA 2K7IA 2KHXA 1TN9A 2EPMX 1YFHA 4DR1E 2JXPA 2L8TA 4N4RB 1PJSA 2DIXA 3ECRA 2LRSA 3EPHA 1AH5A 2YWQA 2V87A 3ADGA 2YT4A 2EQ3A 2EM0A 1YPNA 4FK5C 5DNYA 4KHPE 1IQSA 2EM6A 3AUZA 4ZYHA 4DR3E 2R1FA 4LF6E 2NUGA 1WRJA 1UBDC 2DLKA 1RC7A 1EH8A 1WHNA 2ELYA 5AC4A 4O4KA 2LJUA 2LJHA 2RS6A 4LFAE 2EOZA 2ODRD 5KL2A 1IBME 2YTOA 4DV7E 4JV5E 1NCSA 3F6GA 2EWLA 2EM3A 2EPUA 2EOHA 5CFFE 1YSAC 2EMYA 4Q35B 1T4NA 1X47A 1YUJA 2MKDA 2YTPA 2LBSB 2WCC3 2UXBE 2B7VA 1KYQA 3KWRA 1N33E 2YU5A 5A6AA 4X64E 2EOFA 3T1YE 4BC9A 1BB8A 2EMBA 5A6BA 4R2RA 1WHQA 2EM9A 4WYQB 3F6HA 5LLQA 3EQ1A 4R8OA 3T1HE 4LF5E 2D9HA 2YTEA 3C6MA 2EPNA 2NUFA 2UXDE 3J80C 2N8XA 3EPLA 1J26A 2LTSA 4P78A 4LU9A 1G2DC 3P1XA 4JI6E 4F6NA 2CSHA 1RMDA 1HR0E 4O24A 2EE8A 1HNZE 2ENCA 4JI7E 5LMUE 2V85A 4R2CA 2I13A 4O43A 1X3CA 1YYOA 2B7TA 1PDAA 4R2PA 1DGCA 2EPKX 2EN3A 5KL3A 3KZYA 4R2QA 2F4VE 2L92A 2EMIA 1XMOE 3BBGA 5KL4A 5FLXC 4F2JC 2LVHA 4B3TE 1YYKA 4WXDA 2RSIA 4L5NC 1WJPA 2DB2A 2YZTA 2EOYA 1IQOA 3VYYA 4BMJA 4R2SA 4B3ME 1WXRA 3UK3C 2EOIA 3JTZA 4J8ZA 4ZYEA 2G7HA 4BBYA 3MSWA 1BBGA 4L8NA 2L2NA 1ZAAC 2EMHA 2YTFA 2BBGA 2EJ4A 4LF8E 1X49A 4DR5E 1PKPA 2YTDA 2MKNA 2ELZA 3DJWA 1ZU1A 2I9IA 2EM8A 2RS7A 2IHR1 1XMQE 1XNRE 5AC5A 2EM2A 3HXLA 2E1MA 1SR9A 2JYAA 2ODRC 1FJGE 2RSMA 1UILA 2EOJA 2EPRA 5AE1A 2L2MA 4R2DA 4OX9E 4DR4E 3ADJA 2EN1A 2EPLX 2L6MA 1YUIA
chains in the Genus database with same CATH topology
2A25A 2EPCA 2EN4A 2NABA 2EORA 1KJKA 2D9HA 2YTEA 1A1JA 1AAYA 4R2AA 2YSPA 2WBTA 1TF3A 2EQ0A 2EM5A 2EL6A 2VRDA 2EPPA 2EMWA 4M9VC 3EPLA 1G2FC 2LCEA 2PRTA 2YSOA 1G2DC 2EPXA 2EL5A 2EPZA 2J7JA 1A1LA 4F6NA 1MEYC 2CSHA 2RPCA 3VHTB 1RMDA 5KL5A 2EMAA 2GHFA 1JK2A 2DGCA 1X5WA 5KL6A 2BB8A 2EN2A 2EE8A 2EM7A 1A1FA 2ENCA 1X6EA 3MHSC 4IJDA 2EOSA 4R2CA 2I13A 2EP3A 1JK1A 2YRHA 2EMCA 2LO3A 1X3CA 1TN9A 1A1HA 4R2PA 1DGCA 2YTQA 2EN3A 2DMIA 2EL4A 5KL3A 2JPAA 3EPHA 4R2QA 2EMKA 2EN7A 2M9AA 2DRPA 2YTJA 1LLMC 2EMIA 2ENAA 2CT1A 2JP9A 2YRMA 2EQ3A 5KL4A 2EM0A 4FK5C 4F2JC 2LVHA 1X6HA 2RSIA 1TF6A 2YTNA 2EM4A 3EPKA 4IS1C 1WJPA 2EOYA 2EMLA 2EM6A 5KL7A 2EPAA 4R2EA 2CTDA 1ZR9A 4R2SA 2E72A 2R1FA 3UK3C 2EQ1A 1UBDC 4F6MA 2EMFA 2LV2A 2EOIA 2DLKA 1B69A 2HGHA 1F2IG 2ELYA 2EOXA 3MHHC 2LT7A 1A1GA 1ZAAC 2EOZA 2EMHA 2EOMA 2YTFA 5KL2A 2EJ4A 2YTOA 1Z1BA 2YRKA 1NCSA 2YTIA 2YTDA 2MKNA 2EM3A 2WBUA 3M99B 2ELZA 1X6FA 2EPUA 2EOHA 2GLIA 1ZU1A 2EN8A 2EMYA 2YU8A 1YSAC 2DLQA 1YUJA 2MKDA 2YTGA 2EOEA 2YTPA 1A1IA 2EM8A 2WCC3 2EOQA 2ADRA 2EN6A 2EMZA 4WSGA 2EM2A 4GZNC 2ENHA 1BBOA 2YU5A 2MDGA 2WBSA 2EOFA 4X9JA 3EPJA 1UN6B 1BB8A 2EMBA 2EOJA 2EPRA 4R2DA 4R2RA 2EM9A 2EOOA 2EMXA 2EN1A 1P47A 2EMGA 1A1KA 1YUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A25 A;  2EPC A;  2EN4 A;  2NAB A;  2EOR A;  1KJK A;  2D9H A;  2YTE A;  1A1J A;  1AAY A;  4R2A A;  2YSP A;  2WBT A;  1TF3 A;  2EQ0 A;  2EM5 A;  2EL6 A;  2VRD A;  2EPP A;  2EMW A;  4M9V C;  3EPL A;  1G2F C;  2LCE A;  2PRT A;  2YSO A;  1G2D C;  2EPX A;  2EL5 A;  2EPZ A;  2J7J A;  1A1L A;  4F6N A;  1MEY C;  2CSH A;  2RPC A;  3VHT B;  1RMD A;  5KL5 A;  2EMA A;  2GHF A;  1JK2 A;  2DGC A;  1X5W A;  5KL6 A;  2BB8 A;  2EN2 A;  2EE8 A;  2EM7 A;  1A1F A;  2ENC A;  1X6E A;  3MHS C;  4IJD A;  2EOS A;  4R2C A;  2I13 A;  2EP3 A;  1JK1 A;  2YRH A;  2EMC A;  2LO3 A;  1X3C A;  1TN9 A;  1A1H A;  4R2P A;  1DGC A;  2YTQ A;  2EN3 A;  2DMI A;  2EL4 A;  5KL3 A;  2JPA A;  3EPH A;  4R2Q A;  2EMK A;  2EN7 A;  2M9A A;  2DRP A;  2YTJ A;  1LLM C;  2EMI A;  2ENA A;  2CT1 A;  2JP9 A;  2YRM A;  2EQ3 A;  5KL4 A;  2EM0 A;  4FK5 C;  4F2J C;  2LVH A;  1X6H A;  2RSI A;  1TF6 A;  2YTN A;  2EM4 A;  3EPK A;  4IS1 C;  1WJP A;  2EOY A;  2EML A;  2EM6 A;  5KL7 A;  2EPA A;  4R2E A;  2CTD A;  1ZR9 A;  4R2S A;  2E72 A;  2R1F A;  3UK3 C;  2EQ1 A;  1UBD C;  4F6M A;  2EMF A;  2LV2 A;  2EOI A;  2DLK A;  1B69 A;  2HGH A;  1F2I G;  2ELY A;  2EOX A;  3MHH C;  2LT7 A;  1A1G A;  1ZAA C;  2EOZ A;  2EMH A;  2EOM A;  2YTF A;  5KL2 A;  2EJ4 A;  2YTO A;  1Z1B A;  2YRK A;  1NCS A;  2YTI A;  2YTD A;  2MKN A;  2EM3 A;  2WBU A;  3M99 B;  2ELZ A;  1X6F A;  2EPU A;  2EOH A;  2GLI A;  1ZU1 A;  2EN8 A;  2EMY A;  2YU8 A;  1YSA C;  2DLQ A;  1YUJ A;  2MKD A;  2YTG A;  2EOE A;  2YTP A;  1A1I A;  2EM8 A;  2WCC 3;  2EOQ A;  2ADR A;  2EN6 A;  2EMZ A;  4WSG A;  2EM2 A;  4GZN C;  2ENH A;  1BBO A;  2YU5 A;  2MDG A;  2WBS A;  2EOF A;  4X9J A;  3EPJ A;  1UN6 B;  1BB8 A;  2EMB A;  2EOJ A;  2EPR A;  4R2D A;  4R2R A;  2EM9 A;  2EOO A;  2EMX A;  2EN1 A;  1P47 A;  2EMG A;  1A1K A;  1YUI A; 
#chains in the Genus database with same CATH topology
 2VQF E;  2A25 A;  2EN4 A;  3OTO E;  5TSE A;  5LMN E;  4JI1 E;  2JOX A;  5AE2 A;  1AAY A;  1J5E E;  4R2A A;  2NA2 A;  2YSP A;  1SFE A;  2WBT A;  2B3T B;  2MC5 A;  2V86 A;  4GEQ B;  2EQ0 A;  2JR1 A;  5F3W A;  2E5L E;  2M7Q A;  2EPP A;  2V89 A;  2EMW A;  4M9V C;  4NXM E;  4DV1 E;  2LCE A;  5A69 A;  2EPX A;  2J7J A;  4DR2 E;  3LML A;  3HPS A;  2DSY A;  2EMA A;  1QNT A;  5KL6 A;  4BS9 A;  2EN2 A;  4WFT A;  3TQM A;  1PJQ A;  3HTX A;  3BID A;  4DR6 E;  4IJD A;  1O0W A;  2EOS A;  2GPI A;  2YRH A;  2EMC A;  2LO3 A;  1RQ0 A;  1YYW A;  2FTX B;  4WX9 A;  3ADI A;  1PJT A;  1ZBT A;  2RQL A;  4JI5 E;  2MC6 A;  2DMI A;  2EZ6 A;  2JPA A;  3C6K A;  1T38 A;  2EMK A;  2UXC E;  4OOG C;  2EN7 A;  2M9A A;  2DRP A;  2YTJ A;  2ENA A;  2HC5 A;  2CT1 A;  4BHC A;  2YRM A;  4JI3 E;  2M4I A;  2JY9 A;  4X66 E;  1X6H A;  1TF6 A;  2NUE A;  2YTN A;  2EM4 A;  2EML A;  2LTR A;  2VF1 A;  2EPA A;  2MDR A;  4R2E A;  1NEI A;  3JU0 A;  4AQY E;  1ZR9 A;  2UU9 E;  5ADZ A;  3ZOQ B;  4KZS A;  2EQ1 A;  4JI0 E;  4F6M A;  2LV2 A;  1DI2 A;  4K0K E;  2FV4 B;  1T39 A;  4LF4 E;  3THO B;  3MHH C;  4YY3 E;  2LT7 A;  4LFC E;  1IMU A;  4NHR A;  2FGG A;  2B9D A;  1N32 E;  1Z1B A;  2KOU A;  2YRK A;  3DF6 A;  3THN A;  3HPZ A;  4DR7 E;  4DV0 E;  4R03 A;  5T6J A;  4MLV A;  4X65 E;  2JWO A;  2GLI A;  3L00 A;  2EN8 A;  2YU8 A;  3QG5 C;  2DLQ A;  2UUA E;  2HHH E;  1A1I A;  2EOQ A;  2ADR A;  4M30 A;  4JI8 E;  4JI2 E;  2EMZ A;  2JVA A;  4MLQ A;  4GZN C;  1X48 A;  2MDG A;  4JYA E;  2WBS A;  1I94 E;  1N34 E;  5LL6 R;  1YZ9 A;  1UN6 B;  3EPJ A;  2Q8U A;  4TUI A;  2EOO A;  2EMX A;  1GQE A;  1HNW E;  1P47 A;  1TF3 A;  3H09 A;  4DV2 E;  2HJJ A;  2LUQ A;  4B3S E;  1FKA E;  4M0V A;  5AE3 A;  4LFB E;  1KJK A;  2LUP B;  2VQE E;  4DV6 E;  2EM5 A;  2VRD A;  3JAM C;  2YPN A;  4DUZ E;  1G2F C;  1MEY C;  2YSO A;  4LF7 E;  2EL5 A;  2EPZ A;  2UUB E;  4KWY A;  2RPC A;  2L2K B;  5IT9 C;  2N3G A;  5KL5 A;  4JI4 E;  4WPY A;  1JK2 A;  1GZ6 A;  1IBL E;  1EH6 A;  4GKK E;  1X5W A;  2BB8 A;  4I8O A;  4BHB A;  2EM7 A;  3BGH A;  3K6Q A;  1A1F A;  4HTG A;  4GKJ E;  2K4V A;  4X8W A;  1EKZ A;  1DQ3 A;  5IWA E;  4NZV A;  2EP3 A;  1JK1 A;  4F9C B;  2ZM6 E;  4X62 E;  1A1H A;  3C4T A;  2YTQ A;  2EL4 A;  3J7Y p;  3RMP A;  5AAS A;  3HQ1 A;  5IV8 B;  1XNQ E;  2V8Q B;  1LLM C;  5IXM B;  3LLH A;  1N36 E;  2JP9 A;  4F9B B;  2V83 A;  2UUC E;  4WXC A;  3EPK A;  4IS1 C;  1ZBQ A;  2L3J A;  5KL7 A;  3ADL A;  4F9A B;  2L3C A;  2CTD A;  2F8B A;  2E72 A;  1QU6 A;  3C4B A;  5BR8 E;  2EMF A;  4O5G A;  1B69 A;  2HGH A;  1F2I G;  4RH8 A;  5A6J A;  2EOX A;  1IBK E;  1A1G A;  3J7A G;  5A2Q C;  2EOM A;  1HNX E;  2H36 X;  2V88 A;  4P7D A;  5A6B D;  2YTI A;  3VYX A;  2WBU A;  3M99 B;  1X6F A;  4Q28 A;  2M1S A;  1T4O A;  1UHZ A;  4ZYG A;  2YTG A;  2EOE A;  1STU A;  4LTY A;  4BCA A;  3OML A;  2EN6 A;  2L33 A;  4WSG A;  1GTK A;  2ENH A;  1BBO A;  4X9J A;  4DV5 E;  4DV3 E;  3IWD A;  4DKK A;  3FIG A;  2EMG A;  1A1K A;  2N3H A;  3IWB A;  2EPC A;  2NAB A;  2R76 A;  2EOR A;  1A1J A;  4DV4 E;  3IWC A;  2EPO A;  3J81 C;  1L4S A;  4ZYD A;  2WZO A;  2EL6 A;  2KON A;  2CPN A;  2VE7 C;  4DUY E;  4LF9 E;  4DMI A;  4M2Z A;  4YHH E;  2PRT A;  5A6K A;  1A1L A;  3KZZ A;  2LMZ A;  3AV0 A;  4WSP A;  3VHT B;  1EH7 A;  4B3R E;  1MGT A;  2RTX A;  4NXN E;  2GHF A;  2JOB A;  3VK6 A;  2DGC A;  4F54 A;  2DMY A;  1T4L B;  4BC7 A;  2LE2 A;  1X6E A;  3BF2 A;  3MHS C;  4HEI A;  4RHB B;  4TUG A;  1N3G A;  2K7I A;  2KHX A;  1TN9 A;  2EPM X;  1YFH A;  4DR1 E;  2JXP A;  2L8T A;  4N4R B;  1PJS A;  2DIX A;  3ECR A;  2LRS A;  3EPH A;  1AH5 A;  2YWQ A;  2V87 A;  3ADG A;  2YT4 A;  2EQ3 A;  2EM0 A;  1YPN A;  4FK5 C;  5DNY A;  4KHP E;  1IQS A;  2EM6 A;  3AUZ A;  4ZYH A;  4DR3 E;  2R1F A;  4LF6 E;  2NUG A;  1WRJ A;  1UBD C;  2DLK A;  1RC7 A;  1EH8 A;  1WHN A;  2ELY A;  5AC4 A;  4O4K A;  2LJU A;  2LJH A;  2RS6 A;  4LFA E;  2EOZ A;  2ODR D;  5KL2 A;  1IBM E;  2YTO A;  4DV7 E;  4JV5 E;  1NCS A;  3F6G A;  2EWL A;  2EM3 A;  2EPU A;  2EOH A;  5CFF E;  1YSA C;  2EMY A;  4Q35 B;  1T4N A;  1X47 A;  1YUJ A;  2MKD A;  2YTP A;  2LBS B;  2WCC 3;  2UXB E;  2B7V A;  1KYQ A;  3KWR A;  1N33 E;  2YU5 A;  5A6A A;  4X64 E;  2EOF A;  3T1Y E;  4BC9 A;  1BB8 A;  2EMB A;  5A6B A;  4R2R A;  1WHQ A;  2EM9 A;  4WYQ B;  3F6H A;  5LLQ A;  3EQ1 A;  4R8O A;  3T1H E;  4LF5 E;  2D9H A;  2YTE A;  3C6M A;  2EPN A;  2NUF A;  2UXD E;  3J80 C;  2N8X A;  3EPL A;  1J26 A;  2LTS A;  4P78 A;  4LU9 A;  1G2D C;  3P1X A;  4JI6 E;  4F6N A;  2CSH A;  1RMD A;  1HR0 E;  4O24 A;  2EE8 A;  1HNZ E;  2ENC A;  4JI7 E;  5LMU E;  2V85 A;  4R2C A;  2I13 A;  4O43 A;  1X3C A;  1YYO A;  2B7T A;  1PDA A;  4R2P A;  1DGC A;  2EPK X;  2EN3 A;  5KL3 A;  3KZY A;  4R2Q A;  2F4V E;  2L92 A;  2EMI A;  1XMO E;  3BBG A;  5KL4 A;  5FLX C;  4F2J C;  2LVH A;  4B3T E;  1YYK A;  4WXD A;  2RSI A;  4L5N C;  1WJP A;  2DB2 A;  2YZT A;  2EOY A;  1IQO A;  3VYY A;  4BMJ A;  4R2S A;  4B3M E;  1WXR A;  3UK3 C;  2EOI A;  3JTZ A;  4J8Z A;  4ZYE A;  2G7H A;  4BBY A;  3MSW A;  1BBG A;  4L8N A;  2L2N A;  1ZAA C;  2EMH A;  2YTF A;  2BBG A;  2EJ4 A;  4LF8 E;  1X49 A;  4DR5 E;  1PKP A;  2YTD A;  2MKN A;  2ELZ A;  3DJW A;  1ZU1 A;  2I9I A;  2EM8 A;  2RS7 A;  2IHR 1;  1XMQ E;  1XNR E;  5AC5 A;  2EM2 A;  3HXL A;  2E1M A;  1SR9 A;  2JYA A;  2ODR C;  1FJG E;  2RSM A;  1UIL A;  2EOJ A;  2EPR A;  5AE1 A;  2L2M A;  4R2D A;  4OX9 E;  4DR4 E;  3ADJ A;  2EN1 A;  2EPL X;  2L6M A;  1YUI A; 
#chains in the Genus database with same CATH homology
 2A25 A;  2EPC A;  2EN4 A;  2NAB A;  2EOR A;  1KJK A;  2D9H A;  2YTE A;  1A1J A;  1AAY A;  4R2A A;  2YSP A;  2WBT A;  1TF3 A;  2EQ0 A;  2EM5 A;  2EL6 A;  2VRD A;  2EPP A;  2EMW A;  4M9V C;  3EPL A;  1G2F C;  2LCE A;  2PRT A;  2YSO A;  1G2D C;  2EPX A;  2EL5 A;  2EPZ A;  2J7J A;  1A1L A;  4F6N A;  1MEY C;  2CSH A;  2RPC A;  3VHT B;  1RMD A;  5KL5 A;  2EMA A;  2GHF A;  1JK2 A;  2DGC A;  1X5W A;  5KL6 A;  2BB8 A;  2EN2 A;  2EE8 A;  2EM7 A;  1A1F A;  2ENC A;  1X6E A;  3MHS C;  4IJD A;  2EOS A;  4R2C A;  2I13 A;  2EP3 A;  1JK1 A;  2YRH A;  2EMC A;  2LO3 A;  1X3C A;  1TN9 A;  1A1H A;  4R2P A;  1DGC A;  2YTQ A;  2EN3 A;  2DMI A;  2EL4 A;  5KL3 A;  2JPA A;  3EPH A;  4R2Q A;  2EMK A;  2EN7 A;  2M9A A;  2DRP A;  2YTJ A;  1LLM C;  2EMI A;  2ENA A;  2CT1 A;  2JP9 A;  2YRM A;  2EQ3 A;  5KL4 A;  2EM0 A;  4FK5 C;  4F2J C;  2LVH A;  1X6H A;  2RSI A;  1TF6 A;  2YTN A;  2EM4 A;  3EPK A;  4IS1 C;  1WJP A;  2EOY A;  2EML A;  2EM6 A;  5KL7 A;  2EPA A;  4R2E A;  2CTD A;  1ZR9 A;  4R2S A;  2E72 A;  2R1F A;  3UK3 C;  2EQ1 A;  1UBD C;  4F6M A;  2EMF A;  2LV2 A;  2EOI A;  2DLK A;  1B69 A;  2HGH A;  1F2I G;  2ELY A;  2EOX A;  3MHH C;  2LT7 A;  1A1G A;  1ZAA C;  2EOZ A;  2EMH A;  2EOM A;  2YTF A;  5KL2 A;  2EJ4 A;  2YTO A;  1Z1B A;  2YRK A;  1NCS A;  2YTI A;  2YTD A;  2MKN A;  2EM3 A;  2WBU A;  3M99 B;  2ELZ A;  1X6F A;  2EPU A;  2EOH A;  2GLI A;  1ZU1 A;  2EN8 A;  2EMY A;  2YU8 A;  1YSA C;  2DLQ A;  1YUJ A;  2MKD A;  2YTG A;  2EOE A;  2YTP A;  1A1I A;  2EM8 A;  2WCC 3;  2EOQ A;  2ADR A;  2EN6 A;  2EMZ A;  4WSG A;  2EM2 A;  4GZN C;  2ENH A;  1BBO A;  2YU5 A;  2MDG A;  2WBS A;  2EOF A;  4X9J A;  3EPJ A;  1UN6 B;  1BB8 A;  2EMB A;  2EOJ A;  2EPR A;  4R2D A;  4R2R A;  2EM9 A;  2EOO A;  2EMX A;  2EN1 A;  1P47 A;  2EMG A;  1A1K A;  1YUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...