2YSOA

Solution structure of the c2h2 type zinc finger (region 656-688) of human zinc finger protein 95 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 95 homolog
publication title Solution structure of the C2H2 type zinc finger (region 656-688) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ysoA01
3VHTB 2EPRA 1NCSA 4X9JA 4F2JC 2EL5A 2RPCA 1X3CA 2EM3A 2EOXA 2YTIA 2ELYA 4R2AA 2EN6A 1F2IG 2YRKA 2R1FA 2YU8A 1ZR9A 2EM2A 2EPAA 4R2PA 2DGCA 2EN4A 2EE8A 2DMIA 1TN9A 2ADRA 2DLQA 2JP9A 2LT7A 1BBOA 1YUJA 5KL6A 2WBSA 1AAYA 2ENAA 2YTNA 2LV2A 4R2SA 2EMBA 4R2RA 4FK5C 2EPUA 2WBUA 1Z1BA 1JK2A 2DRPA 1X5WA 2EMWA 2EM6A 2EN3A 2YSOA 2MKNA 1TF3A 2E72A 2EOSA 1A1HA 2LCEA 2YTGA 2EM5A 2EM7A 2EMIA 2YRMA 2D9HA 2EN1A 1A1GA 1A1IA 1MEYC 2JPAA 2VRDA 5KL5A 4F6MA 2EMYA 2YTPA 2EQ1A 4IS1C 2EM9A 2MKDA 2I13A 2EOZA 1P47A 2EOIA 2EMZA 2M9AA 2EQ3A 2ENHA 4GZNC 1A1FA 2EOEA 2EL4A 1YSAC 2EQ0A 2EM8A 2EMLA 3EPJA 5KL2A 1ZAAC 2EOYA 2EPZA 2YTFA 3EPHA 4M9VC 1X6HA 2NABA 2EMKA 4R2EA 1JK1A 2CT1A 2YSPA 2LO3A 2LVHA 1UBDC 5KL3A 2J7JA 2EOQA 2ELZA 1BB8A 1LLMC 2ENCA 1WJPA 1G2FC 1A1KA 2MDGA 2CTDA 2EOHA 2EM4A 1TF6A 1RMDA 2A25A 2EM0A 2EN8A 2EMXA 2EMHA 4IJDA 4F6NA 1G2DC 2EN7A 2YTQA 2GLIA 1X6EA 2EOFA 1ZU1A 2EMCA 1YUIA 2CSHA 2EP3A 2PRTA 2YTJA 2YTOA 2EPCA 2EMFA 3MHSC 2WCC3 2DLKA 3EPKA 2BB8A 3MHHC 4WSGA 3UK3C 2YTDA 2EMAA 2WBTA 1A1JA 2EOOA 2EORA 2EJ4A 2EPPA 3M99B 4R2DA 1B69A 1DGCA 2GHFA 2EOMA 1A1LA 3EPLA 2EMGA 5KL7A 2EN2A 2YTEA 2HGHA 2RSIA 2EOJA 4R2QA 1X6FA 1UN6B 2EL6A 2YU5A 1KJKA 5KL4A 4R2CA 2YRHA 2EPXA
chains in the Genus database with same CATH superfamily
4NZVA 3VHTB 4DR2E 4X9JA 1WHQA 4B3SE 2G7HA 2UUAE 1F2IG 2EN6A 2YRKA 2BBGA 3OMLA 4X8WA 2N3GA 2EM2A 2LMZA 1YYOA 2DGCA 1GQEA 2RSMA 3LLHA 4JI8E 4LF9E 3THOB 4ZYDA 2F8BA 2FTXB 1EKZA 2EPNA 3C6KA 4R8OA 5A2QC 5A6BD 1T4NA 3OTOE 2EMBA 4R2RA 2HHHE 1X5WA 5AC5A 2EN3A 4DV1E 1IMUA 2MKNA 2E72A 1PKPA 2EOSA 5IWAE 1A1HA 1QU6A 1GZ6A 2YTGA 1EH6A 2EM5A 2KHXA 2EN1A 1MEYC 2ZM6E 2VRDA 2M4IA 3HQ1A 4K0KE 2EPLX 3IWBA 2DMYA 2EMYA 2UXDE 2E1MA 4WYQB 2I13A 4O5GA 1SFEA 2EOZA 2B7VA 2EMZA 3EQ1A 3VK6A 2EOEA 2JR1A 2EQ0A 5LLQA 5F3WA 3EPJA 2F4VE 1N32E 3H09A 1X6HA 4ZYEA 4I8OA 2CT1A 4DV0E 2EPOA 1PJQA 2V8QB 4RHBB 2EOQA 2ELZA 2K7IA 2L33A 4ZYHA 2MDGA 2EOHA 2EM4A 3ECRA 2UUCE 4OX9E 1RMDA 2EMXA 2RS7A 2EMHA 2LTRA 4M2ZA 1EH8A 1X6EA 2RQLA 4JV5E 2NA2A 2V89A 2YTJA 1XNQE 2EMFA 2EPCA 2WCC3 2B7TA 2YPNA 4TUGA 2ODRD 2BB8A 2B3TB 4LTYA 3TQMA 4GKJE 2EOOA 2KONA 2EOMA 5AE2A 4NHRA 2DIXA 5KL7A 2EOJA 3AUZA 4F9AB 2EZ6A 2V88A 4JI1E 5A69A 3J7AG 2LUQA 2YRHA 4BMJA 2EPXA 4AQYE 2FGGA 2EPRA 2DB2A 4BS9A 1BBGA 2EOXA 4R2AA 1WRJA 1L4SA 2VQFE 2UUBE 1ZR9A 2EPAA 4R2PA 1IBME 2EN4A 2EE8A 1TN9A 2ADRA 1O0WA 2UU9E 2VE7C 5AASA 2JP9A 5DNYA 1PJSA 2JXPA 2NUFA 2WBSA 4KZSA 1AAYA 2ENAA 2YTNA 4LFCE 4X66E 4R2SA 1X47A 4MLVA 3T1YE 2WBUA 2DRPA 2EMWA 5TSEA 4DR1E 2YT4A 1EH7A 2YSOA 3BF2A 1ZBTA 1HR0E 1TF3A 2EM7A 5ADZA 1IBLE 1WHNA 4F6MA 4BBYA 2LBSB 4DR7E 4IS1C 2EM9A 5BR8E 2GPIA 2YZTA 2MC5A 4GEQB 4GZNC 1AH5A 4M30A 1N36E 2EM8A 3FIGA 1T39A 4HTGA 2UXCE 2NABA 3LMLA 4J8ZA 2YSPA 1WXRA 2LO3A 4WPYA 1HNZE 5CFFE 2N3HA 1UBDC 5KL3A 2J7JA 4DKKA 1LLMC 2ENCA 1FJGE 1WJPA 3HPZA 1A1KA 2JWOA 2LUPB 1IQOA 5IT9C 1TF6A 1UILA 2EM0A 2EN8A 3J80C 1RC7A 1T4LB 1ZU1A 2L2KB 1J5EE 3KZZA 2YTOA 1MGTA 4O24A 1T38A 2CPNA 3HTXA 1X49A 2EMAA 2EORA 4R2DA 4P78A 2YWQA 4DV6E 3ADIA 3EPLA 4JI0E 2EN2A 3QG5C 2FV4B 2L2MA 2V83A 4LU9A 1XMOE 4DV3E 1UN6B 4BC9A 4BHCA 4DV4E 3P1XA 5KL4A 5A6JA 1X48A 1QNTA 4X64E 4F2JC 2RPCA 2EPMX 2EM3A 2ELYA 3F6GA 3C4TA 1ZBQA 2Q8UA 2DMIA 2LT7A 3BGHA 1RQ0A 4Q35B 1XMQE 4RH8A 5A6BA 1SR9A 5KL6A 3AV0A 4O4KA 4M0VA 4FK5C 4LFBE 2EPUA 1Z1BA 4L5NC 4LF7E 1YFHA 2EM6A 3IWDA 3ADJA 4BC7A 4DMIA 3ADLA 2D9HA 1A1GA 2IHR1 4F54A 1A1IA 2JPAA 3BBGA 2JY9A 4DV7E 2YTPA 4LF4E 2EQ1A 2L8TA 4P7DA 2MKDA 2M7QA 5A6AA 2MDRA 2EOIA 2UXBE 2L3CA 4JI6E 5IV8B 4DV2E 1YSAC 2EMLA 4KWYA 1ZAAC 5T6JA 2EPZA 2L92A 4BCAA 1N33E 1HNXE 2EMKA 4R2EA 3IWCA 1YPNA 2I9IA 3ADGA 3BIDA 4JYAE 2LVHA 3C4BA 2L3JA 1BB8A 2KOUA 2JOBA 2R76A 2B9DA 4NXNE 2V86A 2EN7A 2GLIA 5AE3A 2LTSA 1YUIA 1GTKA 2CSHA 2EP3A 4LF6E 2PRTA 4F9CB 3MHSC 2VF1A 2DLKA 2EWLA 3MHHC 4DUYE 3UK3C 3DF6A 2YTDA 4LFAE 1J26A 2WBTA 1A1JA 2LJHA 2EPPA 2EJ4A 3HXLA 1B69A 4WFTA 2GHFA 4BHBA 4WX9A 2NUGA 2EMGA 2HGHA 1N3GA 2YTEA 4WXCA 4B3TE 4R2QA 3RMPA 3KWRA 4HEIA 1N34E 2NUEA 2RS6A 4R2CA 4MLQA 1NCSA 1NEIA 2EL5A 1X3CA 4DR6E 3C6MA 2YTIA 1DQ3A 2R1FA 2YU8A 3HPSA 4N4RB 2H36X 2DLQA 1BBOA 1YUJA 5A6KA 2K4VA 5LL6R 2L6MA 2LRSA 2LV2A 4JI5E 2WZOA 3VYYA 4LF8E 2HC5A 2LE2A 1JK2A 4B3ME 1YYKA 3J7Yp 1YZ9A 4Q28A 1I94E 4LF5E 4B3RE 4GKKE 4NXME 2LCEA 4TUIA 3JTZA 1DI2A 2EMIA 2YRMA 3THNA 4X65E 4YHHE 2MC6A 5IXMB 5KL5A 4JI4E 2L2NA 3T1HE 2RTXA 1P47A 2JYAA 2M9AA 2EQ3A 2ENHA 5AE1A 1PJTA 2LJUA 4WSPA 4WXDA 5AC4A 1A1FA 2EL4A 3L00A 3JAMC 1PDAA 2V85A 5KL2A 2EOYA 2YTFA 2E5LE 3EPHA 3JU0A 4DUZE 3J81C 4M9VC 4DR5E 1HNWE 1JK1A 5FLXC 3VYXA 4R03A 3F6HA 2ODRC 1IBKE 2N8XA 1G2FC 2CTDA 4KHPE 1IQSA 2A25A 4JI2E 1XNRE 1T4OA 2JOXA 3MSWA 4IJDA 4F6NA 1G2DC 1STUA 2YTQA 4F9BB 2EOFA 4L8NA 2V87A 2EMCA 3KZYA 1KYQA 1UHZA 5LMNE 3K6QA 2DSYA 2M1SA 4O43A 3DJWA 2JVAA 3EPKA 4WSGA 2EPKX 2VQEE 4X62E 4DR3E 1FKAE 4OOGC 3M99B 1DGCA 4DR4E 1A1LA 1YYWA 3ZOQB 4JI7E 4YY3E 2RSIA 1X6FA 4ZYGA 2EL6A 2YU5A 1KJKA 4DV5E 4JI3E 2HJJA 5LMUE
chains in the Genus database with same CATH topology
3VHTB 2EPRA 1NCSA 4X9JA 4F2JC 2EL5A 2RPCA 1X3CA 2EM3A 2EOXA 2YTIA 2ELYA 4R2AA 2EN6A 1F2IG 2YRKA 2R1FA 2YU8A 1ZR9A 2EM2A 2EPAA 4R2PA 2DGCA 2EN4A 2EE8A 2DMIA 1TN9A 2ADRA 2DLQA 2JP9A 2LT7A 1BBOA 1YUJA 5KL6A 2WBSA 1AAYA 2ENAA 2YTNA 2LV2A 4R2SA 2EMBA 4R2RA 4FK5C 2EPUA 2WBUA 1Z1BA 1JK2A 2DRPA 1X5WA 2EMWA 2EM6A 2EN3A 2YSOA 2MKNA 1TF3A 2E72A 2EOSA 1A1HA 2LCEA 2YTGA 2EM5A 2EM7A 2EMIA 2YRMA 2D9HA 2EN1A 1A1GA 1A1IA 1MEYC 2JPAA 2VRDA 5KL5A 4F6MA 2EMYA 2YTPA 2EQ1A 4IS1C 2EM9A 2MKDA 2I13A 2EOZA 1P47A 2EOIA 2EMZA 2M9AA 2EQ3A 2ENHA 4GZNC 1A1FA 2EOEA 2EL4A 1YSAC 2EQ0A 2EM8A 2EMLA 3EPJA 5KL2A 1ZAAC 2EOYA 2EPZA 2YTFA 3EPHA 4M9VC 1X6HA 2NABA 2EMKA 4R2EA 1JK1A 2CT1A 2YSPA 2LO3A 2LVHA 1UBDC 5KL3A 2J7JA 2EOQA 2ELZA 1BB8A 1LLMC 2ENCA 1WJPA 1G2FC 1A1KA 2MDGA 2CTDA 2EOHA 2EM4A 1TF6A 1RMDA 2A25A 2EM0A 2EN8A 2EMXA 2EMHA 4IJDA 4F6NA 1G2DC 2EN7A 2YTQA 2GLIA 1X6EA 2EOFA 1ZU1A 2EMCA 1YUIA 2CSHA 2EP3A 2PRTA 2YTJA 2YTOA 2EPCA 2EMFA 3MHSC 2WCC3 2DLKA 3EPKA 2BB8A 3MHHC 4WSGA 3UK3C 2YTDA 2EMAA 2WBTA 1A1JA 2EOOA 2EORA 2EJ4A 2EPPA 3M99B 4R2DA 1B69A 1DGCA 2GHFA 2EOMA 1A1LA 3EPLA 2EMGA 5KL7A 2EN2A 2YTEA 2HGHA 2RSIA 2EOJA 4R2QA 1X6FA 1UN6B 2EL6A 2YU5A 1KJKA 5KL4A 4R2CA 2YRHA 2EPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHT B;  2EPR A;  1NCS A;  4X9J A;  4F2J C;  2EL5 A;  2RPC A;  1X3C A;  2EM3 A;  2EOX A;  2YTI A;  2ELY A;  4R2A A;  2EN6 A;  1F2I G;  2YRK A;  2R1F A;  2YU8 A;  1ZR9 A;  2EM2 A;  2EPA A;  4R2P A;  2DGC A;  2EN4 A;  2EE8 A;  2DMI A;  1TN9 A;  2ADR A;  2DLQ A;  2JP9 A;  2LT7 A;  1BBO A;  1YUJ A;  5KL6 A;  2WBS A;  1AAY A;  2ENA A;  2YTN A;  2LV2 A;  4R2S A;  2EMB A;  4R2R A;  4FK5 C;  2EPU A;  2WBU A;  1Z1B A;  1JK2 A;  2DRP A;  1X5W A;  2EMW A;  2EM6 A;  2EN3 A;  2YSO A;  2MKN A;  1TF3 A;  2E72 A;  2EOS A;  1A1H A;  2LCE A;  2YTG A;  2EM5 A;  2EM7 A;  2EMI A;  2YRM A;  2D9H A;  2EN1 A;  1A1G A;  1A1I A;  1MEY C;  2JPA A;  2VRD A;  5KL5 A;  4F6M A;  2EMY A;  2YTP A;  2EQ1 A;  4IS1 C;  2EM9 A;  2MKD A;  2I13 A;  2EOZ A;  1P47 A;  2EOI A;  2EMZ A;  2M9A A;  2EQ3 A;  2ENH A;  4GZN C;  1A1F A;  2EOE A;  2EL4 A;  1YSA C;  2EQ0 A;  2EM8 A;  2EML A;  3EPJ A;  5KL2 A;  1ZAA C;  2EOY A;  2EPZ A;  2YTF A;  3EPH A;  4M9V C;  1X6H A;  2NAB A;  2EMK A;  4R2E A;  1JK1 A;  2CT1 A;  2YSP A;  2LO3 A;  2LVH A;  1UBD C;  5KL3 A;  2J7J A;  2EOQ A;  2ELZ A;  1BB8 A;  1LLM C;  2ENC A;  1WJP A;  1G2F C;  1A1K A;  2MDG A;  2CTD A;  2EOH A;  2EM4 A;  1TF6 A;  1RMD A;  2A25 A;  2EM0 A;  2EN8 A;  2EMX A;  2EMH A;  4IJD A;  4F6N A;  1G2D C;  2EN7 A;  2YTQ A;  2GLI A;  1X6E A;  2EOF A;  1ZU1 A;  2EMC A;  1YUI A;  2CSH A;  2EP3 A;  2PRT A;  2YTJ A;  2YTO A;  2EPC A;  2EMF A;  3MHS C;  2WCC 3;  2DLK A;  3EPK A;  2BB8 A;  3MHH C;  4WSG A;  3UK3 C;  2YTD A;  2EMA A;  2WBT A;  1A1J A;  2EOO A;  2EOR A;  2EJ4 A;  2EPP A;  3M99 B;  4R2D A;  1B69 A;  1DGC A;  2GHF A;  2EOM A;  1A1L A;  3EPL A;  2EMG A;  5KL7 A;  2EN2 A;  2YTE A;  2HGH A;  2RSI A;  2EOJ A;  4R2Q A;  1X6F A;  1UN6 B;  2EL6 A;  2YU5 A;  1KJK A;  5KL4 A;  4R2C A;  2YRH A;  2EPX A; 
#chains in the Genus database with same CATH topology
 4NZV A;  3VHT B;  4DR2 E;  4X9J A;  1WHQ A;  4B3S E;  2G7H A;  2UUA E;  1F2I G;  2EN6 A;  2YRK A;  2BBG A;  3OML A;  4X8W A;  2N3G A;  2EM2 A;  2LMZ A;  1YYO A;  2DGC A;  1GQE A;  2RSM A;  3LLH A;  4JI8 E;  4LF9 E;  3THO B;  4ZYD A;  2F8B A;  2FTX B;  1EKZ A;  2EPN A;  3C6K A;  4R8O A;  5A2Q C;  5A6B D;  1T4N A;  3OTO E;  2EMB A;  4R2R A;  2HHH E;  1X5W A;  5AC5 A;  2EN3 A;  4DV1 E;  1IMU A;  2MKN A;  2E72 A;  1PKP A;  2EOS A;  5IWA E;  1A1H A;  1QU6 A;  1GZ6 A;  2YTG A;  1EH6 A;  2EM5 A;  2KHX A;  2EN1 A;  1MEY C;  2ZM6 E;  2VRD A;  2M4I A;  3HQ1 A;  4K0K E;  2EPL X;  3IWB A;  2DMY A;  2EMY A;  2UXD E;  2E1M A;  4WYQ B;  2I13 A;  4O5G A;  1SFE A;  2EOZ A;  2B7V A;  2EMZ A;  3EQ1 A;  3VK6 A;  2EOE A;  2JR1 A;  2EQ0 A;  5LLQ A;  5F3W A;  3EPJ A;  2F4V E;  1N32 E;  3H09 A;  1X6H A;  4ZYE A;  4I8O A;  2CT1 A;  4DV0 E;  2EPO A;  1PJQ A;  2V8Q B;  4RHB B;  2EOQ A;  2ELZ A;  2K7I A;  2L33 A;  4ZYH A;  2MDG A;  2EOH A;  2EM4 A;  3ECR A;  2UUC E;  4OX9 E;  1RMD A;  2EMX A;  2RS7 A;  2EMH A;  2LTR A;  4M2Z A;  1EH8 A;  1X6E A;  2RQL A;  4JV5 E;  2NA2 A;  2V89 A;  2YTJ A;  1XNQ E;  2EMF A;  2EPC A;  2WCC 3;  2B7T A;  2YPN A;  4TUG A;  2ODR D;  2BB8 A;  2B3T B;  4LTY A;  3TQM A;  4GKJ E;  2EOO A;  2KON A;  2EOM A;  5AE2 A;  4NHR A;  2DIX A;  5KL7 A;  2EOJ A;  3AUZ A;  4F9A B;  2EZ6 A;  2V88 A;  4JI1 E;  5A69 A;  3J7A G;  2LUQ A;  2YRH A;  4BMJ A;  2EPX A;  4AQY E;  2FGG A;  2EPR A;  2DB2 A;  4BS9 A;  1BBG A;  2EOX A;  4R2A A;  1WRJ A;  1L4S A;  2VQF E;  2UUB E;  1ZR9 A;  2EPA A;  4R2P A;  1IBM E;  2EN4 A;  2EE8 A;  1TN9 A;  2ADR A;  1O0W A;  2UU9 E;  2VE7 C;  5AAS A;  2JP9 A;  5DNY A;  1PJS A;  2JXP A;  2NUF A;  2WBS A;  4KZS A;  1AAY A;  2ENA A;  2YTN A;  4LFC E;  4X66 E;  4R2S A;  1X47 A;  4MLV A;  3T1Y E;  2WBU A;  2DRP A;  2EMW A;  5TSE A;  4DR1 E;  2YT4 A;  1EH7 A;  2YSO A;  3BF2 A;  1ZBT A;  1HR0 E;  1TF3 A;  2EM7 A;  5ADZ A;  1IBL E;  1WHN A;  4F6M A;  4BBY A;  2LBS B;  4DR7 E;  4IS1 C;  2EM9 A;  5BR8 E;  2GPI A;  2YZT A;  2MC5 A;  4GEQ B;  4GZN C;  1AH5 A;  4M30 A;  1N36 E;  2EM8 A;  3FIG A;  1T39 A;  4HTG A;  2UXC E;  2NAB A;  3LML A;  4J8Z A;  2YSP A;  1WXR A;  2LO3 A;  4WPY A;  1HNZ E;  5CFF E;  2N3H A;  1UBD C;  5KL3 A;  2J7J A;  4DKK A;  1LLM C;  2ENC A;  1FJG E;  1WJP A;  3HPZ A;  1A1K A;  2JWO A;  2LUP B;  1IQO A;  5IT9 C;  1TF6 A;  1UIL A;  2EM0 A;  2EN8 A;  3J80 C;  1RC7 A;  1T4L B;  1ZU1 A;  2L2K B;  1J5E E;  3KZZ A;  2YTO A;  1MGT A;  4O24 A;  1T38 A;  2CPN A;  3HTX A;  1X49 A;  2EMA A;  2EOR A;  4R2D A;  4P78 A;  2YWQ A;  4DV6 E;  3ADI A;  3EPL A;  4JI0 E;  2EN2 A;  3QG5 C;  2FV4 B;  2L2M A;  2V83 A;  4LU9 A;  1XMO E;  4DV3 E;  1UN6 B;  4BC9 A;  4BHC A;  4DV4 E;  3P1X A;  5KL4 A;  5A6J A;  1X48 A;  1QNT A;  4X64 E;  4F2J C;  2RPC A;  2EPM X;  2EM3 A;  2ELY A;  3F6G A;  3C4T A;  1ZBQ A;  2Q8U A;  2DMI A;  2LT7 A;  3BGH A;  1RQ0 A;  4Q35 B;  1XMQ E;  4RH8 A;  5A6B A;  1SR9 A;  5KL6 A;  3AV0 A;  4O4K A;  4M0V A;  4FK5 C;  4LFB E;  2EPU A;  1Z1B A;  4L5N C;  4LF7 E;  1YFH A;  2EM6 A;  3IWD A;  3ADJ A;  4BC7 A;  4DMI A;  3ADL A;  2D9H A;  1A1G A;  2IHR 1;  4F54 A;  1A1I A;  2JPA A;  3BBG A;  2JY9 A;  4DV7 E;  2YTP A;  4LF4 E;  2EQ1 A;  2L8T A;  4P7D A;  2MKD A;  2M7Q A;  5A6A A;  2MDR A;  2EOI A;  2UXB E;  2L3C A;  4JI6 E;  5IV8 B;  4DV2 E;  1YSA C;  2EML A;  4KWY A;  1ZAA C;  5T6J A;  2EPZ A;  2L92 A;  4BCA A;  1N33 E;  1HNX E;  2EMK A;  4R2E A;  3IWC A;  1YPN A;  2I9I A;  3ADG A;  3BID A;  4JYA E;  2LVH A;  3C4B A;  2L3J A;  1BB8 A;  2KOU A;  2JOB A;  2R76 A;  2B9D A;  4NXN E;  2V86 A;  2EN7 A;  2GLI A;  5AE3 A;  2LTS A;  1YUI A;  1GTK A;  2CSH A;  2EP3 A;  4LF6 E;  2PRT A;  4F9C B;  3MHS C;  2VF1 A;  2DLK A;  2EWL A;  3MHH C;  4DUY E;  3UK3 C;  3DF6 A;  2YTD A;  4LFA E;  1J26 A;  2WBT A;  1A1J A;  2LJH A;  2EPP A;  2EJ4 A;  3HXL A;  1B69 A;  4WFT A;  2GHF A;  4BHB A;  4WX9 A;  2NUG A;  2EMG A;  2HGH A;  1N3G A;  2YTE A;  4WXC A;  4B3T E;  4R2Q A;  3RMP A;  3KWR A;  4HEI A;  1N34 E;  2NUE A;  2RS6 A;  4R2C A;  4MLQ A;  1NCS A;  1NEI A;  2EL5 A;  1X3C A;  4DR6 E;  3C6M A;  2YTI A;  1DQ3 A;  2R1F A;  2YU8 A;  3HPS A;  4N4R B;  2H36 X;  2DLQ A;  1BBO A;  1YUJ A;  5A6K A;  2K4V A;  5LL6 R;  2L6M A;  2LRS A;  2LV2 A;  4JI5 E;  2WZO A;  3VYY A;  4LF8 E;  2HC5 A;  2LE2 A;  1JK2 A;  4B3M E;  1YYK A;  3J7Y p;  1YZ9 A;  4Q28 A;  1I94 E;  4LF5 E;  4B3R E;  4GKK E;  4NXM E;  2LCE A;  4TUI A;  3JTZ A;  1DI2 A;  2EMI A;  2YRM A;  3THN A;  4X65 E;  4YHH E;  2MC6 A;  5IXM B;  5KL5 A;  4JI4 E;  2L2N A;  3T1H E;  2RTX A;  1P47 A;  2JYA A;  2M9A A;  2EQ3 A;  2ENH A;  5AE1 A;  1PJT A;  2LJU A;  4WSP A;  4WXD A;  5AC4 A;  1A1F A;  2EL4 A;  3L00 A;  3JAM C;  1PDA A;  2V85 A;  5KL2 A;  2EOY A;  2YTF A;  2E5L E;  3EPH A;  3JU0 A;  4DUZ E;  3J81 C;  4M9V C;  4DR5 E;  1HNW E;  1JK1 A;  5FLX C;  3VYX A;  4R03 A;  3F6H A;  2ODR C;  1IBK E;  2N8X A;  1G2F C;  2CTD A;  4KHP E;  1IQS A;  2A25 A;  4JI2 E;  1XNR E;  1T4O A;  2JOX A;  3MSW A;  4IJD A;  4F6N A;  1G2D C;  1STU A;  2YTQ A;  4F9B B;  2EOF A;  4L8N A;  2V87 A;  2EMC A;  3KZY A;  1KYQ A;  1UHZ A;  5LMN E;  3K6Q A;  2DSY A;  2M1S A;  4O43 A;  3DJW A;  2JVA A;  3EPK A;  4WSG A;  2EPK X;  2VQE E;  4X62 E;  4DR3 E;  1FKA E;  4OOG C;  3M99 B;  1DGC A;  4DR4 E;  1A1L A;  1YYW A;  3ZOQ B;  4JI7 E;  4YY3 E;  2RSI A;  1X6F A;  4ZYG A;  2EL6 A;  2YU5 A;  1KJK A;  4DV5 E;  4JI3 E;  2HJJ A;  5LMU E; 
#chains in the Genus database with same CATH homology
 3VHT B;  2EPR A;  1NCS A;  4X9J A;  4F2J C;  2EL5 A;  2RPC A;  1X3C A;  2EM3 A;  2EOX A;  2YTI A;  2ELY A;  4R2A A;  2EN6 A;  1F2I G;  2YRK A;  2R1F A;  2YU8 A;  1ZR9 A;  2EM2 A;  2EPA A;  4R2P A;  2DGC A;  2EN4 A;  2EE8 A;  2DMI A;  1TN9 A;  2ADR A;  2DLQ A;  2JP9 A;  2LT7 A;  1BBO A;  1YUJ A;  5KL6 A;  2WBS A;  1AAY A;  2ENA A;  2YTN A;  2LV2 A;  4R2S A;  2EMB A;  4R2R A;  4FK5 C;  2EPU A;  2WBU A;  1Z1B A;  1JK2 A;  2DRP A;  1X5W A;  2EMW A;  2EM6 A;  2EN3 A;  2YSO A;  2MKN A;  1TF3 A;  2E72 A;  2EOS A;  1A1H A;  2LCE A;  2YTG A;  2EM5 A;  2EM7 A;  2EMI A;  2YRM A;  2D9H A;  2EN1 A;  1A1G A;  1A1I A;  1MEY C;  2JPA A;  2VRD A;  5KL5 A;  4F6M A;  2EMY A;  2YTP A;  2EQ1 A;  4IS1 C;  2EM9 A;  2MKD A;  2I13 A;  2EOZ A;  1P47 A;  2EOI A;  2EMZ A;  2M9A A;  2EQ3 A;  2ENH A;  4GZN C;  1A1F A;  2EOE A;  2EL4 A;  1YSA C;  2EQ0 A;  2EM8 A;  2EML A;  3EPJ A;  5KL2 A;  1ZAA C;  2EOY A;  2EPZ A;  2YTF A;  3EPH A;  4M9V C;  1X6H A;  2NAB A;  2EMK A;  4R2E A;  1JK1 A;  2CT1 A;  2YSP A;  2LO3 A;  2LVH A;  1UBD C;  5KL3 A;  2J7J A;  2EOQ A;  2ELZ A;  1BB8 A;  1LLM C;  2ENC A;  1WJP A;  1G2F C;  1A1K A;  2MDG A;  2CTD A;  2EOH A;  2EM4 A;  1TF6 A;  1RMD A;  2A25 A;  2EM0 A;  2EN8 A;  2EMX A;  2EMH A;  4IJD A;  4F6N A;  1G2D C;  2EN7 A;  2YTQ A;  2GLI A;  1X6E A;  2EOF A;  1ZU1 A;  2EMC A;  1YUI A;  2CSH A;  2EP3 A;  2PRT A;  2YTJ A;  2YTO A;  2EPC A;  2EMF A;  3MHS C;  2WCC 3;  2DLK A;  3EPK A;  2BB8 A;  3MHH C;  4WSG A;  3UK3 C;  2YTD A;  2EMA A;  2WBT A;  1A1J A;  2EOO A;  2EOR A;  2EJ4 A;  2EPP A;  3M99 B;  4R2D A;  1B69 A;  1DGC A;  2GHF A;  2EOM A;  1A1L A;  3EPL A;  2EMG A;  5KL7 A;  2EN2 A;  2YTE A;  2HGH A;  2RSI A;  2EOJ A;  4R2Q A;  1X6F A;  1UN6 B;  2EL6 A;  2YU5 A;  1KJK A;  5KL4 A;  4R2C A;  2YRH A;  2EPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...