2YSOA

Solution structure of the c2h2 type zinc finger (region 656-688) of human zinc finger protein 95 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 95 homolog
publication title Solution structure of the C2H2 type zinc finger (region 656-688) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ysoA01
1ZR9A 2EN1A 2YTJA 2MDGA 5KL3A 2WBUA 4F2JC 4R2QA 3UK3C 5KL5A 1KJKA 2EP3A 1G2FC 2EM9A 2EN8A 2EL6A 1YUJA 2YTEA 2EN4A 4R2RA 2EM4A 2CTDA 2YU8A 2YRMA 1A1HA 2EMKA 1NCSA 2EM0A 2YU5A 1JK2A 2JPAA 1X3CA 2MKDA 2YTIA 2PRTA 2ADRA 1X6EA 2EPXA 1JK1A 1UN6B 4F6MA 2EMGA 2DLKA 2EMBA 2EOFA 1B69A 2GHFA 1ZAAC 2EOEA 2ENHA 1P47A 2RSIA 2EPRA 2EMHA 2EMXA 1X5WA 2EMCA 2EMZA 2LT7A 2R1FA 2DLQA 3MHHC 2EOHA 2LCEA 4WSGA 3M99B 1X6HA 2EPZA 2MKNA 2WBTA 3EPKA 2YRKA 2CSHA 2EN2A 1TF3A 1YSAC 2EOQA 2EQ0A 1AAYA 2EMLA 5KL2A 2EM7A 2EPCA 3EPJA 2EPUA 3EPHA 2CT1A 2YSOA 1A1LA 4R2DA 2YTGA 2HGHA 2ENCA 2EOZA 1DGCA 2WBSA 2EOXA 1WJPA 2YSPA 4R2EA 2EN7A 1YUIA 2WCC3 2EM3A 2D9HA 2EPAA 4F6NA 2EJ4A 2EMWA 1TF6A 2EN3A 2EORA 2JP9A 2EOYA 1A1KA 2EE8A 2LO3A 4M9VC 2GLIA 5KL4A 5KL7A 2I13A 4R2PA 2EOJA 2LVHA 2DGCA 2DRPA 2EPPA 2RPCA 2A25A 2LV2A 4FK5C 2E72A 2EN6A 4R2AA 2NABA 2YTFA 1A1IA 1BBOA 2EQ1A 2EMYA 3MHSC 2YTQA 1BB8A 1Z1BA 2BB8A 4R2SA 2ELZA 2EOSA 1A1GA 2EQ3A 2EMFA 2YTDA 1RMDA 2EM2A 4R2CA 1LLMC 1A1JA 2ENAA 2EOMA 2YTOA 2YTNA 1UBDC 1G2DC 5KL6A 2M9AA 3VHTB 2VRDA 2DMIA 2EMIA 1ZU1A 2ELYA 4GZNC 1TN9A 2EM5A 4IS1C 2YRHA 4IJDA 1MEYC 2EOOA 1A1FA 2EM8A 2YTPA 1X6FA 2J7JA 2EL4A 2EOIA 3EPLA 4X9JA 2EMAA 2EM6A 1F2IG 2EL5A
chains in the Genus database with same CATH superfamily
1J5EE 4JI7E 5KL5A 1KJKA 2EP3A 3J80C 2EN8A 2YTEA 2EN4A 4R2RA 4LF7E 4I8OA 1PKPA 4ZYEA 2HJJA 2EMKA 1FJGE 3C6KA 4B3ME 3AUZA 2ADRA 1X6EA 2EPXA 2L2NA 2JY9A 1DQ3A 2VQFE 4BC9A 2LJUA 2EMGA 2EMBA 4BC7A 2WZOA 1B69A 4KWYA 4DV6E 1XMOE 2LE2A 4TUGA 1P47A 2EPRA 2EMXA 2EMCA 2EMZA 4KHPE 1X48A 2LT7A 1RC7A 3MHHC 1WXRA 2LCEA 4M0VA 4TUIA 2EPZA 2M4IA 2MKNA 3EPKA 2YRKA 3DF6A 3OMLA 3HTXA 4JV5E 3HQ1A 2IHR1 2EM7A 3ZOQB 2LMZA 2CT1A 5AC4A 3HXLA 2WBSA 4LF5E 2V89A 2BBGA 1YUIA 1IBKE 2EN3A 1X49A 2DMYA 1STUA 2E5LE 2LO3A 5LMNE 2V8QB 4OOGC 2EPOA 2LVHA 2DGCA 2KONA 2V83A 4O43A 2HHHE 2EPPA 4JI0E 2L6MA 1YZ9A 2EZ6A 3OTOE 3F6GA 4FK5C 2LUQA 5LMUE 4DV4E 4O4KA 2YTFA 5F3WA 1BBOA 4DR4E 2UUBE 5ADZA 5TSEA 1PJQA 2FGGA 2VE7C 4F9AB 2EMFA 2YTDA 2ENAA 1UBDC 2M9AA 4WSPA 2YZTA 4K0KE 2DMIA 2M1SA 4WXCA 2ELYA 1AH5A 2R76A 2EM5A 2YRHA 4IJDA 4DKKA 3ADIA 4DUYE 2EOOA 2YTPA 2EWLA 1T4OA 3KZYA 2NUGA 4L5NC 2H36X 2EMAA 4LF8E 4F9BB 2YTJA 2WBUA 4F2JC 4BS9A 5FLXC 2N3GA 2Q8UA 1QU6A 5LL6R 5IXMB 1HNZE 2L33A 3H09A 1J26A 2CTDA 4YHHE 4KZSA 1NCSA 5A69A 2EM0A 4BCAA 1X3CA 2ODRC 5DNYA 2PRTA 4R8OA 3LLHA 1IBME 1UN6B 5A6BD 4F6MA 2V88A 2GPIA 2DLKA 3ECRA 2VQEE 1N3GA 4JI6E 4WPYA 2ENHA 2RSIA 1NEIA 2EMHA 3AV0A 4LF9E 2R1FA 1IMUA 4NZVA 2DLQA 4X65E 2B7TA 5CFFE 1X6HA 1YYKA 1L4SA 2ZM6E 4DV3E 1TF3A 3J7Yp 2JXPA 2EOQA 4MLQA 2EQ0A 1AAYA 2EMLA 3JAMC 3EPJA 2YSOA 4X66E 1A1LA 2YTGA 3VYXA 2HGHA 2LTRA 1DGCA 3J7AG 4DV5E 1SFEA 4B3RE 1UHZA 2EM3A 2D9HA 4JYAE 4WX9A 1HNWE 2RQLA 2UXDE 2EOYA 2V85A 2EE8A 1X47A 3J81C 1A1KA 2JYAA 1ZBQA 3ADLA 3BBGA 4LFCE 2MDRA 3K6QA 3T1YE 4BBYA 2NUFA 2JOXA 2A25A 3THOB 3FIGA 4DMIA 2L2KB 4OX9E 3C4TA 5LLQA 2NABA 3HPZA 4P7DA 4ZYHA 1BB8A 1Z1BA 4NHRA 2EOSA 1DI2A 2EQ3A 4R2CA 1A1JA 2EOMA 5AE2A 2YTOA 3F6HA 2FTXB 5KL6A 2L92A 2VRDA 2RSMA 2YWQA 1TN9A 4IS1C 3L00A 2L8TA 4LU9A 4BMJA 3C6MA 5A6BA 2EL4A 2L3JA 4B3TE 2EM6A 5KL3A 4DR3E 2EPLX 4F9CB 1O0WA 4BHBA 2G7HA 2EM9A 3LMLA 4HTGA 4R03A 2EL6A 2YT4A 3RMPA 1SR9A 2YRMA 4JI4E 1T38A 4RHBB 3VK6A 2YU5A 2LBSB 2L2MA 2MKDA 1EKZA 2N3HA 4LTYA 1ZBTA 1GZ6A 1UILA 4DV0E 2MC5A 4NXME 1T4NA 1XNQE 4GKJE 2F4VE 2GHFA 2YPNA 3P1XA 2EOEA 4M2ZA 1HR0E 1X5WA 2UU9E 4DV1E 2UUCE 2JOBA 2EOHA 3M99B 2WBTA 4LFAE 2ODRD 1YSAC 5AE3A 4LF6E 2VF1A 4M30A 1T4LB 2EPUA 5IWAE 3EPHA 2ENCA 2EOZA 2EOXA 1YYOA 2DIXA 1WJPA 1KYQA 5AC5A 2L3CA 4F6NA 2EPAA 2NUEA 4DUZE 2EMWA 5IT9C 1RQ0A 1EH8A 1TF6A 1XNRE 4M9VC 2M7QA 4O24A 3JU0A 4O5GA 2EOJA 4GEQB 1YYWA 5T6JA 1IQOA 4DR2E 2EPKX 4MLVA 5A2QC 4R2AA 1IBLE 1MGTA 2EPNA 5AE1A 1YFHA 2N8XA 2EQ1A 2EMYA 3MHSC 2YTQA 4WXDA 3KZZA 2BB8A 1PJSA 2V87A 1RMDA 4ZYDA 3JTZA 3QG5C 1PJTA 3VHTB 3EQ1A 5A6AA 2NA2A 4WYQB 2EMIA 2B7VA 5AASA 2RS6A 3ADGA 4GZNC 2LJHA 3BF2A 4Q35B 4Q28A 1BBGA 4WFTA 4DV2E 2J7JA 4X9JA 2UXCE 2F8BA 1ZR9A 1N33E 2EN1A 2MDGA 4ZYGA 2B3TB 4R2QA 4BHCA 3UK3C 1I94E 1G2FC 3BIDA 2LUPB 1YUJA 1YPNA 2EM4A 2YU8A 3KWRA 4X8WA 1A1HA 2I9IA 2JVAA 1JK2A 1EH6A 2JPAA 2CPNA 2YTIA 1N32E 4JI8E 1JK1A 3T1HE 1GQEA 4RH8A 2KOUA 5IV8B 1WRJA 2EOFA 4LFBE 2HC5A 2KHXA 2K4VA 1ZAAC 5BR8E 4X62E 2JR1A 5A6JA 3MSWA 4WSGA 1PDAA 2CSHA 1QNTA 4JI5E 2EN2A 4X64E 2LRSA 4YY3E 5KL2A 2EPCA 2UUAE 2B9DA 2FV4B 4R2DA 3BGHA 4R2EA 2YSPA 2EN7A 2WCC3 2EJ4A 3IWBA 2EORA 4B3SE 2JP9A 1T39A 1WHQA 4J8ZA 4JI3E 3THNA 2GLIA 5KL4A 2I13A 4N4RB 4R2PA 2DRPA 4GKKE 3IWDA 4DR5E 2RPCA 2LV2A 1FKAE 2RTXA 1EH7A 3C4BA 2E72A 4NXNE 4DR6E 2EN6A 1HNXE 2EPMX 3VYYA 1A1IA 4HEIA 2DB2A 2LTSA 3DJWA 2K7IA 2DSYA 1N36E 4JI2E 4R2SA 2ELZA 1N34E 2MC6A 1A1GA 2EM2A 2V86A 4P78A 1LLMC 4DR1E 3IWCA 2YTNA 1G2DC 4LF4E 1IQSA 1ZU1A 5A6KA 1XMQE 3ADJA 4AQYE 4F54A 1WHNA 2UXBE 2RS7A 1MEYC 4DR7E 2JWOA 3TQMA 1A1FA 4JI1E 2EM8A 4L8NA 2E1MA 1X6FA 1GTKA 2EOIA 3HPSA 3EPLA 4DV7E 5KL7A 1F2IG 2EL5A
chains in the Genus database with same CATH topology
1ZR9A 2EN1A 2YTJA 2MDGA 5KL3A 2WBUA 4F2JC 4R2QA 3UK3C 5KL5A 1KJKA 2EP3A 1G2FC 2EM9A 2EN8A 2EL6A 1YUJA 2YTEA 2EN4A 4R2RA 2EM4A 2CTDA 2YU8A 2YRMA 1A1HA 2EMKA 1NCSA 2EM0A 2YU5A 1JK2A 2JPAA 1X3CA 2MKDA 2YTIA 2PRTA 2ADRA 1X6EA 2EPXA 1JK1A 1UN6B 4F6MA 2EMGA 2DLKA 2EMBA 2EOFA 1B69A 2GHFA 1ZAAC 2EOEA 2ENHA 1P47A 2RSIA 2EPRA 2EMHA 2EMXA 1X5WA 2EMCA 2EMZA 2LT7A 2R1FA 2DLQA 3MHHC 2EOHA 2LCEA 4WSGA 3M99B 1X6HA 2EPZA 2MKNA 2WBTA 3EPKA 2YRKA 2CSHA 2EN2A 1TF3A 1YSAC 2EOQA 2EQ0A 1AAYA 2EMLA 5KL2A 2EM7A 2EPCA 3EPJA 2EPUA 3EPHA 2CT1A 2YSOA 1A1LA 4R2DA 2YTGA 2HGHA 2ENCA 2EOZA 1DGCA 2WBSA 2EOXA 1WJPA 2YSPA 4R2EA 2EN7A 1YUIA 2WCC3 2EM3A 2D9HA 2EPAA 4F6NA 2EJ4A 2EMWA 1TF6A 2EN3A 2EORA 2JP9A 2EOYA 1A1KA 2EE8A 2LO3A 4M9VC 2GLIA 5KL4A 5KL7A 2I13A 4R2PA 2EOJA 2LVHA 2DGCA 2DRPA 2EPPA 2RPCA 2A25A 2LV2A 4FK5C 2E72A 2EN6A 4R2AA 2NABA 2YTFA 1A1IA 1BBOA 2EQ1A 2EMYA 3MHSC 2YTQA 1BB8A 1Z1BA 2BB8A 4R2SA 2ELZA 2EOSA 1A1GA 2EQ3A 2EMFA 2YTDA 1RMDA 2EM2A 4R2CA 1LLMC 1A1JA 2ENAA 2EOMA 2YTOA 2YTNA 1UBDC 1G2DC 5KL6A 2M9AA 3VHTB 2VRDA 2DMIA 2EMIA 1ZU1A 2ELYA 4GZNC 1TN9A 2EM5A 4IS1C 2YRHA 4IJDA 1MEYC 2EOOA 1A1FA 2EM8A 2YTPA 1X6FA 2J7JA 2EL4A 2EOIA 3EPLA 4X9JA 2EMAA 2EM6A 1F2IG 2EL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR9 A;  2EN1 A;  2YTJ A;  2MDG A;  5KL3 A;  2WBU A;  4F2J C;  4R2Q A;  3UK3 C;  5KL5 A;  1KJK A;  2EP3 A;  1G2F C;  2EM9 A;  2EN8 A;  2EL6 A;  1YUJ A;  2YTE A;  2EN4 A;  4R2R A;  2EM4 A;  2CTD A;  2YU8 A;  2YRM A;  1A1H A;  2EMK A;  1NCS A;  2EM0 A;  2YU5 A;  1JK2 A;  2JPA A;  1X3C A;  2MKD A;  2YTI A;  2PRT A;  2ADR A;  1X6E A;  2EPX A;  1JK1 A;  1UN6 B;  4F6M A;  2EMG A;  2DLK A;  2EMB A;  2EOF A;  1B69 A;  2GHF A;  1ZAA C;  2EOE A;  2ENH A;  1P47 A;  2RSI A;  2EPR A;  2EMH A;  2EMX A;  1X5W A;  2EMC A;  2EMZ A;  2LT7 A;  2R1F A;  2DLQ A;  3MHH C;  2EOH A;  2LCE A;  4WSG A;  3M99 B;  1X6H A;  2EPZ A;  2MKN A;  2WBT A;  3EPK A;  2YRK A;  2CSH A;  2EN2 A;  1TF3 A;  1YSA C;  2EOQ A;  2EQ0 A;  1AAY A;  2EML A;  5KL2 A;  2EM7 A;  2EPC A;  3EPJ A;  2EPU A;  3EPH A;  2CT1 A;  2YSO A;  1A1L A;  4R2D A;  2YTG A;  2HGH A;  2ENC A;  2EOZ A;  1DGC A;  2WBS A;  2EOX A;  1WJP A;  2YSP A;  4R2E A;  2EN7 A;  1YUI A;  2WCC 3;  2EM3 A;  2D9H A;  2EPA A;  4F6N A;  2EJ4 A;  2EMW A;  1TF6 A;  2EN3 A;  2EOR A;  2JP9 A;  2EOY A;  1A1K A;  2EE8 A;  2LO3 A;  4M9V C;  2GLI A;  5KL4 A;  5KL7 A;  2I13 A;  4R2P A;  2EOJ A;  2LVH A;  2DGC A;  2DRP A;  2EPP A;  2RPC A;  2A25 A;  2LV2 A;  4FK5 C;  2E72 A;  2EN6 A;  4R2A A;  2NAB A;  2YTF A;  1A1I A;  1BBO A;  2EQ1 A;  2EMY A;  3MHS C;  2YTQ A;  1BB8 A;  1Z1B A;  2BB8 A;  4R2S A;  2ELZ A;  2EOS A;  1A1G A;  2EQ3 A;  2EMF A;  2YTD A;  1RMD A;  2EM2 A;  4R2C A;  1LLM C;  1A1J A;  2ENA A;  2EOM A;  2YTO A;  2YTN A;  1UBD C;  1G2D C;  5KL6 A;  2M9A A;  3VHT B;  2VRD A;  2DMI A;  2EMI A;  1ZU1 A;  2ELY A;  4GZN C;  1TN9 A;  2EM5 A;  4IS1 C;  2YRH A;  4IJD A;  1MEY C;  2EOO A;  1A1F A;  2EM8 A;  2YTP A;  1X6F A;  2J7J A;  2EL4 A;  2EOI A;  3EPL A;  4X9J A;  2EMA A;  2EM6 A;  1F2I G;  2EL5 A; 
#chains in the Genus database with same CATH topology
 1J5E E;  4JI7 E;  5KL5 A;  1KJK A;  2EP3 A;  3J80 C;  2EN8 A;  2YTE A;  2EN4 A;  4R2R A;  4LF7 E;  4I8O A;  1PKP A;  4ZYE A;  2HJJ A;  2EMK A;  1FJG E;  3C6K A;  4B3M E;  3AUZ A;  2ADR A;  1X6E A;  2EPX A;  2L2N A;  2JY9 A;  1DQ3 A;  2VQF E;  4BC9 A;  2LJU A;  2EMG A;  2EMB A;  4BC7 A;  2WZO A;  1B69 A;  4KWY A;  4DV6 E;  1XMO E;  2LE2 A;  4TUG A;  1P47 A;  2EPR A;  2EMX A;  2EMC A;  2EMZ A;  4KHP E;  1X48 A;  2LT7 A;  1RC7 A;  3MHH C;  1WXR A;  2LCE A;  4M0V A;  4TUI A;  2EPZ A;  2M4I A;  2MKN A;  3EPK A;  2YRK A;  3DF6 A;  3OML A;  3HTX A;  4JV5 E;  3HQ1 A;  2IHR 1;  2EM7 A;  3ZOQ B;  2LMZ A;  2CT1 A;  5AC4 A;  3HXL A;  2WBS A;  4LF5 E;  2V89 A;  2BBG A;  1YUI A;  1IBK E;  2EN3 A;  1X49 A;  2DMY A;  1STU A;  2E5L E;  2LO3 A;  5LMN E;  2V8Q B;  4OOG C;  2EPO A;  2LVH A;  2DGC A;  2KON A;  2V83 A;  4O43 A;  2HHH E;  2EPP A;  4JI0 E;  2L6M A;  1YZ9 A;  2EZ6 A;  3OTO E;  3F6G A;  4FK5 C;  2LUQ A;  5LMU E;  4DV4 E;  4O4K A;  2YTF A;  5F3W A;  1BBO A;  4DR4 E;  2UUB E;  5ADZ A;  5TSE A;  1PJQ A;  2FGG A;  2VE7 C;  4F9A B;  2EMF A;  2YTD A;  2ENA A;  1UBD C;  2M9A A;  4WSP A;  2YZT A;  4K0K E;  2DMI A;  2M1S A;  4WXC A;  2ELY A;  1AH5 A;  2R76 A;  2EM5 A;  2YRH A;  4IJD A;  4DKK A;  3ADI A;  4DUY E;  2EOO A;  2YTP A;  2EWL A;  1T4O A;  3KZY A;  2NUG A;  4L5N C;  2H36 X;  2EMA A;  4LF8 E;  4F9B B;  2YTJ A;  2WBU A;  4F2J C;  4BS9 A;  5FLX C;  2N3G A;  2Q8U A;  1QU6 A;  5LL6 R;  5IXM B;  1HNZ E;  2L33 A;  3H09 A;  1J26 A;  2CTD A;  4YHH E;  4KZS A;  1NCS A;  5A69 A;  2EM0 A;  4BCA A;  1X3C A;  2ODR C;  5DNY A;  2PRT A;  4R8O A;  3LLH A;  1IBM E;  1UN6 B;  5A6B D;  4F6M A;  2V88 A;  2GPI A;  2DLK A;  3ECR A;  2VQE E;  1N3G A;  4JI6 E;  4WPY A;  2ENH A;  2RSI A;  1NEI A;  2EMH A;  3AV0 A;  4LF9 E;  2R1F A;  1IMU A;  4NZV A;  2DLQ A;  4X65 E;  2B7T A;  5CFF E;  1X6H A;  1YYK A;  1L4S A;  2ZM6 E;  4DV3 E;  1TF3 A;  3J7Y p;  2JXP A;  2EOQ A;  4MLQ A;  2EQ0 A;  1AAY A;  2EML A;  3JAM C;  3EPJ A;  2YSO A;  4X66 E;  1A1L A;  2YTG A;  3VYX A;  2HGH A;  2LTR A;  1DGC A;  3J7A G;  4DV5 E;  1SFE A;  4B3R E;  1UHZ A;  2EM3 A;  2D9H A;  4JYA E;  4WX9 A;  1HNW E;  2RQL A;  2UXD E;  2EOY A;  2V85 A;  2EE8 A;  1X47 A;  3J81 C;  1A1K A;  2JYA A;  1ZBQ A;  3ADL A;  3BBG A;  4LFC E;  2MDR A;  3K6Q A;  3T1Y E;  4BBY A;  2NUF A;  2JOX A;  2A25 A;  3THO B;  3FIG A;  4DMI A;  2L2K B;  4OX9 E;  3C4T A;  5LLQ A;  2NAB A;  3HPZ A;  4P7D A;  4ZYH A;  1BB8 A;  1Z1B A;  4NHR A;  2EOS A;  1DI2 A;  2EQ3 A;  4R2C A;  1A1J A;  2EOM A;  5AE2 A;  2YTO A;  3F6H A;  2FTX B;  5KL6 A;  2L92 A;  2VRD A;  2RSM A;  2YWQ A;  1TN9 A;  4IS1 C;  3L00 A;  2L8T A;  4LU9 A;  4BMJ A;  3C6M A;  5A6B A;  2EL4 A;  2L3J A;  4B3T E;  2EM6 A;  5KL3 A;  4DR3 E;  2EPL X;  4F9C B;  1O0W A;  4BHB A;  2G7H A;  2EM9 A;  3LML A;  4HTG A;  4R03 A;  2EL6 A;  2YT4 A;  3RMP A;  1SR9 A;  2YRM A;  4JI4 E;  1T38 A;  4RHB B;  3VK6 A;  2YU5 A;  2LBS B;  2L2M A;  2MKD A;  1EKZ A;  2N3H A;  4LTY A;  1ZBT A;  1GZ6 A;  1UIL A;  4DV0 E;  2MC5 A;  4NXM E;  1T4N A;  1XNQ E;  4GKJ E;  2F4V E;  2GHF A;  2YPN A;  3P1X A;  2EOE A;  4M2Z A;  1HR0 E;  1X5W A;  2UU9 E;  4DV1 E;  2UUC E;  2JOB A;  2EOH A;  3M99 B;  2WBT A;  4LFA E;  2ODR D;  1YSA C;  5AE3 A;  4LF6 E;  2VF1 A;  4M30 A;  1T4L B;  2EPU A;  5IWA E;  3EPH A;  2ENC A;  2EOZ A;  2EOX A;  1YYO A;  2DIX A;  1WJP A;  1KYQ A;  5AC5 A;  2L3C A;  4F6N A;  2EPA A;  2NUE A;  4DUZ E;  2EMW A;  5IT9 C;  1RQ0 A;  1EH8 A;  1TF6 A;  1XNR E;  4M9V C;  2M7Q A;  4O24 A;  3JU0 A;  4O5G A;  2EOJ A;  4GEQ B;  1YYW A;  5T6J A;  1IQO A;  4DR2 E;  2EPK X;  4MLV A;  5A2Q C;  4R2A A;  1IBL E;  1MGT A;  2EPN A;  5AE1 A;  1YFH A;  2N8X A;  2EQ1 A;  2EMY A;  3MHS C;  2YTQ A;  4WXD A;  3KZZ A;  2BB8 A;  1PJS A;  2V87 A;  1RMD A;  4ZYD A;  3JTZ A;  3QG5 C;  1PJT A;  3VHT B;  3EQ1 A;  5A6A A;  2NA2 A;  4WYQ B;  2EMI A;  2B7V A;  5AAS A;  2RS6 A;  3ADG A;  4GZN C;  2LJH A;  3BF2 A;  4Q35 B;  4Q28 A;  1BBG A;  4WFT A;  4DV2 E;  2J7J A;  4X9J A;  2UXC E;  2F8B A;  1ZR9 A;  1N33 E;  2EN1 A;  2MDG A;  4ZYG A;  2B3T B;  4R2Q A;  4BHC A;  3UK3 C;  1I94 E;  1G2F C;  3BID A;  2LUP B;  1YUJ A;  1YPN A;  2EM4 A;  2YU8 A;  3KWR A;  4X8W A;  1A1H A;  2I9I A;  2JVA A;  1JK2 A;  1EH6 A;  2JPA A;  2CPN A;  2YTI A;  1N32 E;  4JI8 E;  1JK1 A;  3T1H E;  1GQE A;  4RH8 A;  2KOU A;  5IV8 B;  1WRJ A;  2EOF A;  4LFB E;  2HC5 A;  2KHX A;  2K4V A;  1ZAA C;  5BR8 E;  4X62 E;  2JR1 A;  5A6J A;  3MSW A;  4WSG A;  1PDA A;  2CSH A;  1QNT A;  4JI5 E;  2EN2 A;  4X64 E;  2LRS A;  4YY3 E;  5KL2 A;  2EPC A;  2UUA E;  2B9D A;  2FV4 B;  4R2D A;  3BGH A;  4R2E A;  2YSP A;  2EN7 A;  2WCC 3;  2EJ4 A;  3IWB A;  2EOR A;  4B3S E;  2JP9 A;  1T39 A;  1WHQ A;  4J8Z A;  4JI3 E;  3THN A;  2GLI A;  5KL4 A;  2I13 A;  4N4R B;  4R2P A;  2DRP A;  4GKK E;  3IWD A;  4DR5 E;  2RPC A;  2LV2 A;  1FKA E;  2RTX A;  1EH7 A;  3C4B A;  2E72 A;  4NXN E;  4DR6 E;  2EN6 A;  1HNX E;  2EPM X;  3VYY A;  1A1I A;  4HEI A;  2DB2 A;  2LTS A;  3DJW A;  2K7I A;  2DSY A;  1N36 E;  4JI2 E;  4R2S A;  2ELZ A;  1N34 E;  2MC6 A;  1A1G A;  2EM2 A;  2V86 A;  4P78 A;  1LLM C;  4DR1 E;  3IWC A;  2YTN A;  1G2D C;  4LF4 E;  1IQS A;  1ZU1 A;  5A6K A;  1XMQ E;  3ADJ A;  4AQY E;  4F54 A;  1WHN A;  2UXB E;  2RS7 A;  1MEY C;  4DR7 E;  2JWO A;  3TQM A;  1A1F A;  4JI1 E;  2EM8 A;  4L8N A;  2E1M A;  1X6F A;  1GTK A;  2EOI A;  3HPS A;  3EPL A;  4DV7 E;  5KL7 A;  1F2I G;  2EL5 A; 
#chains in the Genus database with same CATH homology
 1ZR9 A;  2EN1 A;  2YTJ A;  2MDG A;  5KL3 A;  2WBU A;  4F2J C;  4R2Q A;  3UK3 C;  5KL5 A;  1KJK A;  2EP3 A;  1G2F C;  2EM9 A;  2EN8 A;  2EL6 A;  1YUJ A;  2YTE A;  2EN4 A;  4R2R A;  2EM4 A;  2CTD A;  2YU8 A;  2YRM A;  1A1H A;  2EMK A;  1NCS A;  2EM0 A;  2YU5 A;  1JK2 A;  2JPA A;  1X3C A;  2MKD A;  2YTI A;  2PRT A;  2ADR A;  1X6E A;  2EPX A;  1JK1 A;  1UN6 B;  4F6M A;  2EMG A;  2DLK A;  2EMB A;  2EOF A;  1B69 A;  2GHF A;  1ZAA C;  2EOE A;  2ENH A;  1P47 A;  2RSI A;  2EPR A;  2EMH A;  2EMX A;  1X5W A;  2EMC A;  2EMZ A;  2LT7 A;  2R1F A;  2DLQ A;  3MHH C;  2EOH A;  2LCE A;  4WSG A;  3M99 B;  1X6H A;  2EPZ A;  2MKN A;  2WBT A;  3EPK A;  2YRK A;  2CSH A;  2EN2 A;  1TF3 A;  1YSA C;  2EOQ A;  2EQ0 A;  1AAY A;  2EML A;  5KL2 A;  2EM7 A;  2EPC A;  3EPJ A;  2EPU A;  3EPH A;  2CT1 A;  2YSO A;  1A1L A;  4R2D A;  2YTG A;  2HGH A;  2ENC A;  2EOZ A;  1DGC A;  2WBS A;  2EOX A;  1WJP A;  2YSP A;  4R2E A;  2EN7 A;  1YUI A;  2WCC 3;  2EM3 A;  2D9H A;  2EPA A;  4F6N A;  2EJ4 A;  2EMW A;  1TF6 A;  2EN3 A;  2EOR A;  2JP9 A;  2EOY A;  1A1K A;  2EE8 A;  2LO3 A;  4M9V C;  2GLI A;  5KL4 A;  5KL7 A;  2I13 A;  4R2P A;  2EOJ A;  2LVH A;  2DGC A;  2DRP A;  2EPP A;  2RPC A;  2A25 A;  2LV2 A;  4FK5 C;  2E72 A;  2EN6 A;  4R2A A;  2NAB A;  2YTF A;  1A1I A;  1BBO A;  2EQ1 A;  2EMY A;  3MHS C;  2YTQ A;  1BB8 A;  1Z1B A;  2BB8 A;  4R2S A;  2ELZ A;  2EOS A;  1A1G A;  2EQ3 A;  2EMF A;  2YTD A;  1RMD A;  2EM2 A;  4R2C A;  1LLM C;  1A1J A;  2ENA A;  2EOM A;  2YTO A;  2YTN A;  1UBD C;  1G2D C;  5KL6 A;  2M9A A;  3VHT B;  2VRD A;  2DMI A;  2EMI A;  1ZU1 A;  2ELY A;  4GZN C;  1TN9 A;  2EM5 A;  4IS1 C;  2YRH A;  4IJD A;  1MEY C;  2EOO A;  1A1F A;  2EM8 A;  2YTP A;  1X6F A;  2J7J A;  2EL4 A;  2EOI A;  3EPL A;  4X9J A;  2EMA A;  2EM6 A;  1F2I G;  2EL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...