2ELZA

Solution structure of the 17th zf-c2h2 domain from human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSVEKPYKCEDCGKGYNRRLNLDMHQRVHMGEKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the 17th zf-C2H2 domain from human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2elzA01
2EMXA 2EQ0A 1ZU1A 2EL6A 2EE8A 2ELYA 2EL4A 2EOZA 3UK3C 2GHFA 2YRMA 2YTOA 1F2IG 4F6NA 1P47A 1AAYA 5KL2A 2M9AA 2EP3A 2EN6A 2MKDA 2CTDA 2EM0A 2EORA 2EN2A 2DLKA 2EOEA 2RPCA 2EOXA 2EN8A 5KL3A 2YTIA 2A25A 5KL4A 4R2PA 4M9VC 1YUIA 2YTNA 1A1LA 2EOMA 2DLQA 1ZR9A 2EMBA 2RSIA 5KL7A 2ENCA 2EM9A 1X6FA 2LVHA 2EM7A 2YSPA 1A1JA 1G2DC 2WBTA 4WSGA 5KL5A 2YTJA 2YU5A 2EMCA 2EMZA 2YRHA 1A1KA 1YSAC 2NABA 2YTPA 2EOQA 2YTDA 2JP9A 2EMYA 1NCSA 2E72A 2EM3A 2GLIA 2I13A 1LLMC 1KJKA 1TF3A 2ENHA 4IS1C 2YU8A 2EMIA 2EM8A 2LT7A 1JK1A 3MHSC 1BB8A 2EOOA 2EOSA 2PRTA 2ELZA 1Z1BA 2DMIA 2EPAA 4X9JA 1RMDA 2JPAA 3EPKA 2VRDA 4IJDA 2EMHA 2EM5A 2EQ1A 5KL6A 1A1HA 2EN1A 2EPPA 2EM4A 1A1IA 2WCC3 2YSOA 2EMAA 2LO3A 2DGCA 1G2FC 4GZNC 1A1GA 2EPXA 3MHHC 1MEYC 1X3CA 1X5WA 2EM6A 2EMFA 4R2EA 1B69A 2YTGA 2BB8A 2EM2A 2EQ3A 3VHTB 2YTQA 2EOHA 4R2RA 2ENAA 1X6HA 1X6EA 2EMLA 2EMKA 2EJ4A 2EMGA 1ZAAC 2MDGA 2EOYA 4R2AA 2EN4A 2LV2A 1A1FA 4R2DA 2EOIA 2CSHA 2EOFA 1TF6A 2J7JA 2EN3A 2WBSA 2WBUA 2MKNA 2YTFA 1YUJA 3EPHA 2YRKA 4R2SA 2HGHA 4FK5C 2DRPA 1UN6B 2EPZA 2YTEA 2EPUA 4R2CA 3EPJA 2EMWA 4F2JC 4F6MA 1TN9A 3M99B 1WJPA 2R1FA 1JK2A 1UBDC 2EL5A 2LCEA 2EOJA 4R2QA 1BBOA 2EN7A 2CT1A 3EPLA 2EPCA 2D9HA 2EPRA 1DGCA 2ADRA
chains in the Genus database with same CATH superfamily
2EMXA 2EQ0A 2G7HA 2ELYA 2GHFA 2YRMA 1J5EE 2R76A 4F6NA 4ZYDA 1DQ3A 1XMQE 1SFEA 2MKDA 2L2MA 2CTDA 4O5GA 2DLKA 2KHXA 4BHBA 5KL3A 2A25A 1N3GA 4BCAA 4N4RB 4JI8E 1T38A 4DKKA 1ZR9A 2CPNA 2ENCA 2EM9A 4LFBE 2VE7C 2FTXB 3K6QA 5KL5A 2YTJA 1PJSA 1EKZA 4DR7E 2EMZA 4LTYA 1X47A 2E5LE 2LE2A 2LUPB 2WZOA 3HQ1A 2L3JA 2EM3A 2E72A 2KONA 2EZ6A 4LF4E 3LLHA 2I13A 5AE1A 1KJKA 5LMNE 2ENHA 4IS1C 2EMIA 2EM8A 2LT7A 5A6KA 3MHSC 1UILA 3TQMA 2EOOA 4X9JA 2NUGA 3EPKA 2HJJA 2UXCE 4X62E 2RSMA 1A1HA 2JOBA 2VQFE 4BS9A 3IWBA 2EPPA 2EM4A 2V85A 2V8QB 1G2FC 2YT4A 2V87A 2EPXA 4DMIA 4GKKE 4WX9A 4DV1E 1X5WA 4P7DA 2MC5A 4R2EA 5T6JA 2YTGA 2EM2A 5F3WA 4R2RA 5AASA 2M1SA 2L8TA 1X6EA 2F8BA 2EMKA 2EJ4A 1ZAAC 4P78A 1WHNA 1N32E 1O0WA 2EOYA 3C4BA 2EN4A 2N8XA 2VF1A 3ZOQB 5LMUE 2CSHA 4ZYGA 1TF6A 2J7JA 4B3TE 2WBSA 1X48A 4MLVA 2Q8UA 2WBUA 2MKNA 4M2ZA 4R2SA 3KWRA 2FGGA 5A6AA 1UN6B 3VYYA 1YYOA 2F4VE 2M7QA 5IT9C 4F2JC 4O24A 4R8OA 3BBGA 2N3HA 1HNXE 4JV5E 2NUEA 1ZBQA 1HR0E 4R2QA 2EN7A 3VYXA 3ADGA 4HTGA 4OOGC 3JTZA 2CT1A 4DV2E 2EPRA 2EPKX 1ZU1A 2EE8A 5AE2A 3UK3C 4M30A 5KL2A 4F9AB 2EN6A 2EM0A 1QNTA 1J26A 4F9CB 2NUFA 2EOEA 3KZZA 2YTIA 4LF9E 5KL4A 4R2PA 4DR6E 1YPNA 2LRSA 2EOMA 2B9DA 2V89A 2BBGA 2EMBA 1FJGE 3FIGA 3ADIA 1A1JA 2EM7A 2WBTA 1IBME 4DR3E 4DR4E 4LU9A 3HXLA 2GPIA 1NEIA 2JY9A 4DV3E 2YTPA 2EOQA 1PDAA 2GLIA 2L3CA 1LLMC 4KZSA 2IHR1 2YU8A 4DV4E 2EOSA 2ELZA 2DMIA 2EPAA 4DV6E 4DR2E 2L33A 1RMDA 3HPZA 4IJDA 5KL6A 4TUIA 4JI6E 3ADJA 4MLQA 3MSWA 4F54A 2EWLA 2EMAA 2LO3A 2DGCA 2RS7A 4I8OA 4B3RE 1A1GA 1WXRA 2EM6A 4RHBB 3VHTB 4NXNE 2RQLA 3P1XA 3AUZA 2B3TB 2MDGA 4R2AA 2ZM6E 3C6KA 4NZVA 1WHQA 2UUBE 3JU0A 1A1FA 4JI3E 5IWAE 1STUA 3KZYA 3J7Yp 2FV4B 2HHHE 4F9BB 3EPHA 1IMUA 4WYQB 2HGHA 2M4IA 4DV7E 2EPUA 4R2CA 5A2QC 2VQEE 4DUZE 4NHRA 4Q35B 4F6MA 1TN9A 1WJPA 2LJHA 1EH6A 2EPLX 1UBDC 4WFTA 1RC7A 1IBLE 1PKPA 2EOJA 1GZ6A 3IWDA 2H36X 5IXMB 4DUYE 1DGCA 4M9VC 2DIXA 2EL4A 2EOZA 2YTOA 3QG5C 2YWQA 1P47A 4JI0E 2M9AA 4RH8A 4WXCA 3J81C 3T1HE 1SR9A 2EN2A 2K4VA 5DNYA 2EN8A 4HEIA 2LTRA 4X64E 3JAMC 1YUIA 4LF8E 5LLQA 3L00A 5KL7A 2LVHA 1G2DC 1PJQA 3HTXA 2JXPA 2EMCA 3DF6A 1A1KA 3F6GA 4L8NA 2YTDA 1FKAE 4GKJE 2EMYA 2EPNA 5IV8B 4NXME 4JI7E 2E1MA 3BF2A 5A6JA 4JYAE 1T4NA 2JVAA 1BB8A 1T39A 4M0VA 1Z1BA 5TSEA 2JR1A 2JPAA 2LTSA 4JI2E 2VRDA 1T4LB 1KYQA 2L2NA 2EM5A 5CFFE 2L92A 1N33E 2EN1A 5ADZA 2DB2A 4X8WA 1MGTA 1XMOE 1A1IA 2ODRC 2WCC3 4JI4E 4WXDA 4GZNC 3THOB 4DR5E 1N36E 3BIDA 4OX9E 3BGHA 1YYKA 1B69A 2HC5A 1X49A 2JWOA 2YTQA 1YZ9A 1ZBTA 2ENAA 1X6HA 5A6BD 4BC9A 4B3SE 4X65E 4B3ME 2LV2A 5AE3A 2MDRA 3LMLA 2EOIA 2EOFA 4K0KE 2EN3A 2YZTA 2NA2A 1N34E 4DR1E 1PJTA 1YUJA 1RQ0A 2RS6A 2UU9E 2UUCE 2RTXA 4O4KA 2B7TA 2V83A 3H09A 4FK5C 2DRPA 3RMPA 2EPZA 2YTEA 3DJWA 1I94E 2EMWA 2EPMX 1WRJA 2R1FA 1GQEA 2EL5A 1BBOA 3VK6A 1DI2A 2ADRA 4WPYA 3OTOE 4YY3E 2L2KB 2EL6A 1EH7A 2UXDE 3OMLA 1F2IG 1BBGA 1AAYA 2MC6A 1L4SA 2V86A 3J7AG 2EP3A 4Q28A 2EORA 1IBKE 2RPCA 2EOXA 4TUGA 2KOUA 4LFCE 4DV0E 4BHCA 5FLXC 2YTNA 4YHHE 1A1LA 2DLQA 2LUQA 2RSIA 1X6FA 2YSPA 2YPNA 4WSGA 3ADLA 4R03A 2YU5A 4LF6E 2YRHA 4JI5E 3J80C 1YSAC 2NABA 1HNZE 2JP9A 1NCSA 4BBYA 1T4OA 1UHZA 4WSPA 1TF3A 4AQYE 1JK1A 1IQSA 2PRTA 1XNQE 1XNRE 2EMHA 3THNA 2EQ1A 3IWCA 3C6MA 1GTKA 4ZYHA 5A6BA 3T1YE 1YFHA 2YSOA 4X66E 4GEQB 3C4TA 2EPOA 4LFAE 2V88A 3MHHC 4BMJA 1MEYC 1X3CA 2N3GA 3HPSA 1QU6A 2B7VA 4BC7A 2EMFA 5A69A 2I9IA 4J8ZA 4DV5E 2BB8A 2EQ3A 3F6HA 2EOHA 1EH8A 2EMLA 2EMGA 4LF7E 2DMYA 4L5NC 2LBSB 2JOXA 1YYWA 2UXBE 4KHPE 4LF5E 5LL6R 3ECRA 5AC4A 4R2DA 1HNWE 2UUAE 2YTFA 2YRKA 4KWYA 3EQ1A 2L6MA 1IQOA 3EPJA 2DSYA 2LJUA 3AV0A 4JI1E 3M99B 1JK2A 2ODRD 2LCEA 2JYAA 5BR8E 4ZYEA 5AC5A 2LMZA 2K7IA 4O43A 3EPLA 2EPCA 2D9HA 1AH5A
chains in the Genus database with same CATH topology
2EMXA 2EQ0A 1ZU1A 2EL6A 2EE8A 2ELYA 2EL4A 2EOZA 3UK3C 2GHFA 2YRMA 2YTOA 1F2IG 4F6NA 1P47A 1AAYA 5KL2A 2M9AA 2EP3A 2EN6A 2MKDA 2CTDA 2EM0A 2EORA 2EN2A 2DLKA 2EOEA 2RPCA 2EOXA 2EN8A 5KL3A 2YTIA 2A25A 5KL4A 4R2PA 4M9VC 1YUIA 2YTNA 1A1LA 2EOMA 2DLQA 1ZR9A 2EMBA 2RSIA 5KL7A 2ENCA 2EM9A 1X6FA 2LVHA 2EM7A 2YSPA 1A1JA 1G2DC 2WBTA 4WSGA 5KL5A 2YTJA 2YU5A 2EMCA 2EMZA 2YRHA 1A1KA 1YSAC 2NABA 2YTPA 2EOQA 2YTDA 2JP9A 2EMYA 1NCSA 2E72A 2EM3A 2GLIA 2I13A 1LLMC 1KJKA 1TF3A 2ENHA 4IS1C 2YU8A 2EMIA 2EM8A 2LT7A 1JK1A 3MHSC 1BB8A 2EOOA 2EOSA 2PRTA 2ELZA 1Z1BA 2DMIA 2EPAA 4X9JA 1RMDA 2JPAA 3EPKA 2VRDA 4IJDA 2EMHA 2EM5A 2EQ1A 5KL6A 1A1HA 2EN1A 2EPPA 2EM4A 1A1IA 2WCC3 2YSOA 2EMAA 2LO3A 2DGCA 1G2FC 4GZNC 1A1GA 2EPXA 3MHHC 1MEYC 1X3CA 1X5WA 2EM6A 2EMFA 4R2EA 1B69A 2YTGA 2BB8A 2EM2A 2EQ3A 3VHTB 2YTQA 2EOHA 4R2RA 2ENAA 1X6HA 1X6EA 2EMLA 2EMKA 2EJ4A 2EMGA 1ZAAC 2MDGA 2EOYA 4R2AA 2EN4A 2LV2A 1A1FA 4R2DA 2EOIA 2CSHA 2EOFA 1TF6A 2J7JA 2EN3A 2WBSA 2WBUA 2MKNA 2YTFA 1YUJA 3EPHA 2YRKA 4R2SA 2HGHA 4FK5C 2DRPA 1UN6B 2EPZA 2YTEA 2EPUA 4R2CA 3EPJA 2EMWA 4F2JC 4F6MA 1TN9A 3M99B 1WJPA 2R1FA 1JK2A 1UBDC 2EL5A 2LCEA 2EOJA 4R2QA 1BBOA 2EN7A 2CT1A 3EPLA 2EPCA 2D9HA 2EPRA 1DGCA 2ADRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMX A;  2EQ0 A;  1ZU1 A;  2EL6 A;  2EE8 A;  2ELY A;  2EL4 A;  2EOZ A;  3UK3 C;  2GHF A;  2YRM A;  2YTO A;  1F2I G;  4F6N A;  1P47 A;  1AAY A;  5KL2 A;  2M9A A;  2EP3 A;  2EN6 A;  2MKD A;  2CTD A;  2EM0 A;  2EOR A;  2EN2 A;  2DLK A;  2EOE A;  2RPC A;  2EOX A;  2EN8 A;  5KL3 A;  2YTI A;  2A25 A;  5KL4 A;  4R2P A;  4M9V C;  1YUI A;  2YTN A;  1A1L A;  2EOM A;  2DLQ A;  1ZR9 A;  2EMB A;  2RSI A;  5KL7 A;  2ENC A;  2EM9 A;  1X6F A;  2LVH A;  2EM7 A;  2YSP A;  1A1J A;  1G2D C;  2WBT A;  4WSG A;  5KL5 A;  2YTJ A;  2YU5 A;  2EMC A;  2EMZ A;  2YRH A;  1A1K A;  1YSA C;  2NAB A;  2YTP A;  2EOQ A;  2YTD A;  2JP9 A;  2EMY A;  1NCS A;  2E72 A;  2EM3 A;  2GLI A;  2I13 A;  1LLM C;  1KJK A;  1TF3 A;  2ENH A;  4IS1 C;  2YU8 A;  2EMI A;  2EM8 A;  2LT7 A;  1JK1 A;  3MHS C;  1BB8 A;  2EOO A;  2EOS A;  2PRT A;  2ELZ A;  1Z1B A;  2DMI A;  2EPA A;  4X9J A;  1RMD A;  2JPA A;  3EPK A;  2VRD A;  4IJD A;  2EMH A;  2EM5 A;  2EQ1 A;  5KL6 A;  1A1H A;  2EN1 A;  2EPP A;  2EM4 A;  1A1I A;  2WCC 3;  2YSO A;  2EMA A;  2LO3 A;  2DGC A;  1G2F C;  4GZN C;  1A1G A;  2EPX A;  3MHH C;  1MEY C;  1X3C A;  1X5W A;  2EM6 A;  2EMF A;  4R2E A;  1B69 A;  2YTG A;  2BB8 A;  2EM2 A;  2EQ3 A;  3VHT B;  2YTQ A;  2EOH A;  4R2R A;  2ENA A;  1X6H A;  1X6E A;  2EML A;  2EMK A;  2EJ4 A;  2EMG A;  1ZAA C;  2MDG A;  2EOY A;  4R2A A;  2EN4 A;  2LV2 A;  1A1F A;  4R2D A;  2EOI A;  2CSH A;  2EOF A;  1TF6 A;  2J7J A;  2EN3 A;  2WBS A;  2WBU A;  2MKN A;  2YTF A;  1YUJ A;  3EPH A;  2YRK A;  4R2S A;  2HGH A;  4FK5 C;  2DRP A;  1UN6 B;  2EPZ A;  2YTE A;  2EPU A;  4R2C A;  3EPJ A;  2EMW A;  4F2J C;  4F6M A;  1TN9 A;  3M99 B;  1WJP A;  2R1F A;  1JK2 A;  1UBD C;  2EL5 A;  2LCE A;  2EOJ A;  4R2Q A;  1BBO A;  2EN7 A;  2CT1 A;  3EPL A;  2EPC A;  2D9H A;  2EPR A;  1DGC A;  2ADR A; 
#chains in the Genus database with same CATH topology
 2EMX A;  2EQ0 A;  2G7H A;  2ELY A;  2GHF A;  2YRM A;  1J5E E;  2R76 A;  4F6N A;  4ZYD A;  1DQ3 A;  1XMQ E;  1SFE A;  2MKD A;  2L2M A;  2CTD A;  4O5G A;  2DLK A;  2KHX A;  4BHB A;  5KL3 A;  2A25 A;  1N3G A;  4BCA A;  4N4R B;  4JI8 E;  1T38 A;  4DKK A;  1ZR9 A;  2CPN A;  2ENC A;  2EM9 A;  4LFB E;  2VE7 C;  2FTX B;  3K6Q A;  5KL5 A;  2YTJ A;  1PJS A;  1EKZ A;  4DR7 E;  2EMZ A;  4LTY A;  1X47 A;  2E5L E;  2LE2 A;  2LUP B;  2WZO A;  3HQ1 A;  2L3J A;  2EM3 A;  2E72 A;  2KON A;  2EZ6 A;  4LF4 E;  3LLH A;  2I13 A;  5AE1 A;  1KJK A;  5LMN E;  2ENH A;  4IS1 C;  2EMI A;  2EM8 A;  2LT7 A;  5A6K A;  3MHS C;  1UIL A;  3TQM A;  2EOO A;  4X9J A;  2NUG A;  3EPK A;  2HJJ A;  2UXC E;  4X62 E;  2RSM A;  1A1H A;  2JOB A;  2VQF E;  4BS9 A;  3IWB A;  2EPP A;  2EM4 A;  2V85 A;  2V8Q B;  1G2F C;  2YT4 A;  2V87 A;  2EPX A;  4DMI A;  4GKK E;  4WX9 A;  4DV1 E;  1X5W A;  4P7D A;  2MC5 A;  4R2E A;  5T6J A;  2YTG A;  2EM2 A;  5F3W A;  4R2R A;  5AAS A;  2M1S A;  2L8T A;  1X6E A;  2F8B A;  2EMK A;  2EJ4 A;  1ZAA C;  4P78 A;  1WHN A;  1N32 E;  1O0W A;  2EOY A;  3C4B A;  2EN4 A;  2N8X A;  2VF1 A;  3ZOQ B;  5LMU E;  2CSH A;  4ZYG A;  1TF6 A;  2J7J A;  4B3T E;  2WBS A;  1X48 A;  4MLV A;  2Q8U A;  2WBU A;  2MKN A;  4M2Z A;  4R2S A;  3KWR A;  2FGG A;  5A6A A;  1UN6 B;  3VYY A;  1YYO A;  2F4V E;  2M7Q A;  5IT9 C;  4F2J C;  4O24 A;  4R8O A;  3BBG A;  2N3H A;  1HNX E;  4JV5 E;  2NUE A;  1ZBQ A;  1HR0 E;  4R2Q A;  2EN7 A;  3VYX A;  3ADG A;  4HTG A;  4OOG C;  3JTZ A;  2CT1 A;  4DV2 E;  2EPR A;  2EPK X;  1ZU1 A;  2EE8 A;  5AE2 A;  3UK3 C;  4M30 A;  5KL2 A;  4F9A B;  2EN6 A;  2EM0 A;  1QNT A;  1J26 A;  4F9C B;  2NUF A;  2EOE A;  3KZZ A;  2YTI A;  4LF9 E;  5KL4 A;  4R2P A;  4DR6 E;  1YPN A;  2LRS A;  2EOM A;  2B9D A;  2V89 A;  2BBG A;  2EMB A;  1FJG E;  3FIG A;  3ADI A;  1A1J A;  2EM7 A;  2WBT A;  1IBM E;  4DR3 E;  4DR4 E;  4LU9 A;  3HXL A;  2GPI A;  1NEI A;  2JY9 A;  4DV3 E;  2YTP A;  2EOQ A;  1PDA A;  2GLI A;  2L3C A;  1LLM C;  4KZS A;  2IHR 1;  2YU8 A;  4DV4 E;  2EOS A;  2ELZ A;  2DMI A;  2EPA A;  4DV6 E;  4DR2 E;  2L33 A;  1RMD A;  3HPZ A;  4IJD A;  5KL6 A;  4TUI A;  4JI6 E;  3ADJ A;  4MLQ A;  3MSW A;  4F54 A;  2EWL A;  2EMA A;  2LO3 A;  2DGC A;  2RS7 A;  4I8O A;  4B3R E;  1A1G A;  1WXR A;  2EM6 A;  4RHB B;  3VHT B;  4NXN E;  2RQL A;  3P1X A;  3AUZ A;  2B3T B;  2MDG A;  4R2A A;  2ZM6 E;  3C6K A;  4NZV A;  1WHQ A;  2UUB E;  3JU0 A;  1A1F A;  4JI3 E;  5IWA E;  1STU A;  3KZY A;  3J7Y p;  2FV4 B;  2HHH E;  4F9B B;  3EPH A;  1IMU A;  4WYQ B;  2HGH A;  2M4I A;  4DV7 E;  2EPU A;  4R2C A;  5A2Q C;  2VQE E;  4DUZ E;  4NHR A;  4Q35 B;  4F6M A;  1TN9 A;  1WJP A;  2LJH A;  1EH6 A;  2EPL X;  1UBD C;  4WFT A;  1RC7 A;  1IBL E;  1PKP A;  2EOJ A;  1GZ6 A;  3IWD A;  2H36 X;  5IXM B;  4DUY E;  1DGC A;  4M9V C;  2DIX A;  2EL4 A;  2EOZ A;  2YTO A;  3QG5 C;  2YWQ A;  1P47 A;  4JI0 E;  2M9A A;  4RH8 A;  4WXC A;  3J81 C;  3T1H E;  1SR9 A;  2EN2 A;  2K4V A;  5DNY A;  2EN8 A;  4HEI A;  2LTR A;  4X64 E;  3JAM C;  1YUI A;  4LF8 E;  5LLQ A;  3L00 A;  5KL7 A;  2LVH A;  1G2D C;  1PJQ A;  3HTX A;  2JXP A;  2EMC A;  3DF6 A;  1A1K A;  3F6G A;  4L8N A;  2YTD A;  1FKA E;  4GKJ E;  2EMY A;  2EPN A;  5IV8 B;  4NXM E;  4JI7 E;  2E1M A;  3BF2 A;  5A6J A;  4JYA E;  1T4N A;  2JVA A;  1BB8 A;  1T39 A;  4M0V A;  1Z1B A;  5TSE A;  2JR1 A;  2JPA A;  2LTS A;  4JI2 E;  2VRD A;  1T4L B;  1KYQ A;  2L2N A;  2EM5 A;  5CFF E;  2L92 A;  1N33 E;  2EN1 A;  5ADZ A;  2DB2 A;  4X8W A;  1MGT A;  1XMO E;  1A1I A;  2ODR C;  2WCC 3;  4JI4 E;  4WXD A;  4GZN C;  3THO B;  4DR5 E;  1N36 E;  3BID A;  4OX9 E;  3BGH A;  1YYK A;  1B69 A;  2HC5 A;  1X49 A;  2JWO A;  2YTQ A;  1YZ9 A;  1ZBT A;  2ENA A;  1X6H A;  5A6B D;  4BC9 A;  4B3S E;  4X65 E;  4B3M E;  2LV2 A;  5AE3 A;  2MDR A;  3LML A;  2EOI A;  2EOF A;  4K0K E;  2EN3 A;  2YZT A;  2NA2 A;  1N34 E;  4DR1 E;  1PJT A;  1YUJ A;  1RQ0 A;  2RS6 A;  2UU9 E;  2UUC E;  2RTX A;  4O4K A;  2B7T A;  2V83 A;  3H09 A;  4FK5 C;  2DRP A;  3RMP A;  2EPZ A;  2YTE A;  3DJW A;  1I94 E;  2EMW A;  2EPM X;  1WRJ A;  2R1F A;  1GQE A;  2EL5 A;  1BBO A;  3VK6 A;  1DI2 A;  2ADR A;  4WPY A;  3OTO E;  4YY3 E;  2L2K B;  2EL6 A;  1EH7 A;  2UXD E;  3OML A;  1F2I G;  1BBG A;  1AAY A;  2MC6 A;  1L4S A;  2V86 A;  3J7A G;  2EP3 A;  4Q28 A;  2EOR A;  1IBK E;  2RPC A;  2EOX A;  4TUG A;  2KOU A;  4LFC E;  4DV0 E;  4BHC A;  5FLX C;  2YTN A;  4YHH E;  1A1L A;  2DLQ A;  2LUQ A;  2RSI A;  1X6F A;  2YSP A;  2YPN A;  4WSG A;  3ADL A;  4R03 A;  2YU5 A;  4LF6 E;  2YRH A;  4JI5 E;  3J80 C;  1YSA C;  2NAB A;  1HNZ E;  2JP9 A;  1NCS A;  4BBY A;  1T4O A;  1UHZ A;  4WSP A;  1TF3 A;  4AQY E;  1JK1 A;  1IQS A;  2PRT A;  1XNQ E;  1XNR E;  2EMH A;  3THN A;  2EQ1 A;  3IWC A;  3C6M A;  1GTK A;  4ZYH A;  5A6B A;  3T1Y E;  1YFH A;  2YSO A;  4X66 E;  4GEQ B;  3C4T A;  2EPO A;  4LFA E;  2V88 A;  3MHH C;  4BMJ A;  1MEY C;  1X3C A;  2N3G A;  3HPS A;  1QU6 A;  2B7V A;  4BC7 A;  2EMF A;  5A69 A;  2I9I A;  4J8Z A;  4DV5 E;  2BB8 A;  2EQ3 A;  3F6H A;  2EOH A;  1EH8 A;  2EML A;  2EMG A;  4LF7 E;  2DMY A;  4L5N C;  2LBS B;  2JOX A;  1YYW A;  2UXB E;  4KHP E;  4LF5 E;  5LL6 R;  3ECR A;  5AC4 A;  4R2D A;  1HNW E;  2UUA E;  2YTF A;  2YRK A;  4KWY A;  3EQ1 A;  2L6M A;  1IQO A;  3EPJ A;  2DSY A;  2LJU A;  3AV0 A;  4JI1 E;  3M99 B;  1JK2 A;  2ODR D;  2LCE A;  2JYA A;  5BR8 E;  4ZYE A;  5AC5 A;  2LMZ A;  2K7I A;  4O43 A;  3EPL A;  2EPC A;  2D9H A;  1AH5 A; 
#chains in the Genus database with same CATH homology
 2EMX A;  2EQ0 A;  1ZU1 A;  2EL6 A;  2EE8 A;  2ELY A;  2EL4 A;  2EOZ A;  3UK3 C;  2GHF A;  2YRM A;  2YTO A;  1F2I G;  4F6N A;  1P47 A;  1AAY A;  5KL2 A;  2M9A A;  2EP3 A;  2EN6 A;  2MKD A;  2CTD A;  2EM0 A;  2EOR A;  2EN2 A;  2DLK A;  2EOE A;  2RPC A;  2EOX A;  2EN8 A;  5KL3 A;  2YTI A;  2A25 A;  5KL4 A;  4R2P A;  4M9V C;  1YUI A;  2YTN A;  1A1L A;  2EOM A;  2DLQ A;  1ZR9 A;  2EMB A;  2RSI A;  5KL7 A;  2ENC A;  2EM9 A;  1X6F A;  2LVH A;  2EM7 A;  2YSP A;  1A1J A;  1G2D C;  2WBT A;  4WSG A;  5KL5 A;  2YTJ A;  2YU5 A;  2EMC A;  2EMZ A;  2YRH A;  1A1K A;  1YSA C;  2NAB A;  2YTP A;  2EOQ A;  2YTD A;  2JP9 A;  2EMY A;  1NCS A;  2E72 A;  2EM3 A;  2GLI A;  2I13 A;  1LLM C;  1KJK A;  1TF3 A;  2ENH A;  4IS1 C;  2YU8 A;  2EMI A;  2EM8 A;  2LT7 A;  1JK1 A;  3MHS C;  1BB8 A;  2EOO A;  2EOS A;  2PRT A;  2ELZ A;  1Z1B A;  2DMI A;  2EPA A;  4X9J A;  1RMD A;  2JPA A;  3EPK A;  2VRD A;  4IJD A;  2EMH A;  2EM5 A;  2EQ1 A;  5KL6 A;  1A1H A;  2EN1 A;  2EPP A;  2EM4 A;  1A1I A;  2WCC 3;  2YSO A;  2EMA A;  2LO3 A;  2DGC A;  1G2F C;  4GZN C;  1A1G A;  2EPX A;  3MHH C;  1MEY C;  1X3C A;  1X5W A;  2EM6 A;  2EMF A;  4R2E A;  1B69 A;  2YTG A;  2BB8 A;  2EM2 A;  2EQ3 A;  3VHT B;  2YTQ A;  2EOH A;  4R2R A;  2ENA A;  1X6H A;  1X6E A;  2EML A;  2EMK A;  2EJ4 A;  2EMG A;  1ZAA C;  2MDG A;  2EOY A;  4R2A A;  2EN4 A;  2LV2 A;  1A1F A;  4R2D A;  2EOI A;  2CSH A;  2EOF A;  1TF6 A;  2J7J A;  2EN3 A;  2WBS A;  2WBU A;  2MKN A;  2YTF A;  1YUJ A;  3EPH A;  2YRK A;  4R2S A;  2HGH A;  4FK5 C;  2DRP A;  1UN6 B;  2EPZ A;  2YTE A;  2EPU A;  4R2C A;  3EPJ A;  2EMW A;  4F2J C;  4F6M A;  1TN9 A;  3M99 B;  1WJP A;  2R1F A;  1JK2 A;  1UBD C;  2EL5 A;  2LCE A;  2EOJ A;  4R2Q A;  1BBO A;  2EN7 A;  2CT1 A;  3EPL A;  2EPC A;  2D9H A;  2EPR A;  1DGC A;  2ADR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...