2ELZA

Solution structure of the 17th zf-c2h2 domain from human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSVEKPYKCEDCGKGYNRRLNLDMHQRVHMGEKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the 17th zf-C2H2 domain from human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2elzA01
2E72A 2ENHA 2EL4A 2EPCA 3M99B 2CSHA 2WBTA 1X6FA 2YTFA 2ADRA 2EM0A 2EN4A 2EN1A 2EMGA 2EMHA 5KL6A 2WBSA 2EMBA 2GHFA 2A25A 4M9VC 1TF6A 2EN2A 1P47A 2EOFA 2EOYA 2YSOA 2EOEA 2ENCA 2DRPA 1BBOA 2ELYA 1UN6B 2EJ4A 2EQ1A 2EM2A 2EM4A 1LLMC 2EMKA 2YTEA 5KL7A 2EN8A 2YTPA 1A1HA 3MHSC 1A1FA 2EOIA 2EPZA 4WSGA 1DGCA 2EQ0A 2EMAA 1YSAC 3EPKA 2BB8A 2GLIA 2YTGA 1X6HA 2EM3A 2EPAA 2EQ3A 2EPRA 2EOQA 1A1JA 2EPPA 2JP9A 2EM7A 4R2CA 2EN7A 2ENAA 4F2JC 4X9JA 3EPJA 3EPHA 2M9AA 1A1KA 1G2DC 2DLQA 2YRHA 2EORA 2LCEA 2EM8A 2DMIA 2EN3A 2CT1A 2LV2A 4GZNC 2DLKA 2R1FA 1A1LA 2MKNA 5KL5A 2EM9A 3UK3C 1Z1BA 2DGCA 2EMIA 2YSPA 2LVHA 4FK5C 4R2PA 2LT7A 2RPCA 2EOZA 3MHHC 2EL6A 4R2DA 1JK1A 2EOHA 1A1IA 1YUJA 1BB8A 1X6EA 2EMYA 1UBDC 1F2IG 2VRDA 4F6MA 2HGHA 1YUIA 2ELZA 1TN9A 2EOJA 1ZR9A 4R2EA 2EN6A 2EOSA 2D9HA 2I13A 1A1GA 2MKDA 2EM5A 2MDGA 2EMWA 2YU8A 4IJDA 4R2SA 2EMFA 1RMDA 2EMZA 2YTJA 2CTDA 2EPXA 2EMXA 2YTOA 4R2QA 2EPUA 4R2AA 4F6NA 3VHTB 1B69A 2RSIA 2YRKA 3EPLA 2YTIA 2JPAA 2YTNA 2WCC3 2EL5A 1AAYA 4IS1C 2J7JA 5KL3A 5KL2A 2PRTA 2YTQA 2EOXA 2NABA 2EOOA 5KL4A 1ZAAC 2EOMA 2YTDA 1TF3A 1ZU1A 2EE8A 2LO3A 2EMLA 2WBUA 1X5WA 2EM6A 2YU5A 1JK2A 1MEYC 1WJPA 1X3CA 1G2FC 2EMCA 2EP3A 1KJKA 4R2RA 2YRMA 1NCSA
chains in the Genus database with same CATH superfamily
5F3WA 4O43A 1X48A 3T1HE 2GPIA 2EPCA 4JYAE 3ECRA 2EM0A 2EN1A 5KL6A 5IXMB 2FTXB 3J7AG 4BS9A 1P47A 2L33A 2EOEA 2DRPA 5A2QC 3J7Yp 2ODRC 2I9IA 2FGGA 1UN6B 3C6KA 2EJ4A 1STUA 2EQ1A 4WPYA 4LFBE 4KWYA 2EM4A 1LLMC 2EN8A 1UHZA 1A1FA 3IWCA 4WSGA 2EQ0A 2DMYA 2BB8A 2YWQA 2EPAA 2UUBE 4DR6E 2JYAA 1A1JA 1IBME 3HPSA 2B3TB 3MSWA 4JI3E 3J81C 4LF7E 4F2JC 3J80C 1N33E 2M9AA 5AC4A 2DLQA 5A6BD 4X64E 5LMUE 2DMIA 2EN3A 4GKKE 4GZNC 1A1LA 2L92A 4YY3E 2LBSB 2MDRA 4ZYHA 2RPCA 2EOZA 2MC5A 1UILA 3MHHC 3KZYA 1PJQA 4B3RE 1ZBTA 4OOGC 1X6EA 2V88A 2RS7A 4X65E 2JR1A 2L2KB 2HGHA 2LTSA 1YUIA 2ELZA 4R2EA 4B3SE 2EOSA 2MKDA 2EMWA 4IJDA 3BGHA 4JI2E 2EMZA 4WXDA 2UXCE 3LMLA 2DB2A 4X66E 2UXDE 4DR7E 1HNWE 5AASA 3VK6A 1IMUA 1NEIA 4NXNE 1AH5A 4DMIA 5LMNE 4IS1C 3HTXA 3JAMC 2KONA 1N36E 4DR2E 2PRTA 2YTQA 2EOXA 4JI4E 5KL4A 5IV8B 3THOB 2YTDA 1RC7A 4JI6E 1YFHA 3HXLA 1X47A 1ZBQA 4OX9E 1EH7A 2LMZA 1YYOA 1EH8A 4I8OA 2E72A 1IBLE 2ENHA 2EL4A 3M99B 2CSHA 2EZ6A 4JI7E 2L3JA 2ZM6E 3BBGA 2YTFA 5DNYA 4F9CB 2EMGA 2WBSA 2GHFA 5AE3A 2A25A 1TF6A 1N3GA 1XMQE 4M2ZA 2EOYA 4TUIA 4RHBB 1BBOA 2HHHE 2CPNA 4ZYDA 2EMKA 4JI5E 4M0VA 3MHSC 2EOIA 4X62E 5A6AA 3C4TA 1DGCA 2E1MA 1YSAC 2GLIA 3C4BA 1DQ3A 4DV2E 1YPNA 2EOQA 3EQ1A 4HTGA 4R2CA 2EN7A 1DI2A 3AV0A 3EPJA 1A1KA 2K7IA 1WHNA 4L5NC 1WHQA 2LCEA 4MLVA 3ADIA 2CT1A 2MKNA 5KL5A 1T39A 3UK3C 4DR3E 2EMIA 2YSPA 4NHRA 5IT9C 4NZVA 4FK5C 4MLQA 1T4LB 1GQEA 2N3GA 4DKKA 2EL6A 1JK1A 2YPNA 1PJTA 4WSPA 1RQ0A 5IWAE 2VQFE 4LF9E 2L6MA 4HEIA 3HPZA 4K0KE 1HR0E 4J8ZA 4JV5E 2I13A 2D9HA 1WXRA 1GTKA 4LF4E 4TUGA 2MDGA 1O0WA 2G7HA 3ZOQB 2EMFA 2NUFA 1EH6A 2CTDA 3F6HA 4DV7E 1YYKA 4LF5E 4R2AA 1PKPA 2YTIA 3ADLA 2JPAA 2V85A 2H36X 2WCC3 2M4IA 2ODRD 5LLQA 4YHHE 2M1SA 2L2MA 4BCAA 2L2NA 4LU9A 2LUQA 2MC6A 2EPKX 3BF2A 3THNA 3RMPA 2EE8A 1ZU1A 2WBUA 1X5WA 1N32E 1WJPA 1PDAA 2EMCA 2RQLA 1KJKA 4R2RA 3LLHA 5LL6R 4DV4E 4NXME 4DR1E 4GKJE 2VF1A 2JXPA 1PJSA 1X6FA 2ADRA 2EN4A 3IWDA 2JWOA 4BC9A 3L00A 4LF6E 3KZZA 2EMBA 4F54A 2EOFA 2YSOA 3T1YE 5FLXC 2ELYA 2N3HA 2B7VA 2YTEA 2NA2A 2YTPA 5KL7A 5A6BA 4DV3E 2EPZA 1IBKE 2JOXA 2EQ3A 2EPRA 2HJJA 2WZOA 2EPPA 2BBGA 5A6KA 4DV5E 2RS6A 1IQSA 2ENAA 2K4VA 4Q35B 1XNQE 2M7QA 3AUZA 2YRHA 4BBYA 5AC5A 4R8OA 2LUPB 3DJWA 2DIXA 2LV2A 2DLKA 4ZYEA 2N8XA 4R03A 2Q8UA 3OMLA 1T38A 1Z1BA 1N34E 2DGCA 5TSEA 5BR8E 4O5GA 3KWRA 4BHCA 2EOHA 2V8QB 2JOBA 4ZYGA 4B3ME 1YUJA 4L8NA 3DF6A 4Q28A 4BHBA 1GZ6A 2LRSA 5A69A 1F2IG 5T6JA 2FV4B 2V83A 4F6MA 4BMJA 4KHPE 2EOJA 1EKZA 1KYQA 2LJUA 3ADGA 1IQOA 2YU8A 2YTJA 1RMDA 2EPXA 2YTOA 1SR9A 2LJHA 2YRKA 4KZSA 3EPLA 2UXBE 1BBGA 2EPNA 4GEQB 2EPLX 2J7JA 5CFFE 2F8BA 5KL3A 2EOOA 2F4VE 4P78A 1QU6A 4DUZE 2EOMA 1TF3A 1J26A 2EMLA 3TQMA 5ADZA 2EM6A 2YU5A 1MEYC 1HNZE 2EP3A 2KOUA 4WFTA 2YRMA 4M30A 1NCSA 3VYXA 1T4NA 2L3CA 2WBTA 4F9BB 4BC7A 3JTZA 4LFAE 2EMHA 2VE7C 1SFEA 4M9VC 2EN2A 2HC5A 4LTYA 3C6MA 2UU9E 1XMOE 2ENCA 4LF8E 2EM2A 1WRJA 4DV1E 3K6QA 1A1HA 4RH8A 2EMAA 1QNTA 3EPKA 2V86A 2YTGA 1X6HA 2EM3A 2JY9A 4JI0E 2EWLA 4DV0E 2JP9A 2EM7A 4WX9A 4F9AB 4X9JA 1YYWA 1J5EE 4LFCE 3EPHA 1G2DC 4JI1E 2B9DA 2LE2A 2EORA 2LTRA 4O4KA 2JVAA 2EM8A 4WYQB 4DR5E 2YZTA 2E5LE 2R1FA 3QG5C 3F6GA 3FIGA 2EM9A 4JI8E 2LVHA 4R2PA 4DR4E 2LT7A 2DSYA 1XNRE 4WXCA 4R2DA 2UUAE 2EPOA 4O24A 3JU0A 4B3TE 2EPMX 3BIDA 1A1IA 1BB8A 2EMYA 1L4SA 1UBDC 1FKAE 2VQEE 2VRDA 2V89A 5AE2A 2NUEA 1TN9A 1ZR9A 2EN6A 4DV6E 1A1GA 2EM5A 2IHR1 2YT4A 4R2SA 3HQ1A 4N4RB 2B7TA 2NUGA 2EMXA 4R2QA 2EPUA 3ADJA 4F6NA 3VHTB 1B69A 2RSIA 2KHXA 1FJGE 2YTNA 1I94E 1YZ9A 2R76A 2EL5A 3IWBA 5AE1A 1AAYA 2V87A 2RTXA 4X8WA 4DUYE 4AQYE 5KL2A 3VYYA 2NABA 3P1XA 5A6JA 1ZAAC 2L8TA 3OTOE 2LO3A 1T4OA 4P7DA 1JK2A 1MGTA 1HNXE 1X3CA 1G2FC 2UUCE 3H09A 1X49A 2RSMA
chains in the Genus database with same CATH topology
2E72A 2ENHA 2EL4A 2EPCA 3M99B 2CSHA 2WBTA 1X6FA 2YTFA 2ADRA 2EM0A 2EN4A 2EN1A 2EMGA 2EMHA 5KL6A 2WBSA 2EMBA 2GHFA 2A25A 4M9VC 1TF6A 2EN2A 1P47A 2EOFA 2EOYA 2YSOA 2EOEA 2ENCA 2DRPA 1BBOA 2ELYA 1UN6B 2EJ4A 2EQ1A 2EM2A 2EM4A 1LLMC 2EMKA 2YTEA 5KL7A 2EN8A 2YTPA 1A1HA 3MHSC 1A1FA 2EOIA 2EPZA 4WSGA 1DGCA 2EQ0A 2EMAA 1YSAC 3EPKA 2BB8A 2GLIA 2YTGA 1X6HA 2EM3A 2EPAA 2EQ3A 2EPRA 2EOQA 1A1JA 2EPPA 2JP9A 2EM7A 4R2CA 2EN7A 2ENAA 4F2JC 4X9JA 3EPJA 3EPHA 2M9AA 1A1KA 1G2DC 2DLQA 2YRHA 2EORA 2LCEA 2EM8A 2DMIA 2EN3A 2CT1A 2LV2A 4GZNC 2DLKA 2R1FA 1A1LA 2MKNA 5KL5A 2EM9A 3UK3C 1Z1BA 2DGCA 2EMIA 2YSPA 2LVHA 4FK5C 4R2PA 2LT7A 2RPCA 2EOZA 3MHHC 2EL6A 4R2DA 1JK1A 2EOHA 1A1IA 1YUJA 1BB8A 1X6EA 2EMYA 1UBDC 1F2IG 2VRDA 4F6MA 2HGHA 1YUIA 2ELZA 1TN9A 2EOJA 1ZR9A 4R2EA 2EN6A 2EOSA 2D9HA 2I13A 1A1GA 2MKDA 2EM5A 2MDGA 2EMWA 2YU8A 4IJDA 4R2SA 2EMFA 1RMDA 2EMZA 2YTJA 2CTDA 2EPXA 2EMXA 2YTOA 4R2QA 2EPUA 4R2AA 4F6NA 3VHTB 1B69A 2RSIA 2YRKA 3EPLA 2YTIA 2JPAA 2YTNA 2WCC3 2EL5A 1AAYA 4IS1C 2J7JA 5KL3A 5KL2A 2PRTA 2YTQA 2EOXA 2NABA 2EOOA 5KL4A 1ZAAC 2EOMA 2YTDA 1TF3A 1ZU1A 2EE8A 2LO3A 2EMLA 2WBUA 1X5WA 2EM6A 2YU5A 1JK2A 1MEYC 1WJPA 1X3CA 1G2FC 2EMCA 2EP3A 1KJKA 4R2RA 2YRMA 1NCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E72 A;  2ENH A;  2EL4 A;  2EPC A;  3M99 B;  2CSH A;  2WBT A;  1X6F A;  2YTF A;  2ADR A;  2EM0 A;  2EN4 A;  2EN1 A;  2EMG A;  2EMH A;  5KL6 A;  2WBS A;  2EMB A;  2GHF A;  2A25 A;  4M9V C;  1TF6 A;  2EN2 A;  1P47 A;  2EOF A;  2EOY A;  2YSO A;  2EOE A;  2ENC A;  2DRP A;  1BBO A;  2ELY A;  1UN6 B;  2EJ4 A;  2EQ1 A;  2EM2 A;  2EM4 A;  1LLM C;  2EMK A;  2YTE A;  5KL7 A;  2EN8 A;  2YTP A;  1A1H A;  3MHS C;  1A1F A;  2EOI A;  2EPZ A;  4WSG A;  1DGC A;  2EQ0 A;  2EMA A;  1YSA C;  3EPK A;  2BB8 A;  2GLI A;  2YTG A;  1X6H A;  2EM3 A;  2EPA A;  2EQ3 A;  2EPR A;  2EOQ A;  1A1J A;  2EPP A;  2JP9 A;  2EM7 A;  4R2C A;  2EN7 A;  2ENA A;  4F2J C;  4X9J A;  3EPJ A;  3EPH A;  2M9A A;  1A1K A;  1G2D C;  2DLQ A;  2YRH A;  2EOR A;  2LCE A;  2EM8 A;  2DMI A;  2EN3 A;  2CT1 A;  2LV2 A;  4GZN C;  2DLK A;  2R1F A;  1A1L A;  2MKN A;  5KL5 A;  2EM9 A;  3UK3 C;  1Z1B A;  2DGC A;  2EMI A;  2YSP A;  2LVH A;  4FK5 C;  4R2P A;  2LT7 A;  2RPC A;  2EOZ A;  3MHH C;  2EL6 A;  4R2D A;  1JK1 A;  2EOH A;  1A1I A;  1YUJ A;  1BB8 A;  1X6E A;  2EMY A;  1UBD C;  1F2I G;  2VRD A;  4F6M A;  2HGH A;  1YUI A;  2ELZ A;  1TN9 A;  2EOJ A;  1ZR9 A;  4R2E A;  2EN6 A;  2EOS A;  2D9H A;  2I13 A;  1A1G A;  2MKD A;  2EM5 A;  2MDG A;  2EMW A;  2YU8 A;  4IJD A;  4R2S A;  2EMF A;  1RMD A;  2EMZ A;  2YTJ A;  2CTD A;  2EPX A;  2EMX A;  2YTO A;  4R2Q A;  2EPU A;  4R2A A;  4F6N A;  3VHT B;  1B69 A;  2RSI A;  2YRK A;  3EPL A;  2YTI A;  2JPA A;  2YTN A;  2WCC 3;  2EL5 A;  1AAY A;  4IS1 C;  2J7J A;  5KL3 A;  5KL2 A;  2PRT A;  2YTQ A;  2EOX A;  2NAB A;  2EOO A;  5KL4 A;  1ZAA C;  2EOM A;  2YTD A;  1TF3 A;  1ZU1 A;  2EE8 A;  2LO3 A;  2EML A;  2WBU A;  1X5W A;  2EM6 A;  2YU5 A;  1JK2 A;  1MEY C;  1WJP A;  1X3C A;  1G2F C;  2EMC A;  2EP3 A;  1KJK A;  4R2R A;  2YRM A;  1NCS A; 
#chains in the Genus database with same CATH topology
 5F3W A;  4O43 A;  1X48 A;  3T1H E;  2GPI A;  2EPC A;  4JYA E;  3ECR A;  2EM0 A;  2EN1 A;  5KL6 A;  5IXM B;  2FTX B;  3J7A G;  4BS9 A;  1P47 A;  2L33 A;  2EOE A;  2DRP A;  5A2Q C;  3J7Y p;  2ODR C;  2I9I A;  2FGG A;  1UN6 B;  3C6K A;  2EJ4 A;  1STU A;  2EQ1 A;  4WPY A;  4LFB E;  4KWY A;  2EM4 A;  1LLM C;  2EN8 A;  1UHZ A;  1A1F A;  3IWC A;  4WSG A;  2EQ0 A;  2DMY A;  2BB8 A;  2YWQ A;  2EPA A;  2UUB E;  4DR6 E;  2JYA A;  1A1J A;  1IBM E;  3HPS A;  2B3T B;  3MSW A;  4JI3 E;  3J81 C;  4LF7 E;  4F2J C;  3J80 C;  1N33 E;  2M9A A;  5AC4 A;  2DLQ A;  5A6B D;  4X64 E;  5LMU E;  2DMI A;  2EN3 A;  4GKK E;  4GZN C;  1A1L A;  2L92 A;  4YY3 E;  2LBS B;  2MDR A;  4ZYH A;  2RPC A;  2EOZ A;  2MC5 A;  1UIL A;  3MHH C;  3KZY A;  1PJQ A;  4B3R E;  1ZBT A;  4OOG C;  1X6E A;  2V88 A;  2RS7 A;  4X65 E;  2JR1 A;  2L2K B;  2HGH A;  2LTS A;  1YUI A;  2ELZ A;  4R2E A;  4B3S E;  2EOS A;  2MKD A;  2EMW A;  4IJD A;  3BGH A;  4JI2 E;  2EMZ A;  4WXD A;  2UXC E;  3LML A;  2DB2 A;  4X66 E;  2UXD E;  4DR7 E;  1HNW E;  5AAS A;  3VK6 A;  1IMU A;  1NEI A;  4NXN E;  1AH5 A;  4DMI A;  5LMN E;  4IS1 C;  3HTX A;  3JAM C;  2KON A;  1N36 E;  4DR2 E;  2PRT A;  2YTQ A;  2EOX A;  4JI4 E;  5KL4 A;  5IV8 B;  3THO B;  2YTD A;  1RC7 A;  4JI6 E;  1YFH A;  3HXL A;  1X47 A;  1ZBQ A;  4OX9 E;  1EH7 A;  2LMZ A;  1YYO A;  1EH8 A;  4I8O A;  2E72 A;  1IBL E;  2ENH A;  2EL4 A;  3M99 B;  2CSH A;  2EZ6 A;  4JI7 E;  2L3J A;  2ZM6 E;  3BBG A;  2YTF A;  5DNY A;  4F9C B;  2EMG A;  2WBS A;  2GHF A;  5AE3 A;  2A25 A;  1TF6 A;  1N3G A;  1XMQ E;  4M2Z A;  2EOY A;  4TUI A;  4RHB B;  1BBO A;  2HHH E;  2CPN A;  4ZYD A;  2EMK A;  4JI5 E;  4M0V A;  3MHS C;  2EOI A;  4X62 E;  5A6A A;  3C4T A;  1DGC A;  2E1M A;  1YSA C;  2GLI A;  3C4B A;  1DQ3 A;  4DV2 E;  1YPN A;  2EOQ A;  3EQ1 A;  4HTG A;  4R2C A;  2EN7 A;  1DI2 A;  3AV0 A;  3EPJ A;  1A1K A;  2K7I A;  1WHN A;  4L5N C;  1WHQ A;  2LCE A;  4MLV A;  3ADI A;  2CT1 A;  2MKN A;  5KL5 A;  1T39 A;  3UK3 C;  4DR3 E;  2EMI A;  2YSP A;  4NHR A;  5IT9 C;  4NZV A;  4FK5 C;  4MLQ A;  1T4L B;  1GQE A;  2N3G A;  4DKK A;  2EL6 A;  1JK1 A;  2YPN A;  1PJT A;  4WSP A;  1RQ0 A;  5IWA E;  2VQF E;  4LF9 E;  2L6M A;  4HEI A;  3HPZ A;  4K0K E;  1HR0 E;  4J8Z A;  4JV5 E;  2I13 A;  2D9H A;  1WXR A;  1GTK A;  4LF4 E;  4TUG A;  2MDG A;  1O0W A;  2G7H A;  3ZOQ B;  2EMF A;  2NUF A;  1EH6 A;  2CTD A;  3F6H A;  4DV7 E;  1YYK A;  4LF5 E;  4R2A A;  1PKP A;  2YTI A;  3ADL A;  2JPA A;  2V85 A;  2H36 X;  2WCC 3;  2M4I A;  2ODR D;  5LLQ A;  4YHH E;  2M1S A;  2L2M A;  4BCA A;  2L2N A;  4LU9 A;  2LUQ A;  2MC6 A;  2EPK X;  3BF2 A;  3THN A;  3RMP A;  2EE8 A;  1ZU1 A;  2WBU A;  1X5W A;  1N32 E;  1WJP A;  1PDA A;  2EMC A;  2RQL A;  1KJK A;  4R2R A;  3LLH A;  5LL6 R;  4DV4 E;  4NXM E;  4DR1 E;  4GKJ E;  2VF1 A;  2JXP A;  1PJS A;  1X6F A;  2ADR A;  2EN4 A;  3IWD A;  2JWO A;  4BC9 A;  3L00 A;  4LF6 E;  3KZZ A;  2EMB A;  4F54 A;  2EOF A;  2YSO A;  3T1Y E;  5FLX C;  2ELY A;  2N3H A;  2B7V A;  2YTE A;  2NA2 A;  2YTP A;  5KL7 A;  5A6B A;  4DV3 E;  2EPZ A;  1IBK E;  2JOX A;  2EQ3 A;  2EPR A;  2HJJ A;  2WZO A;  2EPP A;  2BBG A;  5A6K A;  4DV5 E;  2RS6 A;  1IQS A;  2ENA A;  2K4V A;  4Q35 B;  1XNQ E;  2M7Q A;  3AUZ A;  2YRH A;  4BBY A;  5AC5 A;  4R8O A;  2LUP B;  3DJW A;  2DIX A;  2LV2 A;  2DLK A;  4ZYE A;  2N8X A;  4R03 A;  2Q8U A;  3OML A;  1T38 A;  1Z1B A;  1N34 E;  2DGC A;  5TSE A;  5BR8 E;  4O5G A;  3KWR A;  4BHC A;  2EOH A;  2V8Q B;  2JOB A;  4ZYG A;  4B3M E;  1YUJ A;  4L8N A;  3DF6 A;  4Q28 A;  4BHB A;  1GZ6 A;  2LRS A;  5A69 A;  1F2I G;  5T6J A;  2FV4 B;  2V83 A;  4F6M A;  4BMJ A;  4KHP E;  2EOJ A;  1EKZ A;  1KYQ A;  2LJU A;  3ADG A;  1IQO A;  2YU8 A;  2YTJ A;  1RMD A;  2EPX A;  2YTO A;  1SR9 A;  2LJH A;  2YRK A;  4KZS A;  3EPL A;  2UXB E;  1BBG A;  2EPN A;  4GEQ B;  2EPL X;  2J7J A;  5CFF E;  2F8B A;  5KL3 A;  2EOO A;  2F4V E;  4P78 A;  1QU6 A;  4DUZ E;  2EOM A;  1TF3 A;  1J26 A;  2EML A;  3TQM A;  5ADZ A;  2EM6 A;  2YU5 A;  1MEY C;  1HNZ E;  2EP3 A;  2KOU A;  4WFT A;  2YRM A;  4M30 A;  1NCS A;  3VYX A;  1T4N A;  2L3C A;  2WBT A;  4F9B B;  4BC7 A;  3JTZ A;  4LFA E;  2EMH A;  2VE7 C;  1SFE A;  4M9V C;  2EN2 A;  2HC5 A;  4LTY A;  3C6M A;  2UU9 E;  1XMO E;  2ENC A;  4LF8 E;  2EM2 A;  1WRJ A;  4DV1 E;  3K6Q A;  1A1H A;  4RH8 A;  2EMA A;  1QNT A;  3EPK A;  2V86 A;  2YTG A;  1X6H A;  2EM3 A;  2JY9 A;  4JI0 E;  2EWL A;  4DV0 E;  2JP9 A;  2EM7 A;  4WX9 A;  4F9A B;  4X9J A;  1YYW A;  1J5E E;  4LFC E;  3EPH A;  1G2D C;  4JI1 E;  2B9D A;  2LE2 A;  2EOR A;  2LTR A;  4O4K A;  2JVA A;  2EM8 A;  4WYQ B;  4DR5 E;  2YZT A;  2E5L E;  2R1F A;  3QG5 C;  3F6G A;  3FIG A;  2EM9 A;  4JI8 E;  2LVH A;  4R2P A;  4DR4 E;  2LT7 A;  2DSY A;  1XNR E;  4WXC A;  4R2D A;  2UUA E;  2EPO A;  4O24 A;  3JU0 A;  4B3T E;  2EPM X;  3BID A;  1A1I A;  1BB8 A;  2EMY A;  1L4S A;  1UBD C;  1FKA E;  2VQE E;  2VRD A;  2V89 A;  5AE2 A;  2NUE A;  1TN9 A;  1ZR9 A;  2EN6 A;  4DV6 E;  1A1G A;  2EM5 A;  2IHR 1;  2YT4 A;  4R2S A;  3HQ1 A;  4N4R B;  2B7T A;  2NUG A;  2EMX A;  4R2Q A;  2EPU A;  3ADJ A;  4F6N A;  3VHT B;  1B69 A;  2RSI A;  2KHX A;  1FJG E;  2YTN A;  1I94 E;  1YZ9 A;  2R76 A;  2EL5 A;  3IWB A;  5AE1 A;  1AAY A;  2V87 A;  2RTX A;  4X8W A;  4DUY E;  4AQY E;  5KL2 A;  3VYY A;  2NAB A;  3P1X A;  5A6J A;  1ZAA C;  2L8T A;  3OTO E;  2LO3 A;  1T4O A;  4P7D A;  1JK2 A;  1MGT A;  1HNX E;  1X3C A;  1G2F C;  2UUC E;  3H09 A;  1X49 A;  2RSM A; 
#chains in the Genus database with same CATH homology
 2E72 A;  2ENH A;  2EL4 A;  2EPC A;  3M99 B;  2CSH A;  2WBT A;  1X6F A;  2YTF A;  2ADR A;  2EM0 A;  2EN4 A;  2EN1 A;  2EMG A;  2EMH A;  5KL6 A;  2WBS A;  2EMB A;  2GHF A;  2A25 A;  4M9V C;  1TF6 A;  2EN2 A;  1P47 A;  2EOF A;  2EOY A;  2YSO A;  2EOE A;  2ENC A;  2DRP A;  1BBO A;  2ELY A;  1UN6 B;  2EJ4 A;  2EQ1 A;  2EM2 A;  2EM4 A;  1LLM C;  2EMK A;  2YTE A;  5KL7 A;  2EN8 A;  2YTP A;  1A1H A;  3MHS C;  1A1F A;  2EOI A;  2EPZ A;  4WSG A;  1DGC A;  2EQ0 A;  2EMA A;  1YSA C;  3EPK A;  2BB8 A;  2GLI A;  2YTG A;  1X6H A;  2EM3 A;  2EPA A;  2EQ3 A;  2EPR A;  2EOQ A;  1A1J A;  2EPP A;  2JP9 A;  2EM7 A;  4R2C A;  2EN7 A;  2ENA A;  4F2J C;  4X9J A;  3EPJ A;  3EPH A;  2M9A A;  1A1K A;  1G2D C;  2DLQ A;  2YRH A;  2EOR A;  2LCE A;  2EM8 A;  2DMI A;  2EN3 A;  2CT1 A;  2LV2 A;  4GZN C;  2DLK A;  2R1F A;  1A1L A;  2MKN A;  5KL5 A;  2EM9 A;  3UK3 C;  1Z1B A;  2DGC A;  2EMI A;  2YSP A;  2LVH A;  4FK5 C;  4R2P A;  2LT7 A;  2RPC A;  2EOZ A;  3MHH C;  2EL6 A;  4R2D A;  1JK1 A;  2EOH A;  1A1I A;  1YUJ A;  1BB8 A;  1X6E A;  2EMY A;  1UBD C;  1F2I G;  2VRD A;  4F6M A;  2HGH A;  1YUI A;  2ELZ A;  1TN9 A;  2EOJ A;  1ZR9 A;  4R2E A;  2EN6 A;  2EOS A;  2D9H A;  2I13 A;  1A1G A;  2MKD A;  2EM5 A;  2MDG A;  2EMW A;  2YU8 A;  4IJD A;  4R2S A;  2EMF A;  1RMD A;  2EMZ A;  2YTJ A;  2CTD A;  2EPX A;  2EMX A;  2YTO A;  4R2Q A;  2EPU A;  4R2A A;  4F6N A;  3VHT B;  1B69 A;  2RSI A;  2YRK A;  3EPL A;  2YTI A;  2JPA A;  2YTN A;  2WCC 3;  2EL5 A;  1AAY A;  4IS1 C;  2J7J A;  5KL3 A;  5KL2 A;  2PRT A;  2YTQ A;  2EOX A;  2NAB A;  2EOO A;  5KL4 A;  1ZAA C;  2EOM A;  2YTD A;  1TF3 A;  1ZU1 A;  2EE8 A;  2LO3 A;  2EML A;  2WBU A;  1X5W A;  2EM6 A;  2YU5 A;  1JK2 A;  1MEY C;  1WJP A;  1X3C A;  1G2F C;  2EMC A;  2EP3 A;  1KJK A;  4R2R A;  2YRM A;  1NCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...