2YSOA

Solution structure of the c2h2 type zinc finger (region 656-688) of human zinc finger protein 95 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 95 homolog
publication title Solution structure of the C2H2 type zinc finger (region 656-688) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ysoA01
2HGHA 2MKNA 2EN4A 2MDGA 2EPRA 4R2PA 2DLKA 2EPCA 2D9HA 2EN2A 2EN1A 2EMKA 2LCEA 2EM9A 1RMDA 2EMCA 2RSIA 2EMZA 2NABA 4R2CA 3M99B 2WCC3 2EOMA 2EMLA 2DMIA 2EMHA 4FK5C 2E72A 4R2AA 2YTPA 4R2QA 2EMYA 4R2RA 1TF3A 1A1GA 1KJKA 2YTDA 1JK2A 2EL6A 2CSHA 2EQ0A 4R2DA 2DLQA 2EMGA 2EL5A 1F2IG 1P47A 2EN7A 4R2SA 2EPUA 2EOQA 1AAYA 1MEYC 2PRTA 2EQ3A 2EMXA 2EOXA 3EPKA 1TN9A 2EE8A 2YRKA 1UN6B 5KL5A 1X6FA 5KL2A 2EMIA 4X9JA 3EPJA 5KL7A 2ELZA 2EM0A 2JP9A 2EOJA 1G2DC 1NCSA 2ENAA 2EM6A 1A1HA 2EJ4A 2BB8A 2EPPA 2R1FA 2EN3A 2YSPA 2EM5A 3EPLA 3EPHA 2EN8A 2EOZA 4F6NA 4F2JC 4F6MA 2EMFA 2YTFA 1JK1A 2ELYA 2EM8A 1ZR9A 2EOSA 2EORA 2YU5A 2EOFA 1X5WA 2EMAA 3MHSC 4IS1C 2EMBA 1BBOA 5KL4A 2RPCA 1UBDC 2YTQA 2EPXA 1X6HA 2WBTA 2M9AA 2CTDA 2YSOA 4M9VC 1WJPA 2LO3A 2EOOA 2EMWA 3MHHC 5KL6A 2DGCA 1A1IA 2LVHA 1BB8A 2EM3A 2EN6A 2YTOA 4WSGA 2JPAA 2ENHA 2WBSA 1A1KA 1DGCA 2EQ1A 2J7JA 2LV2A 3UK3C 2YRMA 2ENCA 1A1LA 2EM7A 1A1JA 1A1FA 2EOEA 2EPAA 1G2FC 2CT1A 2YU8A 2EM2A 2ADRA 2EPZA 1Z1BA 2YRHA 2LT7A 2YTGA 2YTNA 1ZU1A 2EOIA 1X3CA 3VHTB 2EM4A 1LLMC 2EL4A 2YTIA 2YTJA 1ZAAC 2EOHA 2WBUA 1B69A 1TF6A 4GZNC 4IJDA 4R2EA 2I13A 2MKDA 2VRDA 5KL3A 2GHFA 2A25A 1X6EA 2DRPA 2EOYA 1YSAC 2YTEA 2GLIA 1YUJA 1YUIA 2EP3A
chains in the Genus database with same CATH superfamily
2HGHA 1XNQE 2MKNA 2MC5A 5BR8E 1DQ3A 2F4VE 2DLKA 2D9HA 2EN1A 2EMKA 2EM9A 2HHHE 1XMQE 1T4NA 1GZ6A 3M99B 4DR1E 1UILA 2EMLA 4O43A 1DI2A 2YTPA 1EH7A 5AC5A 2JVAA 2YWQA 1A1GA 3OMLA 2E1MA 2YTDA 2RS6A 1JK2A 2EQ0A 4R2DA 4JI0E 3FIGA 2EMGA 1F2IG 1P47A 2EN7A 4YY3E 4R2SA 1IBME 4X62E 1N3GA 3DF6A 2EMXA 2BBGA 1TN9A 2M7QA 1WRJA 1XNRE 3EPJA 5KL7A 2ELZA 2JP9A 2EOJA 2JY9A 2EPPA 3EPLA 2EOZA 4F2JC 3P1XA 1T39A 2EPLX 3TQMA 3J80C 1X48A 4RHBB 2EZ6A 4NHRA 3K6QA 4DV3E 4P7DA 4B3RE 2R76A 2KHXA 2V87A 2LJUA 4KZSA 5F3WA 2L2MA 2JXPA 4TUGA 2B7VA 2M1SA 1QNTA 2L2KB 1UBDC 2EPXA 2WBTA 2YT4A 5A2QC 3C6MA 3JU0A 1N36E 2K4VA 1N33E 3HTXA 2DB2A 2YPNA 4R03A 2YSOA 4M9VC 3F6GA 4K0KE 2EMWA 3OTOE 3MHHC 4LU9A 1YFHA 2LVHA 4B3ME 2EM3A 2EPKX 4OOGC 4M30A 4NXME 2LMZA 2VQEE 2DSYA 5AE2A 2EQ1A 1EH6A 2RQLA 3DJWA 3UK3C 2YRMA 4DV6E 1A1JA 1QU6A 1N34E 5LMUE 3THNA 4LF4E 5AE1A 2YRHA 2YTNA 4RH8A 4NZVA 3VHTB 1EH8A 1ZAAC 2WBUA 1WHNA 3KZYA 2MKDA 2VRDA 1X6EA 1T4LB 2NUFA 2EP3A 1L4SA 3IWCA 2JOXA 4B3TE 1HNWE 4R2PA 2EPRA 2EPMX 1T38A 5FLXC 4F9AB 2V88A 1X49A 3JTZA 4DUZE 2EMCA 3ADGA 2EMZA 4R2CA 1RC7A 1PJTA 1X47A 2EMHA 1XMOE 4R2AA 4R2QA 2EMYA 4L8NA 1KJKA 5DNYA 3L00A 2EL6A 2CSHA 1STUA 2DLQA 3C4BA 3BF2A 2LE2A 5ADZA 2UXCE 2EPUA 1MEYC 2EPOA 2PRTA 1HR0E 2EQ3A 2EOXA 2B3TB 3AV0A 2EE8A 4WPYA 2YRKA 5KL2A 2JR1A 4X9JA 3ECRA 4KHPE 5LMNE 2IHR1 1NCSA 2ENAA 2BB8A 2K7IA 2YSPA 2FTXB 4M0VA 4DR4E 2EWLA 2DMYA 4F6MA 2YTFA 4JI7E 1ZR9A 2EORA 1FJGE 2EOFA 5A6BD 1PKPA 3MHSC 1BBOA 5AC4A 2L8TA 2I9IA 1RQ0A 2M9AA 5IXMB 1YPNA 1WJPA 2LO3A 2V83A 1WXRA 4M2ZA 2DGCA 1A1IA 2EN6A 3AUZA 2JPAA 3QG5C 1DGCA 2JYAA 2J7JA 4X66E 1IMUA 1A1LA 1UHZA 4O4KA 2L2NA 2N8XA 2Q8UA 2EOEA 4TUIA 4BHCA 2YU8A 4Q35B 4F9BB 3VK6A 4JI5E 2UXDE 4F9CB 3BGHA 1ZU1A 1SFEA 1X3CA 5T6JA 2EM4A 2YTIA 4HEIA 2YTJA 3J7Yp 4JI6E 2VQFE 4IJDA 4R2EA 2I13A 2LUQA 3F6HA 2A25A 4ZYHA 2DRPA 2YTEA 2GLIA 2ZM6E 1YYKA 4ZYEA 2EN4A 2MDGA 3ADJA 3VYYA 1J5EE 2RS7A 1WHQA 3T1YE 5LL6R 2RSIA 5TSEA 4WXCA 2EOMA 3JAMC 2UU9E 1AH5A 4LFCE 4GEQB 4FK5C 2E72A 2RTXA 3MSWA 1TF3A 4L5NC 4BBYA 2LUPB 1IQOA 1FKAE 5A6JA 2LBSB 4LTYA 2EL5A 5AE3A 1AAYA 3EPKA 5LLQA 1KYQA 2UUBE 1PJQA 1X6FA 2EMIA 1BBGA 3HPSA 2EM0A 2L3JA 1G2DC 2EM6A 2EJ4A 2R1FA 2EN3A 4I8OA 5A69A 2EM5A 3EPHA 1YZ9A 4JI4E 4B3SE 1NEIA 4DKKA 4O24A 2ODRC 4JI2E 4JYAE 1X5WA 4BCAA 1SR9A 4X8WA 1GQEA 4N4RB 4DV0E 5A6BA 1EKZA 2EMBA 4ZYGA 4BMJA 3KZZA 1X6HA 3BBGA 3VYXA 2HC5A 3IWBA 2DIXA 1J26A 3ZOQB 5IWAE 1YYWA 2L92A 3HPZA 4O5GA 5CFFE 4WFTA 5KL6A 4HTGA 2YTOA 1IQSA 2ENHA 2WBSA 4AQYE 2LV2A 2ODRD 3KWRA 2ENCA 3ADLA 1GTKA 2EPAA 3EQ1A 1G2FC 2CT1A 2LRSA 1IBKE 4BC7A 4GKJE 2ADRA 2EPZA 2V8QB 2LT7A 2YTGA 2EOIA 2EL4A 2L6MA 1N32E 2YZTA 2EOHA 2B7TA 1TF6A 4JV5E 2KONA 1HNZE 2B9DA 1HNXE 4DV1E 1MGTA 4MLVA 4DR3E 1YUIA 4GKKE 4DR2E 3H09A 2EPNA 2EPCA 2WZOA 2EN2A 2LCEA 4J8ZA 4BHBA 1RMDA 2FV4B 2NABA 2F8BA 4MLQA 2CPNA 2WCC3 2V86A 5A6AA 2DMIA 4DR7E 4R2RA 2KOUA 4DMIA 3BIDA 3LMLA 3HXLA 3THOB 2JOBA 4BS9A 1I94E 2V85A 5IT9C 4LF9E 2HJJA 2UUCE 4BC9A 2EOQA 4WXDA 4JI3E 2NUEA 1UN6B 5KL5A 2UUAE 2N3GA 2E5LE 3ADIA 4LF6E 4R8OA 1A1HA 2VF1A 2L3CA 2H36X 2LTRA 2MDRA 4P78A 2EN8A 4F6NA 2VE7C 4ZYDA 4DR5E 2EMFA 2NUGA 4DV4E 2UXBE 1JK1A 2ELYA 2G7HA 2EM8A 2EOSA 4OX9E 2N3HA 2YU5A 5A6KA 1YYOA 2EMAA 4IS1C 4KWYA 2LJHA 1PDAA 4LFAE 3C6KA 5KL4A 2V89A 2YTQA 4F54A 4LFBE 4DR6E 4LF8E 2CTDA 2FGGA 2EOOA 4DUYE 4NXNE 4YHHE 1BB8A 1O0WA 1T4OA 2GPIA 3LLHA 4X64E 1ZBQA 4JI1E 4WSGA 3J81C 3J7AG 3T1HE 1A1KA 4LF5E 4X65E 4DV7E 4DV2E 2M4IA 3HQ1A 4JI8E 1ZBTA 5IV8B 4LF7E 2LTSA 4DV5E 2EM7A 1A1FA 2NA2A 1IBLE 4WSPA 2MC6A 2RSMA 4Q28A 2EM2A 5AASA 1Z1BA 2L33A 4WYQB 1LLMC 3IWDA 1B69A 4GZNC 1PJSA 5KL3A 2JWOA 2GHFA 2EOYA 1YSAC 4WX9A 1YUJA 3C4TA 2RPCA 3RMPA
chains in the Genus database with same CATH topology
2HGHA 2MKNA 2EN4A 2MDGA 2EPRA 4R2PA 2DLKA 2EPCA 2D9HA 2EN2A 2EN1A 2EMKA 2LCEA 2EM9A 1RMDA 2EMCA 2RSIA 2EMZA 2NABA 4R2CA 3M99B 2WCC3 2EOMA 2EMLA 2DMIA 2EMHA 4FK5C 2E72A 4R2AA 2YTPA 4R2QA 2EMYA 4R2RA 1TF3A 1A1GA 1KJKA 2YTDA 1JK2A 2EL6A 2CSHA 2EQ0A 4R2DA 2DLQA 2EMGA 2EL5A 1F2IG 1P47A 2EN7A 4R2SA 2EPUA 2EOQA 1AAYA 1MEYC 2PRTA 2EQ3A 2EMXA 2EOXA 3EPKA 1TN9A 2EE8A 2YRKA 1UN6B 5KL5A 1X6FA 5KL2A 2EMIA 4X9JA 3EPJA 5KL7A 2ELZA 2EM0A 2JP9A 2EOJA 1G2DC 1NCSA 2ENAA 2EM6A 1A1HA 2EJ4A 2BB8A 2EPPA 2R1FA 2EN3A 2YSPA 2EM5A 3EPLA 3EPHA 2EN8A 2EOZA 4F6NA 4F2JC 4F6MA 2EMFA 2YTFA 1JK1A 2ELYA 2EM8A 1ZR9A 2EOSA 2EORA 2YU5A 2EOFA 1X5WA 2EMAA 3MHSC 4IS1C 2EMBA 1BBOA 5KL4A 2RPCA 1UBDC 2YTQA 2EPXA 1X6HA 2WBTA 2M9AA 2CTDA 2YSOA 4M9VC 1WJPA 2LO3A 2EOOA 2EMWA 3MHHC 5KL6A 2DGCA 1A1IA 2LVHA 1BB8A 2EM3A 2EN6A 2YTOA 4WSGA 2JPAA 2ENHA 2WBSA 1A1KA 1DGCA 2EQ1A 2J7JA 2LV2A 3UK3C 2YRMA 2ENCA 1A1LA 2EM7A 1A1JA 1A1FA 2EOEA 2EPAA 1G2FC 2CT1A 2YU8A 2EM2A 2ADRA 2EPZA 1Z1BA 2YRHA 2LT7A 2YTGA 2YTNA 1ZU1A 2EOIA 1X3CA 3VHTB 2EM4A 1LLMC 2EL4A 2YTIA 2YTJA 1ZAAC 2EOHA 2WBUA 1B69A 1TF6A 4GZNC 4IJDA 4R2EA 2I13A 2MKDA 2VRDA 5KL3A 2GHFA 2A25A 1X6EA 2DRPA 2EOYA 1YSAC 2YTEA 2GLIA 1YUJA 1YUIA 2EP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HGH A;  2MKN A;  2EN4 A;  2MDG A;  2EPR A;  4R2P A;  2DLK A;  2EPC A;  2D9H A;  2EN2 A;  2EN1 A;  2EMK A;  2LCE A;  2EM9 A;  1RMD A;  2EMC A;  2RSI A;  2EMZ A;  2NAB A;  4R2C A;  3M99 B;  2WCC 3;  2EOM A;  2EML A;  2DMI A;  2EMH A;  4FK5 C;  2E72 A;  4R2A A;  2YTP A;  4R2Q A;  2EMY A;  4R2R A;  1TF3 A;  1A1G A;  1KJK A;  2YTD A;  1JK2 A;  2EL6 A;  2CSH A;  2EQ0 A;  4R2D A;  2DLQ A;  2EMG A;  2EL5 A;  1F2I G;  1P47 A;  2EN7 A;  4R2S A;  2EPU A;  2EOQ A;  1AAY A;  1MEY C;  2PRT A;  2EQ3 A;  2EMX A;  2EOX A;  3EPK A;  1TN9 A;  2EE8 A;  2YRK A;  1UN6 B;  5KL5 A;  1X6F A;  5KL2 A;  2EMI A;  4X9J A;  3EPJ A;  5KL7 A;  2ELZ A;  2EM0 A;  2JP9 A;  2EOJ A;  1G2D C;  1NCS A;  2ENA A;  2EM6 A;  1A1H A;  2EJ4 A;  2BB8 A;  2EPP A;  2R1F A;  2EN3 A;  2YSP A;  2EM5 A;  3EPL A;  3EPH A;  2EN8 A;  2EOZ A;  4F6N A;  4F2J C;  4F6M A;  2EMF A;  2YTF A;  1JK1 A;  2ELY A;  2EM8 A;  1ZR9 A;  2EOS A;  2EOR A;  2YU5 A;  2EOF A;  1X5W A;  2EMA A;  3MHS C;  4IS1 C;  2EMB A;  1BBO A;  5KL4 A;  2RPC A;  1UBD C;  2YTQ A;  2EPX A;  1X6H A;  2WBT A;  2M9A A;  2CTD A;  2YSO A;  4M9V C;  1WJP A;  2LO3 A;  2EOO A;  2EMW A;  3MHH C;  5KL6 A;  2DGC A;  1A1I A;  2LVH A;  1BB8 A;  2EM3 A;  2EN6 A;  2YTO A;  4WSG A;  2JPA A;  2ENH A;  2WBS A;  1A1K A;  1DGC A;  2EQ1 A;  2J7J A;  2LV2 A;  3UK3 C;  2YRM A;  2ENC A;  1A1L A;  2EM7 A;  1A1J A;  1A1F A;  2EOE A;  2EPA A;  1G2F C;  2CT1 A;  2YU8 A;  2EM2 A;  2ADR A;  2EPZ A;  1Z1B A;  2YRH A;  2LT7 A;  2YTG A;  2YTN A;  1ZU1 A;  2EOI A;  1X3C A;  3VHT B;  2EM4 A;  1LLM C;  2EL4 A;  2YTI A;  2YTJ A;  1ZAA C;  2EOH A;  2WBU A;  1B69 A;  1TF6 A;  4GZN C;  4IJD A;  4R2E A;  2I13 A;  2MKD A;  2VRD A;  5KL3 A;  2GHF A;  2A25 A;  1X6E A;  2DRP A;  2EOY A;  1YSA C;  2YTE A;  2GLI A;  1YUJ A;  1YUI A;  2EP3 A; 
#chains in the Genus database with same CATH topology
 2HGH A;  1XNQ E;  2MKN A;  2MC5 A;  5BR8 E;  1DQ3 A;  2F4V E;  2DLK A;  2D9H A;  2EN1 A;  2EMK A;  2EM9 A;  2HHH E;  1XMQ E;  1T4N A;  1GZ6 A;  3M99 B;  4DR1 E;  1UIL A;  2EML A;  4O43 A;  1DI2 A;  2YTP A;  1EH7 A;  5AC5 A;  2JVA A;  2YWQ A;  1A1G A;  3OML A;  2E1M A;  2YTD A;  2RS6 A;  1JK2 A;  2EQ0 A;  4R2D A;  4JI0 E;  3FIG A;  2EMG A;  1F2I G;  1P47 A;  2EN7 A;  4YY3 E;  4R2S A;  1IBM E;  4X62 E;  1N3G A;  3DF6 A;  2EMX A;  2BBG A;  1TN9 A;  2M7Q A;  1WRJ A;  1XNR E;  3EPJ A;  5KL7 A;  2ELZ A;  2JP9 A;  2EOJ A;  2JY9 A;  2EPP A;  3EPL A;  2EOZ A;  4F2J C;  3P1X A;  1T39 A;  2EPL X;  3TQM A;  3J80 C;  1X48 A;  4RHB B;  2EZ6 A;  4NHR A;  3K6Q A;  4DV3 E;  4P7D A;  4B3R E;  2R76 A;  2KHX A;  2V87 A;  2LJU A;  4KZS A;  5F3W A;  2L2M A;  2JXP A;  4TUG A;  2B7V A;  2M1S A;  1QNT A;  2L2K B;  1UBD C;  2EPX A;  2WBT A;  2YT4 A;  5A2Q C;  3C6M A;  3JU0 A;  1N36 E;  2K4V A;  1N33 E;  3HTX A;  2DB2 A;  2YPN A;  4R03 A;  2YSO A;  4M9V C;  3F6G A;  4K0K E;  2EMW A;  3OTO E;  3MHH C;  4LU9 A;  1YFH A;  2LVH A;  4B3M E;  2EM3 A;  2EPK X;  4OOG C;  4M30 A;  4NXM E;  2LMZ A;  2VQE E;  2DSY A;  5AE2 A;  2EQ1 A;  1EH6 A;  2RQL A;  3DJW A;  3UK3 C;  2YRM A;  4DV6 E;  1A1J A;  1QU6 A;  1N34 E;  5LMU E;  3THN A;  4LF4 E;  5AE1 A;  2YRH A;  2YTN A;  4RH8 A;  4NZV A;  3VHT B;  1EH8 A;  1ZAA C;  2WBU A;  1WHN A;  3KZY A;  2MKD A;  2VRD A;  1X6E A;  1T4L B;  2NUF A;  2EP3 A;  1L4S A;  3IWC A;  2JOX A;  4B3T E;  1HNW E;  4R2P A;  2EPR A;  2EPM X;  1T38 A;  5FLX C;  4F9A B;  2V88 A;  1X49 A;  3JTZ A;  4DUZ E;  2EMC A;  3ADG A;  2EMZ A;  4R2C A;  1RC7 A;  1PJT A;  1X47 A;  2EMH A;  1XMO E;  4R2A A;  4R2Q A;  2EMY A;  4L8N A;  1KJK A;  5DNY A;  3L00 A;  2EL6 A;  2CSH A;  1STU A;  2DLQ A;  3C4B A;  3BF2 A;  2LE2 A;  5ADZ A;  2UXC E;  2EPU A;  1MEY C;  2EPO A;  2PRT A;  1HR0 E;  2EQ3 A;  2EOX A;  2B3T B;  3AV0 A;  2EE8 A;  4WPY A;  2YRK A;  5KL2 A;  2JR1 A;  4X9J A;  3ECR A;  4KHP E;  5LMN E;  2IHR 1;  1NCS A;  2ENA A;  2BB8 A;  2K7I A;  2YSP A;  2FTX B;  4M0V A;  4DR4 E;  2EWL A;  2DMY A;  4F6M A;  2YTF A;  4JI7 E;  1ZR9 A;  2EOR A;  1FJG E;  2EOF A;  5A6B D;  1PKP A;  3MHS C;  1BBO A;  5AC4 A;  2L8T A;  2I9I A;  1RQ0 A;  2M9A A;  5IXM B;  1YPN A;  1WJP A;  2LO3 A;  2V83 A;  1WXR A;  4M2Z A;  2DGC A;  1A1I A;  2EN6 A;  3AUZ A;  2JPA A;  3QG5 C;  1DGC A;  2JYA A;  2J7J A;  4X66 E;  1IMU A;  1A1L A;  1UHZ A;  4O4K A;  2L2N A;  2N8X A;  2Q8U A;  2EOE A;  4TUI A;  4BHC A;  2YU8 A;  4Q35 B;  4F9B B;  3VK6 A;  4JI5 E;  2UXD E;  4F9C B;  3BGH A;  1ZU1 A;  1SFE A;  1X3C A;  5T6J A;  2EM4 A;  2YTI A;  4HEI A;  2YTJ A;  3J7Y p;  4JI6 E;  2VQF E;  4IJD A;  4R2E A;  2I13 A;  2LUQ A;  3F6H A;  2A25 A;  4ZYH A;  2DRP A;  2YTE A;  2GLI A;  2ZM6 E;  1YYK A;  4ZYE A;  2EN4 A;  2MDG A;  3ADJ A;  3VYY A;  1J5E E;  2RS7 A;  1WHQ A;  3T1Y E;  5LL6 R;  2RSI A;  5TSE A;  4WXC A;  2EOM A;  3JAM C;  2UU9 E;  1AH5 A;  4LFC E;  4GEQ B;  4FK5 C;  2E72 A;  2RTX A;  3MSW A;  1TF3 A;  4L5N C;  4BBY A;  2LUP B;  1IQO A;  1FKA E;  5A6J A;  2LBS B;  4LTY A;  2EL5 A;  5AE3 A;  1AAY A;  3EPK A;  5LLQ A;  1KYQ A;  2UUB E;  1PJQ A;  1X6F A;  2EMI A;  1BBG A;  3HPS A;  2EM0 A;  2L3J A;  1G2D C;  2EM6 A;  2EJ4 A;  2R1F A;  2EN3 A;  4I8O A;  5A69 A;  2EM5 A;  3EPH A;  1YZ9 A;  4JI4 E;  4B3S E;  1NEI A;  4DKK A;  4O24 A;  2ODR C;  4JI2 E;  4JYA E;  1X5W A;  4BCA A;  1SR9 A;  4X8W A;  1GQE A;  4N4R B;  4DV0 E;  5A6B A;  1EKZ A;  2EMB A;  4ZYG A;  4BMJ A;  3KZZ A;  1X6H A;  3BBG A;  3VYX A;  2HC5 A;  3IWB A;  2DIX A;  1J26 A;  3ZOQ B;  5IWA E;  1YYW A;  2L92 A;  3HPZ A;  4O5G A;  5CFF E;  4WFT A;  5KL6 A;  4HTG A;  2YTO A;  1IQS A;  2ENH A;  2WBS A;  4AQY E;  2LV2 A;  2ODR D;  3KWR A;  2ENC A;  3ADL A;  1GTK A;  2EPA A;  3EQ1 A;  1G2F C;  2CT1 A;  2LRS A;  1IBK E;  4BC7 A;  4GKJ E;  2ADR A;  2EPZ A;  2V8Q B;  2LT7 A;  2YTG A;  2EOI A;  2EL4 A;  2L6M A;  1N32 E;  2YZT A;  2EOH A;  2B7T A;  1TF6 A;  4JV5 E;  2KON A;  1HNZ E;  2B9D A;  1HNX E;  4DV1 E;  1MGT A;  4MLV A;  4DR3 E;  1YUI A;  4GKK E;  4DR2 E;  3H09 A;  2EPN A;  2EPC A;  2WZO A;  2EN2 A;  2LCE A;  4J8Z A;  4BHB A;  1RMD A;  2FV4 B;  2NAB A;  2F8B A;  4MLQ A;  2CPN A;  2WCC 3;  2V86 A;  5A6A A;  2DMI A;  4DR7 E;  4R2R A;  2KOU A;  4DMI A;  3BID A;  3LML A;  3HXL A;  3THO B;  2JOB A;  4BS9 A;  1I94 E;  2V85 A;  5IT9 C;  4LF9 E;  2HJJ A;  2UUC E;  4BC9 A;  2EOQ A;  4WXD A;  4JI3 E;  2NUE A;  1UN6 B;  5KL5 A;  2UUA E;  2N3G A;  2E5L E;  3ADI A;  4LF6 E;  4R8O A;  1A1H A;  2VF1 A;  2L3C A;  2H36 X;  2LTR A;  2MDR A;  4P78 A;  2EN8 A;  4F6N A;  2VE7 C;  4ZYD A;  4DR5 E;  2EMF A;  2NUG A;  4DV4 E;  2UXB E;  1JK1 A;  2ELY A;  2G7H A;  2EM8 A;  2EOS A;  4OX9 E;  2N3H A;  2YU5 A;  5A6K A;  1YYO A;  2EMA A;  4IS1 C;  4KWY A;  2LJH A;  1PDA A;  4LFA E;  3C6K A;  5KL4 A;  2V89 A;  2YTQ A;  4F54 A;  4LFB E;  4DR6 E;  4LF8 E;  2CTD A;  2FGG A;  2EOO A;  4DUY E;  4NXN E;  4YHH E;  1BB8 A;  1O0W A;  1T4O A;  2GPI A;  3LLH A;  4X64 E;  1ZBQ A;  4JI1 E;  4WSG A;  3J81 C;  3J7A G;  3T1H E;  1A1K A;  4LF5 E;  4X65 E;  4DV7 E;  4DV2 E;  2M4I A;  3HQ1 A;  4JI8 E;  1ZBT A;  5IV8 B;  4LF7 E;  2LTS A;  4DV5 E;  2EM7 A;  1A1F A;  2NA2 A;  1IBL E;  4WSP A;  2MC6 A;  2RSM A;  4Q28 A;  2EM2 A;  5AAS A;  1Z1B A;  2L33 A;  4WYQ B;  1LLM C;  3IWD A;  1B69 A;  4GZN C;  1PJS A;  5KL3 A;  2JWO A;  2GHF A;  2EOY A;  1YSA C;  4WX9 A;  1YUJ A;  3C4T A;  2RPC A;  3RMP A; 
#chains in the Genus database with same CATH homology
 2HGH A;  2MKN A;  2EN4 A;  2MDG A;  2EPR A;  4R2P A;  2DLK A;  2EPC A;  2D9H A;  2EN2 A;  2EN1 A;  2EMK A;  2LCE A;  2EM9 A;  1RMD A;  2EMC A;  2RSI A;  2EMZ A;  2NAB A;  4R2C A;  3M99 B;  2WCC 3;  2EOM A;  2EML A;  2DMI A;  2EMH A;  4FK5 C;  2E72 A;  4R2A A;  2YTP A;  4R2Q A;  2EMY A;  4R2R A;  1TF3 A;  1A1G A;  1KJK A;  2YTD A;  1JK2 A;  2EL6 A;  2CSH A;  2EQ0 A;  4R2D A;  2DLQ A;  2EMG A;  2EL5 A;  1F2I G;  1P47 A;  2EN7 A;  4R2S A;  2EPU A;  2EOQ A;  1AAY A;  1MEY C;  2PRT A;  2EQ3 A;  2EMX A;  2EOX A;  3EPK A;  1TN9 A;  2EE8 A;  2YRK A;  1UN6 B;  5KL5 A;  1X6F A;  5KL2 A;  2EMI A;  4X9J A;  3EPJ A;  5KL7 A;  2ELZ A;  2EM0 A;  2JP9 A;  2EOJ A;  1G2D C;  1NCS A;  2ENA A;  2EM6 A;  1A1H A;  2EJ4 A;  2BB8 A;  2EPP A;  2R1F A;  2EN3 A;  2YSP A;  2EM5 A;  3EPL A;  3EPH A;  2EN8 A;  2EOZ A;  4F6N A;  4F2J C;  4F6M A;  2EMF A;  2YTF A;  1JK1 A;  2ELY A;  2EM8 A;  1ZR9 A;  2EOS A;  2EOR A;  2YU5 A;  2EOF A;  1X5W A;  2EMA A;  3MHS C;  4IS1 C;  2EMB A;  1BBO A;  5KL4 A;  2RPC A;  1UBD C;  2YTQ A;  2EPX A;  1X6H A;  2WBT A;  2M9A A;  2CTD A;  2YSO A;  4M9V C;  1WJP A;  2LO3 A;  2EOO A;  2EMW A;  3MHH C;  5KL6 A;  2DGC A;  1A1I A;  2LVH A;  1BB8 A;  2EM3 A;  2EN6 A;  2YTO A;  4WSG A;  2JPA A;  2ENH A;  2WBS A;  1A1K A;  1DGC A;  2EQ1 A;  2J7J A;  2LV2 A;  3UK3 C;  2YRM A;  2ENC A;  1A1L A;  2EM7 A;  1A1J A;  1A1F A;  2EOE A;  2EPA A;  1G2F C;  2CT1 A;  2YU8 A;  2EM2 A;  2ADR A;  2EPZ A;  1Z1B A;  2YRH A;  2LT7 A;  2YTG A;  2YTN A;  1ZU1 A;  2EOI A;  1X3C A;  3VHT B;  2EM4 A;  1LLM C;  2EL4 A;  2YTI A;  2YTJ A;  1ZAA C;  2EOH A;  2WBU A;  1B69 A;  1TF6 A;  4GZN C;  4IJD A;  4R2E A;  2I13 A;  2MKD A;  2VRD A;  5KL3 A;  2GHF A;  2A25 A;  1X6E A;  2DRP A;  2EOY A;  1YSA C;  2YTE A;  2GLI A;  1YUJ A;  1YUI A;  2EP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...