2ELZA

Solution structure of the 17th zf-c2h2 domain from human zinc finger protein 224
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSVEKPYKCEDCGKGYNRRLNLDMHQRVHMGEKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 17th zf-C2H2 domain from human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2elzA01
2EL4A 2YTJA 4R2QA 2J7JA 1A1LA 2EMKA 2EMZA 2EMLA 4F2JC 3EPJA 2WCC3 2EM4A 2DMIA 2YTOA 2LO3A 4R2CA 1A1HA 2EM0A 2EOOA 2MDGA 2LT7A 2EM8A 2EPUA 2YRMA 4F6NA 2VRDA 2EL5A 2ELZA 2ENHA 2R1FA 2GHFA 3EPKA 3M99B 2EOYA 2YTGA 2EN6A 1JK2A 2EMYA 2EQ1A 2YRHA 2EOMA 2EM2A 5KL4A 1MEYC 5KL6A 2ENAA 2ENCA 2EMCA 1X6HA 1JK1A 2EM6A 1BBOA 5KL7A 1LLMC 1X6FA 2MKDA 2RPCA 2EN8A 2HGHA 2DLQA 2GLIA 1WJPA 4R2DA 2EOQA 2EL6A 1AAYA 2PRTA 4M9VC 2EPXA 1F2IG 2EM3A 1A1JA 1TF3A 4X9JA 1G2DC 4F6MA 2RSIA 3UK3C 4R2AA 2EOFA 1DGCA 2EE8A 2YTPA 1YUJA 2EMHA 2EM7A 5KL3A 4IS1C 2EOEA 2EMXA 2YTQA 2EPRA 2ADRA 1KJKA 2A25A 1A1GA 4R2EA 5KL2A 2CSHA 2LVHA 2JPAA 2CTDA 2EMFA 2EPPA 2ELYA 1Z1BA 1RMDA 3MHSC 2M9AA 2LCEA 2DLKA 2D9HA 2EJ4A 2YTIA 1A1KA 2EN1A 2EOIA 1B69A 2JP9A 1TF6A 2EMGA 2MKNA 4FK5C 3EPLA 2YTEA 4WSGA 2EOJA 2LV2A 1YUIA 2YU5A 1X5WA 2CT1A 2EOZA 2EQ0A 2EM9A 1ZR9A 2WBUA 1UBDC 4R2PA 1NCSA 1X6EA 1YSAC 4R2RA 1X3CA 2YSPA 2EORA 2BB8A 2EOXA 2EOHA 4GZNC 2YTFA 2I13A 2NABA 1BB8A 2EPCA 2EN2A 2EMAA 2EMIA 2EPAA 2YTNA 2EMWA 2EN3A 2DGCA 5KL5A 2YSOA 3MHHC 3EPHA 1UN6B 2EM5A 2EN7A 1A1FA 2YRKA 2WBSA 1ZU1A 2YTDA 2EN4A 1A1IA 1ZAAC 1P47A 1TN9A 2YU8A 2EQ3A 4IJDA 2E72A 2DRPA 2EMBA 2WBTA 2EPZA 1G2FC 2EOSA 2EP3A 3VHTB 4R2SA
chains in the Genus database with same CATH superfamily
4R2QA 5F3WA 4F9AB 2EMZA 4F2JC 2WCC3 1FJGE 1PKPA 1T38A 2EM0A 4R03A 4DV1E 4LF9E 4F6NA 2ENHA 4F54A 1N34E 2DIXA 1GTKA 4O24A 3M99B 3THNA 4B3TE 2MC5A 2KOUA 4WFTA 4LFBE 2EOMA 2HJJA 2R76A 5KL4A 4M0VA 1AH5A 5AE3A 4JI1E 4X8WA 2EMCA 5A2QC 1X6HA 1JK1A 3ADJA 2EM6A 2ODRC 1UILA 4ZYHA 2VF1A 4K0KE 2MKDA 2GPIA 2V89A 3K6QA 4WXCA 1AAYA 2EPXA 2L8TA 1TF3A 2NA2A 3BIDA 2RS6A 4X9JA 3UK3C 4GKJE 4R2AA 3HPSA 1YUJA 2ODRD 2B9DA 2EM7A 4DMIA 2V88A 5KL3A 2YPNA 2A25A 4KHPE 1QU6A 4F9CB 2DLKA 2EJ4A 3HTXA 4P78A 5A69A 4L8NA 1B69A 2JP9A 4KWYA 2FGGA 4NXNE 4WSGA 1YUIA 2LV2A 4GEQB 4DV0E 2YU5A 1IQOA 2CT1A 5IV8B 2WBUA 3J80C 3LMLA 5AE1A 1EH7A 1X47A 4M2ZA 3J81C 4LFCE 2MDRA 1XNQE 2YTFA 4DV7E 2B7TA 1T39A 4DV5E 1BB8A 3VYXA 2EPAA 2UXCE 3QG5C 3MSWA 3EPHA 4DV3E 1PJSA 1GZ6A 1YYWA 3VYYA 3DF6A 3OMLA 2YU8A 1YYOA 4JI6E 4P7DA 2DRPA 2LMZA 3VHTB 2I9IA 1L4SA 2M7QA 1A1LA 2UXDE 2EMKA 4O43A 2JY9A 1N3GA 3H09A 2EM4A 1QNTA 4WSPA 2LO3A 1A1HA 4MLVA 2LT7A 4B3ME 3J7AG 4JYAE 2DMYA 2UUBE 2M4IA 2YRMA 1DI2A 2R1FA 1BBGA 3EPKA 2EOYA 2ZM6E 2EN6A 1XMQE 2EMYA 2L6MA 3OTOE 5IXMB 5KL6A 2ENAA 4DR6E 1HR0E 2LTSA 2N8XA 4JI4E 5LLQA 3KZYA 4ZYEA 1SFEA 2F8BA 2JYAA 2DLQA 2B3TB 3C4BA 1A1JA 5LL6R 2B7VA 2NUFA 1G2DC 3ECRA 2L2NA 2L3JA 1WHNA 4TUIA 2L2MA 2M1SA 4LFAE 2EMHA 4X66E 1XNRE 4IS1C 2EOEA 2EMXA 3BF2A 3JU0A 1KJKA 2JR1A 4DUYE 5IWAE 1HNXE 4JI0E 2JPAA 1XMOE 3ZOQB 1YYKA 1KYQA 2RQLA 2M9AA 2EPMX 2D9HA 2LRSA 4R8OA 2LJHA 1TF6A 2EMGA 2EPKX 4FK5C 2MKNA 2YTEA 2JOBA 1T4NA 4NXME 1PDAA 1X5WA 2EM9A 1NCSA 2N3GA 2Q8UA 2EOXA 2EOHA 5CFFE 3HXLA 4RH8A 1PJTA 4BMJA 2I13A 4LF7E 2JXPA 5AE2A 4DV2E 2EPCA 2EN2A 4B3SE 2YTNA 2EMWA 4N4RB 1FKAE 3MHHC 1UN6B 2EM5A 2EN7A 3HPZA 4LU9A 2LE2A 1YZ9A 2V8QB 5DNYA 1ZU1A 2YTDA 2VQFE 1IBKE 2G7HA 1X48A 4OX9E 1DQ3A 1STUA 4BC7A 2EMBA 2EPZA 2E1MA 4BBYA 2EL4A 2YTJA 3J7Yp 4LF4E 2LUQA 4O5GA 3KWRA 2EMLA 1ZBQA 3EPJA 2NUGA 3L00A 4R2CA 2E5LE 2LJUA 4WYQB 3ADLA 4DR7E 2EPLX 1EKZA 2UUCE 2GHFA 1MGTA 2HHHE 1IMUA 2EQ1A 4DR1E 3TQMA 2NUEA 4OOGC 1MEYC 2V87A 1BBOA 2RTXA 2UXBE 5KL7A 3C6KA 1LLMC 2RPCA 2EOQA 3AV0A 2PRTA 2FV4B 2EM3A 4F6MA 2EOFA 2YTPA 3BGHA 2JOXA 4RHBB 4WPYA 3HQ1A 1YPNA 1T4OA 2LBSB 2H36X 2EPNA 4DR3E 1PJQA 5AC5A 5KL2A 2V86A 3IWBA 2EMFA 2YT4A 4WXDA 2ELYA 1Z1BA 3MHSC 3RMPA 4X64E 2DSYA 2YTIA 3ADIA 4DR5E 2EN1A 5A6KA 4HEIA 2VE7C 4BCAA 5FLXC 2EOJA 4ZYGA 5LMNE 2EOZA 1UBDC 1RQ0A 5TSEA 1X6EA 2L92A 3P1XA 4I8OA 1YSAC 3T1HE 4R2RA 3EQ1A 3ADGA 3IWCA 4DUZE 4Q35B 4LF8E 2NABA 4LTYA 4MLQA 2F4VE 2EMAA 2EMIA 3KZZA 2DGCA 1NEIA 5KL5A 4DR2E 2LTRA 3T1YE 2YSOA 1IBLE 5LMUE 5BR8E 1J5EE 3VK6A 4TUGA 2YRKA 2KONA 1N36E 1ZAAC 2LUPB 1SR9A 1T4LB 1P47A 1TN9A 3JAMC 3FIGA 4B3RE 2KHXA 2E72A 2WBTA 4YY3E 1G2FC 2EP3A 5A6BD 2J7JA 2K7IA 4JI8E 2DMIA 2YTOA 2JWOA 2N3HA 4HTGA 2EOOA 2MDGA 1N32E 1IQSA 2DB2A 2EM8A 2EPUA 2VRDA 4M30A 1J26A 2EL5A 4BS9A 2ELZA 4BC9A 5IT9C 1YFHA 3THOB 2YTGA 1EH6A 1JK2A 2YRHA 2YZTA 3JTZA 4LF5E 2V85A 2EM2A 4DV4E 4X65E 2ENCA 2JVAA 3IWDA 4DV6E 1O0WA 3C4TA 2FTXB 4JV5E 1HNWE 1X6FA 4DR4E 2EN8A 4BHBA 2HGHA 2GLIA 1WJPA 4R2DA 5A6JA 2EL6A 4L5NC 5A6AA 4M9VC 2L3CA 1F2IG 4ZYDA 2RSIA 4NHRA 2VQEE 4NZVA 1WRJA 1DGCA 2EE8A 2HC5A 2UUAE 2V83A 2RS7A 2YTQA 2EPRA 2ADRA 2WZOA 5A6BA 1A1GA 4R2EA 2CSHA 2LVHA 2RSMA 4JI7E 2CTDA 4X62E 1RC7A 4LF6E 2EPPA 4O4KA 1N33E 1RMDA 2LCEA 3AUZA 5AASA 1A1KA 3F6GA 2EOIA 5T6JA 3C6MA 3EPLA 4GKKE 4JI2E 4WX9A 4AQYE 1IBME 2K4VA 2EQ0A 4KZSA 4JI5E 1ZR9A 4R2PA 1WXRA 4BHCA 1WHQA 1X3CA 2EZ6A 2YSPA 2BB8A 2EORA 4DKKA 4GZNC 1EH8A 1HNZE 1GQEA 5ADZA 2IHR1 4JI3E 5AC4A 2EN3A 1X49A 4Q28A 2MC6A 1A1FA 3BBGA 3LLHA 2WBSA 2EN4A 1A1IA 2CPNA 2EPOA 2YWQA 4F9BB 2EQ3A 4YHHE 1I94E 2L33A 4IJDA 1UHZA 2L2KB 2UU9E 1ZBTA 4J8ZA 3F6HA 2BBGA 2EOSA 2EWLA 3DJWA 4R2SA
chains in the Genus database with same CATH topology
2EL4A 2YTJA 4R2QA 2J7JA 1A1LA 2EMKA 2EMZA 2EMLA 4F2JC 3EPJA 2WCC3 2EM4A 2DMIA 2YTOA 2LO3A 4R2CA 1A1HA 2EM0A 2EOOA 2MDGA 2LT7A 2EM8A 2EPUA 2YRMA 4F6NA 2VRDA 2EL5A 2ELZA 2ENHA 2R1FA 2GHFA 3EPKA 3M99B 2EOYA 2YTGA 2EN6A 1JK2A 2EMYA 2EQ1A 2YRHA 2EOMA 2EM2A 5KL4A 1MEYC 5KL6A 2ENAA 2ENCA 2EMCA 1X6HA 1JK1A 2EM6A 1BBOA 5KL7A 1LLMC 1X6FA 2MKDA 2RPCA 2EN8A 2HGHA 2DLQA 2GLIA 1WJPA 4R2DA 2EOQA 2EL6A 1AAYA 2PRTA 4M9VC 2EPXA 1F2IG 2EM3A 1A1JA 1TF3A 4X9JA 1G2DC 4F6MA 2RSIA 3UK3C 4R2AA 2EOFA 1DGCA 2EE8A 2YTPA 1YUJA 2EMHA 2EM7A 5KL3A 4IS1C 2EOEA 2EMXA 2YTQA 2EPRA 2ADRA 1KJKA 2A25A 1A1GA 4R2EA 5KL2A 2CSHA 2LVHA 2JPAA 2CTDA 2EMFA 2EPPA 2ELYA 1Z1BA 1RMDA 3MHSC 2M9AA 2LCEA 2DLKA 2D9HA 2EJ4A 2YTIA 1A1KA 2EN1A 2EOIA 1B69A 2JP9A 1TF6A 2EMGA 2MKNA 4FK5C 3EPLA 2YTEA 4WSGA 2EOJA 2LV2A 1YUIA 2YU5A 1X5WA 2CT1A 2EOZA 2EQ0A 2EM9A 1ZR9A 2WBUA 1UBDC 4R2PA 1NCSA 1X6EA 1YSAC 4R2RA 1X3CA 2YSPA 2EORA 2BB8A 2EOXA 2EOHA 4GZNC 2YTFA 2I13A 2NABA 1BB8A 2EPCA 2EN2A 2EMAA 2EMIA 2EPAA 2YTNA 2EMWA 2EN3A 2DGCA 5KL5A 2YSOA 3MHHC 3EPHA 1UN6B 2EM5A 2EN7A 1A1FA 2YRKA 2WBSA 1ZU1A 2YTDA 2EN4A 1A1IA 1ZAAC 1P47A 1TN9A 2YU8A 2EQ3A 4IJDA 2E72A 2DRPA 2EMBA 2WBTA 2EPZA 1G2FC 2EOSA 2EP3A 3VHTB 4R2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL4 A;  2YTJ A;  4R2Q A;  2J7J A;  1A1L A;  2EMK A;  2EMZ A;  2EML A;  4F2J C;  3EPJ A;  2WCC 3;  2EM4 A;  2DMI A;  2YTO A;  2LO3 A;  4R2C A;  1A1H A;  2EM0 A;  2EOO A;  2MDG A;  2LT7 A;  2EM8 A;  2EPU A;  2YRM A;  4F6N A;  2VRD A;  2EL5 A;  2ELZ A;  2ENH A;  2R1F A;  2GHF A;  3EPK A;  3M99 B;  2EOY A;  2YTG A;  2EN6 A;  1JK2 A;  2EMY A;  2EQ1 A;  2YRH A;  2EOM A;  2EM2 A;  5KL4 A;  1MEY C;  5KL6 A;  2ENA A;  2ENC A;  2EMC A;  1X6H A;  1JK1 A;  2EM6 A;  1BBO A;  5KL7 A;  1LLM C;  1X6F A;  2MKD A;  2RPC A;  2EN8 A;  2HGH A;  2DLQ A;  2GLI A;  1WJP A;  4R2D A;  2EOQ A;  2EL6 A;  1AAY A;  2PRT A;  4M9V C;  2EPX A;  1F2I G;  2EM3 A;  1A1J A;  1TF3 A;  4X9J A;  1G2D C;  4F6M A;  2RSI A;  3UK3 C;  4R2A A;  2EOF A;  1DGC A;  2EE8 A;  2YTP A;  1YUJ A;  2EMH A;  2EM7 A;  5KL3 A;  4IS1 C;  2EOE A;  2EMX A;  2YTQ A;  2EPR A;  2ADR A;  1KJK A;  2A25 A;  1A1G A;  4R2E A;  5KL2 A;  2CSH A;  2LVH A;  2JPA A;  2CTD A;  2EMF A;  2EPP A;  2ELY A;  1Z1B A;  1RMD A;  3MHS C;  2M9A A;  2LCE A;  2DLK A;  2D9H A;  2EJ4 A;  2YTI A;  1A1K A;  2EN1 A;  2EOI A;  1B69 A;  2JP9 A;  1TF6 A;  2EMG A;  2MKN A;  4FK5 C;  3EPL A;  2YTE A;  4WSG A;  2EOJ A;  2LV2 A;  1YUI A;  2YU5 A;  1X5W A;  2CT1 A;  2EOZ A;  2EQ0 A;  2EM9 A;  1ZR9 A;  2WBU A;  1UBD C;  4R2P A;  1NCS A;  1X6E A;  1YSA C;  4R2R A;  1X3C A;  2YSP A;  2EOR A;  2BB8 A;  2EOX A;  2EOH A;  4GZN C;  2YTF A;  2I13 A;  2NAB A;  1BB8 A;  2EPC A;  2EN2 A;  2EMA A;  2EMI A;  2EPA A;  2YTN A;  2EMW A;  2EN3 A;  2DGC A;  5KL5 A;  2YSO A;  3MHH C;  3EPH A;  1UN6 B;  2EM5 A;  2EN7 A;  1A1F A;  2YRK A;  2WBS A;  1ZU1 A;  2YTD A;  2EN4 A;  1A1I A;  1ZAA C;  1P47 A;  1TN9 A;  2YU8 A;  2EQ3 A;  4IJD A;  2E72 A;  2DRP A;  2EMB A;  2WBT A;  2EPZ A;  1G2F C;  2EOS A;  2EP3 A;  3VHT B;  4R2S A; 
#chains in the Genus database with same CATH topology
 4R2Q A;  5F3W A;  4F9A B;  2EMZ A;  4F2J C;  2WCC 3;  1FJG E;  1PKP A;  1T38 A;  2EM0 A;  4R03 A;  4DV1 E;  4LF9 E;  4F6N A;  2ENH A;  4F54 A;  1N34 E;  2DIX A;  1GTK A;  4O24 A;  3M99 B;  3THN A;  4B3T E;  2MC5 A;  2KOU A;  4WFT A;  4LFB E;  2EOM A;  2HJJ A;  2R76 A;  5KL4 A;  4M0V A;  1AH5 A;  5AE3 A;  4JI1 E;  4X8W A;  2EMC A;  5A2Q C;  1X6H A;  1JK1 A;  3ADJ A;  2EM6 A;  2ODR C;  1UIL A;  4ZYH A;  2VF1 A;  4K0K E;  2MKD A;  2GPI A;  2V89 A;  3K6Q A;  4WXC A;  1AAY A;  2EPX A;  2L8T A;  1TF3 A;  2NA2 A;  3BID A;  2RS6 A;  4X9J A;  3UK3 C;  4GKJ E;  4R2A A;  3HPS A;  1YUJ A;  2ODR D;  2B9D A;  2EM7 A;  4DMI A;  2V88 A;  5KL3 A;  2YPN A;  2A25 A;  4KHP E;  1QU6 A;  4F9C B;  2DLK A;  2EJ4 A;  3HTX A;  4P78 A;  5A69 A;  4L8N A;  1B69 A;  2JP9 A;  4KWY A;  2FGG A;  4NXN E;  4WSG A;  1YUI A;  2LV2 A;  4GEQ B;  4DV0 E;  2YU5 A;  1IQO A;  2CT1 A;  5IV8 B;  2WBU A;  3J80 C;  3LML A;  5AE1 A;  1EH7 A;  1X47 A;  4M2Z A;  3J81 C;  4LFC E;  2MDR A;  1XNQ E;  2YTF A;  4DV7 E;  2B7T A;  1T39 A;  4DV5 E;  1BB8 A;  3VYX A;  2EPA A;  2UXC E;  3QG5 C;  3MSW A;  3EPH A;  4DV3 E;  1PJS A;  1GZ6 A;  1YYW A;  3VYY A;  3DF6 A;  3OML A;  2YU8 A;  1YYO A;  4JI6 E;  4P7D A;  2DRP A;  2LMZ A;  3VHT B;  2I9I A;  1L4S A;  2M7Q A;  1A1L A;  2UXD E;  2EMK A;  4O43 A;  2JY9 A;  1N3G A;  3H09 A;  2EM4 A;  1QNT A;  4WSP A;  2LO3 A;  1A1H A;  4MLV A;  2LT7 A;  4B3M E;  3J7A G;  4JYA E;  2DMY A;  2UUB E;  2M4I A;  2YRM A;  1DI2 A;  2R1F A;  1BBG A;  3EPK A;  2EOY A;  2ZM6 E;  2EN6 A;  1XMQ E;  2EMY A;  2L6M A;  3OTO E;  5IXM B;  5KL6 A;  2ENA A;  4DR6 E;  1HR0 E;  2LTS A;  2N8X A;  4JI4 E;  5LLQ A;  3KZY A;  4ZYE A;  1SFE A;  2F8B A;  2JYA A;  2DLQ A;  2B3T B;  3C4B A;  1A1J A;  5LL6 R;  2B7V A;  2NUF A;  1G2D C;  3ECR A;  2L2N A;  2L3J A;  1WHN A;  4TUI A;  2L2M A;  2M1S A;  4LFA E;  2EMH A;  4X66 E;  1XNR E;  4IS1 C;  2EOE A;  2EMX A;  3BF2 A;  3JU0 A;  1KJK A;  2JR1 A;  4DUY E;  5IWA E;  1HNX E;  4JI0 E;  2JPA A;  1XMO E;  3ZOQ B;  1YYK A;  1KYQ A;  2RQL A;  2M9A A;  2EPM X;  2D9H A;  2LRS A;  4R8O A;  2LJH A;  1TF6 A;  2EMG A;  2EPK X;  4FK5 C;  2MKN A;  2YTE A;  2JOB A;  1T4N A;  4NXM E;  1PDA A;  1X5W A;  2EM9 A;  1NCS A;  2N3G A;  2Q8U A;  2EOX A;  2EOH A;  5CFF E;  3HXL A;  4RH8 A;  1PJT A;  4BMJ A;  2I13 A;  4LF7 E;  2JXP A;  5AE2 A;  4DV2 E;  2EPC A;  2EN2 A;  4B3S E;  2YTN A;  2EMW A;  4N4R B;  1FKA E;  3MHH C;  1UN6 B;  2EM5 A;  2EN7 A;  3HPZ A;  4LU9 A;  2LE2 A;  1YZ9 A;  2V8Q B;  5DNY A;  1ZU1 A;  2YTD A;  2VQF E;  1IBK E;  2G7H A;  1X48 A;  4OX9 E;  1DQ3 A;  1STU A;  4BC7 A;  2EMB A;  2EPZ A;  2E1M A;  4BBY A;  2EL4 A;  2YTJ A;  3J7Y p;  4LF4 E;  2LUQ A;  4O5G A;  3KWR A;  2EML A;  1ZBQ A;  3EPJ A;  2NUG A;  3L00 A;  4R2C A;  2E5L E;  2LJU A;  4WYQ B;  3ADL A;  4DR7 E;  2EPL X;  1EKZ A;  2UUC E;  2GHF A;  1MGT A;  2HHH E;  1IMU A;  2EQ1 A;  4DR1 E;  3TQM A;  2NUE A;  4OOG C;  1MEY C;  2V87 A;  1BBO A;  2RTX A;  2UXB E;  5KL7 A;  3C6K A;  1LLM C;  2RPC A;  2EOQ A;  3AV0 A;  2PRT A;  2FV4 B;  2EM3 A;  4F6M A;  2EOF A;  2YTP A;  3BGH A;  2JOX A;  4RHB B;  4WPY A;  3HQ1 A;  1YPN A;  1T4O A;  2LBS B;  2H36 X;  2EPN A;  4DR3 E;  1PJQ A;  5AC5 A;  5KL2 A;  2V86 A;  3IWB A;  2EMF A;  2YT4 A;  4WXD A;  2ELY A;  1Z1B A;  3MHS C;  3RMP A;  4X64 E;  2DSY A;  2YTI A;  3ADI A;  4DR5 E;  2EN1 A;  5A6K A;  4HEI A;  2VE7 C;  4BCA A;  5FLX C;  2EOJ A;  4ZYG A;  5LMN E;  2EOZ A;  1UBD C;  1RQ0 A;  5TSE A;  1X6E A;  2L92 A;  3P1X A;  4I8O A;  1YSA C;  3T1H E;  4R2R A;  3EQ1 A;  3ADG A;  3IWC A;  4DUZ E;  4Q35 B;  4LF8 E;  2NAB A;  4LTY A;  4MLQ A;  2F4V E;  2EMA A;  2EMI A;  3KZZ A;  2DGC A;  1NEI A;  5KL5 A;  4DR2 E;  2LTR A;  3T1Y E;  2YSO A;  1IBL E;  5LMU E;  5BR8 E;  1J5E E;  3VK6 A;  4TUG A;  2YRK A;  2KON A;  1N36 E;  1ZAA C;  2LUP B;  1SR9 A;  1T4L B;  1P47 A;  1TN9 A;  3JAM C;  3FIG A;  4B3R E;  2KHX A;  2E72 A;  2WBT A;  4YY3 E;  1G2F C;  2EP3 A;  5A6B D;  2J7J A;  2K7I A;  4JI8 E;  2DMI A;  2YTO A;  2JWO A;  2N3H A;  4HTG A;  2EOO A;  2MDG A;  1N32 E;  1IQS A;  2DB2 A;  2EM8 A;  2EPU A;  2VRD A;  4M30 A;  1J26 A;  2EL5 A;  4BS9 A;  2ELZ A;  4BC9 A;  5IT9 C;  1YFH A;  3THO B;  2YTG A;  1EH6 A;  1JK2 A;  2YRH A;  2YZT A;  3JTZ A;  4LF5 E;  2V85 A;  2EM2 A;  4DV4 E;  4X65 E;  2ENC A;  2JVA A;  3IWD A;  4DV6 E;  1O0W A;  3C4T A;  2FTX B;  4JV5 E;  1HNW E;  1X6F A;  4DR4 E;  2EN8 A;  4BHB A;  2HGH A;  2GLI A;  1WJP A;  4R2D A;  5A6J A;  2EL6 A;  4L5N C;  5A6A A;  4M9V C;  2L3C A;  1F2I G;  4ZYD A;  2RSI A;  4NHR A;  2VQE E;  4NZV A;  1WRJ A;  1DGC A;  2EE8 A;  2HC5 A;  2UUA E;  2V83 A;  2RS7 A;  2YTQ A;  2EPR A;  2ADR A;  2WZO A;  5A6B A;  1A1G A;  4R2E A;  2CSH A;  2LVH A;  2RSM A;  4JI7 E;  2CTD A;  4X62 E;  1RC7 A;  4LF6 E;  2EPP A;  4O4K A;  1N33 E;  1RMD A;  2LCE A;  3AUZ A;  5AAS A;  1A1K A;  3F6G A;  2EOI A;  5T6J A;  3C6M A;  3EPL A;  4GKK E;  4JI2 E;  4WX9 A;  4AQY E;  1IBM E;  2K4V A;  2EQ0 A;  4KZS A;  4JI5 E;  1ZR9 A;  4R2P A;  1WXR A;  4BHC A;  1WHQ A;  1X3C A;  2EZ6 A;  2YSP A;  2BB8 A;  2EOR A;  4DKK A;  4GZN C;  1EH8 A;  1HNZ E;  1GQE A;  5ADZ A;  2IHR 1;  4JI3 E;  5AC4 A;  2EN3 A;  1X49 A;  4Q28 A;  2MC6 A;  1A1F A;  3BBG A;  3LLH A;  2WBS A;  2EN4 A;  1A1I A;  2CPN A;  2EPO A;  2YWQ A;  4F9B B;  2EQ3 A;  4YHH E;  1I94 E;  2L33 A;  4IJD A;  1UHZ A;  2L2K B;  2UU9 E;  1ZBT A;  4J8Z A;  3F6H A;  2BBG A;  2EOS A;  2EWL A;  3DJW A;  4R2S A; 
#chains in the Genus database with same CATH homology
 2EL4 A;  2YTJ A;  4R2Q A;  2J7J A;  1A1L A;  2EMK A;  2EMZ A;  2EML A;  4F2J C;  3EPJ A;  2WCC 3;  2EM4 A;  2DMI A;  2YTO A;  2LO3 A;  4R2C A;  1A1H A;  2EM0 A;  2EOO A;  2MDG A;  2LT7 A;  2EM8 A;  2EPU A;  2YRM A;  4F6N A;  2VRD A;  2EL5 A;  2ELZ A;  2ENH A;  2R1F A;  2GHF A;  3EPK A;  3M99 B;  2EOY A;  2YTG A;  2EN6 A;  1JK2 A;  2EMY A;  2EQ1 A;  2YRH A;  2EOM A;  2EM2 A;  5KL4 A;  1MEY C;  5KL6 A;  2ENA A;  2ENC A;  2EMC A;  1X6H A;  1JK1 A;  2EM6 A;  1BBO A;  5KL7 A;  1LLM C;  1X6F A;  2MKD A;  2RPC A;  2EN8 A;  2HGH A;  2DLQ A;  2GLI A;  1WJP A;  4R2D A;  2EOQ A;  2EL6 A;  1AAY A;  2PRT A;  4M9V C;  2EPX A;  1F2I G;  2EM3 A;  1A1J A;  1TF3 A;  4X9J A;  1G2D C;  4F6M A;  2RSI A;  3UK3 C;  4R2A A;  2EOF A;  1DGC A;  2EE8 A;  2YTP A;  1YUJ A;  2EMH A;  2EM7 A;  5KL3 A;  4IS1 C;  2EOE A;  2EMX A;  2YTQ A;  2EPR A;  2ADR A;  1KJK A;  2A25 A;  1A1G A;  4R2E A;  5KL2 A;  2CSH A;  2LVH A;  2JPA A;  2CTD A;  2EMF A;  2EPP A;  2ELY A;  1Z1B A;  1RMD A;  3MHS C;  2M9A A;  2LCE A;  2DLK A;  2D9H A;  2EJ4 A;  2YTI A;  1A1K A;  2EN1 A;  2EOI A;  1B69 A;  2JP9 A;  1TF6 A;  2EMG A;  2MKN A;  4FK5 C;  3EPL A;  2YTE A;  4WSG A;  2EOJ A;  2LV2 A;  1YUI A;  2YU5 A;  1X5W A;  2CT1 A;  2EOZ A;  2EQ0 A;  2EM9 A;  1ZR9 A;  2WBU A;  1UBD C;  4R2P A;  1NCS A;  1X6E A;  1YSA C;  4R2R A;  1X3C A;  2YSP A;  2EOR A;  2BB8 A;  2EOX A;  2EOH A;  4GZN C;  2YTF A;  2I13 A;  2NAB A;  1BB8 A;  2EPC A;  2EN2 A;  2EMA A;  2EMI A;  2EPA A;  2YTN A;  2EMW A;  2EN3 A;  2DGC A;  5KL5 A;  2YSO A;  3MHH C;  3EPH A;  1UN6 B;  2EM5 A;  2EN7 A;  1A1F A;  2YRK A;  2WBS A;  1ZU1 A;  2YTD A;  2EN4 A;  1A1I A;  1ZAA C;  1P47 A;  1TN9 A;  2YU8 A;  2EQ3 A;  4IJD A;  2E72 A;  2DRP A;  2EMB A;  2WBT A;  2EPZ A;  1G2F C;  2EOS A;  2EP3 A;  3VHT B;  4R2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...