2YSOA

Solution structure of the c2h2 type zinc finger (region 656-688) of human zinc finger protein 95 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 95 homolog
publication title Solution structure of the C2H2 type zinc finger (region 656-688) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ysoA01
5KL6A 2EM5A 5KL3A 1A1KA 2CTDA 2MDGA 2EN1A 2EOEA 2EQ0A 2EPCA 2EQ1A 2EM6A 1BB8A 2YTEA 1RMDA 2EMAA 2MKDA 2YTPA 2DMIA 2EOQA 2EM4A 2EP3A 2RPCA 2JP9A 2D9HA 2YRKA 2WBSA 1Z1BA 2WBTA 2WCC3 1X3CA 4IS1C 2EN6A 4R2AA 3EPLA 2YTNA 1UN6B 2EOMA 1X6HA 4FK5C 4IJDA 1A1LA 2YTOA 2LCEA 1JK1A 2JPAA 2EN3A 1KJKA 2YTGA 2EPRA 2EM2A 2YSPA 2EMCA 2EM3A 2EJ4A 4F2JC 1TF6A 2BB8A 2R1FA 4F6NA 2ADRA 2EN8A 4R2DA 2EMZA 2YU5A 2M9AA 2LVHA 2NABA 2YRMA 1DGCA 2WBUA 2DRPA 2EL6A 2ENCA 1JK2A 2EPXA 2YTFA 2EM8A 2EM7A 3UK3C 2EOXA 1WJPA 4R2QA 4R2SA 1ZAAC 1TF3A 2J7JA 2EOHA 2EN4A 2EORA 2YTDA 1UBDC 1NCSA 1MEYC 2EN2A 2EPZA 4R2RA 2GLIA 2EL5A 4GZNC 1A1JA 1LLMC 3EPHA 2VRDA 1A1HA 1ZU1A 4X9JA 1A1GA 2EOOA 2PRTA 1B69A 1P47A 1BBOA 2DLKA 3M99B 2ENAA 5KL2A 3MHSC 2EOYA 1A1FA 1AAYA 2YSOA 2YTJA 1ZR9A 2LV2A 4R2CA 2EE8A 2DLQA 2EL4A 3EPJA 2EMBA 2EOFA 2EM9A 5KL4A 2EOZA 1X5WA 2EMXA 2YU8A 2A25A 2EN7A 4M9VC 2EMWA 2YTIA 1G2DC 2LT7A 1YUIA 2EMGA 2CT1A 4WSGA 2ELYA 1X6FA 1TN9A 2I13A 2ELZA 1YUJA 2MKNA 2EMYA 2RSIA 2EPAA 2LO3A 5KL7A 2HGHA 3VHTB 2EMFA 2EOSA 1X6EA 3MHHC 2EMLA 2YTQA 2DGCA 3EPKA 2EMIA 4R2EA 5KL5A 1A1IA 1F2IG 2E72A 2EOJA 2EPPA 2EOIA 2YRHA 2EMKA 2CSHA 1G2FC 4F6MA 2EM0A 2GHFA 1YSAC 2ENHA 2EQ3A 4R2PA 2EPUA 2EMHA
chains in the Genus database with same CATH superfamily
3P1XA 5KL3A 2BBGA 1GZ6A 2MDGA 2EQ0A 1STUA 1XNRE 1O0WA 5A6BA 2WZOA 3C4BA 1RMDA 2EMAA 4YY3E 5ADZA 4LU9A 4LF4E 2JP9A 2YRKA 4DR5E 1Z1BA 1IBLE 4R2AA 1ZBTA 2EOMA 4IJDA 1EH6A 1I94E 2LCEA 5A6JA 4WXCA 4DR3E 2VQFE 1YZ9A 4GEQB 2V89A 4O4KA 1EKZA 1KJKA 2YSPA 2ADRA 5AE3A 4BHCA 2M9AA 5LMNE 2FGGA 2EL6A 2ENCA 3T1HE 3LLHA 2RQLA 2EM8A 2K7IA 1T4NA 2L8TA 3C4TA 4R2QA 1T38A 4JI7E 1TF3A 3HQ1A 2YPNA 2NUGA 3AV0A 3ADGA 5TSEA 4N4RB 4NHRA 2ODRC 3VYYA 1UBDC 1PDAA 1MEYC 4JV5E 2I9IA 2Q8UA 2EN2A 1SR9A 2EPZA 4R2RA 5IT9C 2DB2A 1IMUA 2UXDE 4Q35B 1A1GA 1P47A 4GKKE 3MSWA 4JI0E 2ENAA 5KL2A 5T6JA 3KZZA 1A1FA 1AAYA 2UXBE 2YSOA 3EPJA 2EWLA 2EE8A 1PKPA 2EM9A 2EOZA 1X5WA 2EMXA 1HNWE 1HR0E 2YTIA 4KWYA 2JVAA 2E5LE 4LTYA 3OMLA 1UHZA 3HPSA 4LF6E 4Q28A 2JOXA 3DJWA 3LMLA 2IHR1 2EOSA 2V83A 4DMIA 3C6KA 2EMLA 2EZ6A 1IBKE 2UUBE 2RSMA 2UU9E 2LUQA 2YRHA 2KHXA 4P78A 2CSHA 3F6GA 2EM0A 4OX9E 4BS9A 1PJTA 1NEIA 3J7AG 3KZYA 2VQEE 2EM5A 1A1KA 2JXPA 2G7HA 2EPCA 2YTEA 4B3TE 2YTPA 5DNYA 4B3RE 4MLQA 2EP3A 2RPCA 2D9HA 4L8NA 4JI5E 4K0KE 3IWBA 1SFEA 2NUEA 1X3CA 3EPLA 2YTNA 1PJQA 4WSPA 1X6HA 5A6AA 3KWRA 5AE2A 4KHPE 2B7TA 4O5GA 3ADLA 2HC5A 4HEIA 4BCAA 5A6KA 1WRJA 2YTGA 1TF6A 2EM2A 4WX9A 4F2JC 2EM3A 2BB8A 1YYKA 2CPNA 4NZVA 2YU5A 3J81C 3TQMA 2YRMA 1DGCA 1JK2A 4JI3E 2ODRD 1XMQE 2EM7A 3UK3C 4O24A 1WJPA 4X62E 3ECRA 4R2SA 1ZAAC 1T4OA 4TUGA 3IWCA 1AH5A 5AC5A 2DSYA 4KZSA 1YYOA 2YTDA 2KOUA 4BMJA 1N33E 4ZYGA 1J5EE 4P7DA 3VK6A 4R03A 1A1JA 1LLMC 2V86A 1A1HA 1L4SA 4RHBB 4JI1E 1ZBQA 4X9JA 4B3ME 4M30A 1B69A 2LE2A 1X48A 2YWQA 2YZTA 4DUZE 4OOGC 3L00A 4BC7A 4GKJE 3ZOQB 2YTJA 1ZR9A 3RMPA 1FJGE 2EMBA 2L3JA 2RS6A 1GQEA 2YU8A 4LF9E 4DR2E 4WSGA 2DMYA 4DV1E 2ELYA 2LMZA 1TN9A 3THNA 2MKNA 2EMYA 2EPAA 2LO3A 4DR7E 4DUYE 3VHTB 1WXRA 3EQ1A 4DV6E 2EMFA 4DV3E 1X47A 2RTXA 1EH8A 2YTQA 2DGCA 2UUCE 5F3WA 2JOBA 2EMIA 4R2EA 4F9BB 2EOIA 3BGHA 2EMKA 1G2FC 4F6MA 3HXLA 1YSAC 4RH8A 4R2PA 1WHNA 3AUZA 5KL6A 3J80C 2CTDA 2EN1A 2MDRA 2MC6A 2EQ1A 2EM6A 2EPNA 4LF8E 2DMIA 2EOQA 2EM4A 4M2ZA 2DIXA 4JI8E 2LJUA 1HNXE 2WBTA 5AASA 4IS1C 2EN6A 1UN6B 5A69A 3ADIA 1A1LA 1JK1A 2JPAA 4X8WA 3J7Yp 2LBSB 3C6MA 2HHHE 1N3GA 2EMCA 2L6MA 3OTOE 2JY9A 4B3SE 1XMOE 4F6NA 2LUPB 4R2DA 2EMZA 3F6HA 2L2KB 4LFCE 5IV8B 2WBUA 2DRPA 1RQ0A 1YYWA 2EPLX 2V88A 2YTFA 4M0VA 2B3TB 2R76A 2EOXA 1IQOA 2EPMX 2EOHA 2VF1A 4DKKA 2EN4A 4ZYHA 4F9CB 2UUAE 1NCSA 2LRSA 4HTGA 2UXCE 2B7VA 2YT4A 2EPOA 4GZNC 3EPHA 2VRDA 1BBGA 4DV2E 4DR1E 2EOOA 2DLKA 1X49A 1EH7A 4R2CA 4BBYA 1N36E 2DLQA 2EOFA 5LL6R 2M4IA 2A25A 2EN7A 3FIGA 1G2DC 1YUIA 2L33A 1DQ3A 2I13A 4JI2E 1MGTA 2ELZA 2KONA 1YUJA 3JAMC 1IQSA 2F8BA 4LFAE 1UILA 4WPYA 5KL7A 4X64E 5FLXC 1FKAE 2RS7A 2L3CA 3MHHC 5LMUE 5AE1A 3EPKA 2B9DA 4LFBE 1F2IG 2E72A 2EOJA 4ZYDA 2GHFA 2ENHA 2EQ3A 2ZM6E 3HPZA 2EPUA 4ZYEA 2EMHA 4WFTA 4J8ZA 2EOEA 2FV4B 4TUIA 4MLVA 1BB8A 5AC4A 1WHQA 3QG5C 2MKDA 4JI4E 1N34E 4BC9A 1XNQE 5A6BD 2WBSA 4DV7E 2V85A 2WCC3 4FK5C 4L5NC 2YTOA 4DR4E 2EN3A 1YFHA 1QU6A 4WYQB 5A2QC 2EPRA 2LTRA 5IWAE 2EJ4A 2LJHA 2N3HA 2VE7C 2R1FA 4NXME 2EN8A 4JYAE 3JTZA 2NUFA 2NABA 2LVHA 5IXMB 2F4VE 1HNZE 2EPXA 2L2MA 3H09A 4JI6E 1J26A 2J7JA 4DV4E 3BF2A 2E1MA 1QNTA 2N8XA 2EORA 3ADJA 3IWDA 2M1SA 4AQYE 3JU0A 1GTKA 2NA2A 2GLIA 3BIDA 2JYAA 2EL5A 2V87A 2L92A 5BR8E 1DI2A 2M7QA 1ZU1A 2EPKX 3VYXA 2PRTA 1YPNA 2MC5A 1KYQA 1BBOA 4DV5E 3M99B 2N3GA 4F9AB 3MHSC 4LF7E 2JWOA 2HJJA 4LF5E 2EOYA 4X66E 1RC7A 2LV2A 2EL4A 2V8QB 5CFFE 2JR1A 1IBME 4R8OA 4M9VC 2EMWA 2LT7A 2K4VA 3K6QA 2CT1A 2EMGA 3T1YE 4YHHE 1X6FA 4WXDA 5LLQA 4BHBA 1PJSA 3DF6A 2RSIA 3THOB 4NXNE 2HGHA 2H36X 4O43A 1X6EA 4F54A 4DV0E 2GPIA 1N32E 5KL5A 1T4LB 1A1IA 2EPPA 2LTSA 4DR6E 2L2NA 2FTXB 4I8OA 3BBGA 4X65E 3HTXA 1T39A 5KL4A
chains in the Genus database with same CATH topology
5KL6A 2EM5A 5KL3A 1A1KA 2CTDA 2MDGA 2EN1A 2EOEA 2EQ0A 2EPCA 2EQ1A 2EM6A 1BB8A 2YTEA 1RMDA 2EMAA 2MKDA 2YTPA 2DMIA 2EOQA 2EM4A 2EP3A 2RPCA 2JP9A 2D9HA 2YRKA 2WBSA 1Z1BA 2WBTA 2WCC3 1X3CA 4IS1C 2EN6A 4R2AA 3EPLA 2YTNA 1UN6B 2EOMA 1X6HA 4FK5C 4IJDA 1A1LA 2YTOA 2LCEA 1JK1A 2JPAA 2EN3A 1KJKA 2YTGA 2EPRA 2EM2A 2YSPA 2EMCA 2EM3A 2EJ4A 4F2JC 1TF6A 2BB8A 2R1FA 4F6NA 2ADRA 2EN8A 4R2DA 2EMZA 2YU5A 2M9AA 2LVHA 2NABA 2YRMA 1DGCA 2WBUA 2DRPA 2EL6A 2ENCA 1JK2A 2EPXA 2YTFA 2EM8A 2EM7A 3UK3C 2EOXA 1WJPA 4R2QA 4R2SA 1ZAAC 1TF3A 2J7JA 2EOHA 2EN4A 2EORA 2YTDA 1UBDC 1NCSA 1MEYC 2EN2A 2EPZA 4R2RA 2GLIA 2EL5A 4GZNC 1A1JA 1LLMC 3EPHA 2VRDA 1A1HA 1ZU1A 4X9JA 1A1GA 2EOOA 2PRTA 1B69A 1P47A 1BBOA 2DLKA 3M99B 2ENAA 5KL2A 3MHSC 2EOYA 1A1FA 1AAYA 2YSOA 2YTJA 1ZR9A 2LV2A 4R2CA 2EE8A 2DLQA 2EL4A 3EPJA 2EMBA 2EOFA 2EM9A 5KL4A 2EOZA 1X5WA 2EMXA 2YU8A 2A25A 2EN7A 4M9VC 2EMWA 2YTIA 1G2DC 2LT7A 1YUIA 2EMGA 2CT1A 4WSGA 2ELYA 1X6FA 1TN9A 2I13A 2ELZA 1YUJA 2MKNA 2EMYA 2RSIA 2EPAA 2LO3A 5KL7A 2HGHA 3VHTB 2EMFA 2EOSA 1X6EA 3MHHC 2EMLA 2YTQA 2DGCA 3EPKA 2EMIA 4R2EA 5KL5A 1A1IA 1F2IG 2E72A 2EOJA 2EPPA 2EOIA 2YRHA 2EMKA 2CSHA 1G2FC 4F6MA 2EM0A 2GHFA 1YSAC 2ENHA 2EQ3A 4R2PA 2EPUA 2EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL6 A;  2EM5 A;  5KL3 A;  1A1K A;  2CTD A;  2MDG A;  2EN1 A;  2EOE A;  2EQ0 A;  2EPC A;  2EQ1 A;  2EM6 A;  1BB8 A;  2YTE A;  1RMD A;  2EMA A;  2MKD A;  2YTP A;  2DMI A;  2EOQ A;  2EM4 A;  2EP3 A;  2RPC A;  2JP9 A;  2D9H A;  2YRK A;  2WBS A;  1Z1B A;  2WBT A;  2WCC 3;  1X3C A;  4IS1 C;  2EN6 A;  4R2A A;  3EPL A;  2YTN A;  1UN6 B;  2EOM A;  1X6H A;  4FK5 C;  4IJD A;  1A1L A;  2YTO A;  2LCE A;  1JK1 A;  2JPA A;  2EN3 A;  1KJK A;  2YTG A;  2EPR A;  2EM2 A;  2YSP A;  2EMC A;  2EM3 A;  2EJ4 A;  4F2J C;  1TF6 A;  2BB8 A;  2R1F A;  4F6N A;  2ADR A;  2EN8 A;  4R2D A;  2EMZ A;  2YU5 A;  2M9A A;  2LVH A;  2NAB A;  2YRM A;  1DGC A;  2WBU A;  2DRP A;  2EL6 A;  2ENC A;  1JK2 A;  2EPX A;  2YTF A;  2EM8 A;  2EM7 A;  3UK3 C;  2EOX A;  1WJP A;  4R2Q A;  4R2S A;  1ZAA C;  1TF3 A;  2J7J A;  2EOH A;  2EN4 A;  2EOR A;  2YTD A;  1UBD C;  1NCS A;  1MEY C;  2EN2 A;  2EPZ A;  4R2R A;  2GLI A;  2EL5 A;  4GZN C;  1A1J A;  1LLM C;  3EPH A;  2VRD A;  1A1H A;  1ZU1 A;  4X9J A;  1A1G A;  2EOO A;  2PRT A;  1B69 A;  1P47 A;  1BBO A;  2DLK A;  3M99 B;  2ENA A;  5KL2 A;  3MHS C;  2EOY A;  1A1F A;  1AAY A;  2YSO A;  2YTJ A;  1ZR9 A;  2LV2 A;  4R2C A;  2EE8 A;  2DLQ A;  2EL4 A;  3EPJ A;  2EMB A;  2EOF A;  2EM9 A;  5KL4 A;  2EOZ A;  1X5W A;  2EMX A;  2YU8 A;  2A25 A;  2EN7 A;  4M9V C;  2EMW A;  2YTI A;  1G2D C;  2LT7 A;  1YUI A;  2EMG A;  2CT1 A;  4WSG A;  2ELY A;  1X6F A;  1TN9 A;  2I13 A;  2ELZ A;  1YUJ A;  2MKN A;  2EMY A;  2RSI A;  2EPA A;  2LO3 A;  5KL7 A;  2HGH A;  3VHT B;  2EMF A;  2EOS A;  1X6E A;  3MHH C;  2EML A;  2YTQ A;  2DGC A;  3EPK A;  2EMI A;  4R2E A;  5KL5 A;  1A1I A;  1F2I G;  2E72 A;  2EOJ A;  2EPP A;  2EOI A;  2YRH A;  2EMK A;  2CSH A;  1G2F C;  4F6M A;  2EM0 A;  2GHF A;  1YSA C;  2ENH A;  2EQ3 A;  4R2P A;  2EPU A;  2EMH A; 
#chains in the Genus database with same CATH topology
 3P1X A;  5KL3 A;  2BBG A;  1GZ6 A;  2MDG A;  2EQ0 A;  1STU A;  1XNR E;  1O0W A;  5A6B A;  2WZO A;  3C4B A;  1RMD A;  2EMA A;  4YY3 E;  5ADZ A;  4LU9 A;  4LF4 E;  2JP9 A;  2YRK A;  4DR5 E;  1Z1B A;  1IBL E;  4R2A A;  1ZBT A;  2EOM A;  4IJD A;  1EH6 A;  1I94 E;  2LCE A;  5A6J A;  4WXC A;  4DR3 E;  2VQF E;  1YZ9 A;  4GEQ B;  2V89 A;  4O4K A;  1EKZ A;  1KJK A;  2YSP A;  2ADR A;  5AE3 A;  4BHC A;  2M9A A;  5LMN E;  2FGG A;  2EL6 A;  2ENC A;  3T1H E;  3LLH A;  2RQL A;  2EM8 A;  2K7I A;  1T4N A;  2L8T A;  3C4T A;  4R2Q A;  1T38 A;  4JI7 E;  1TF3 A;  3HQ1 A;  2YPN A;  2NUG A;  3AV0 A;  3ADG A;  5TSE A;  4N4R B;  4NHR A;  2ODR C;  3VYY A;  1UBD C;  1PDA A;  1MEY C;  4JV5 E;  2I9I A;  2Q8U A;  2EN2 A;  1SR9 A;  2EPZ A;  4R2R A;  5IT9 C;  2DB2 A;  1IMU A;  2UXD E;  4Q35 B;  1A1G A;  1P47 A;  4GKK E;  3MSW A;  4JI0 E;  2ENA A;  5KL2 A;  5T6J A;  3KZZ A;  1A1F A;  1AAY A;  2UXB E;  2YSO A;  3EPJ A;  2EWL A;  2EE8 A;  1PKP A;  2EM9 A;  2EOZ A;  1X5W A;  2EMX A;  1HNW E;  1HR0 E;  2YTI A;  4KWY A;  2JVA A;  2E5L E;  4LTY A;  3OML A;  1UHZ A;  3HPS A;  4LF6 E;  4Q28 A;  2JOX A;  3DJW A;  3LML A;  2IHR 1;  2EOS A;  2V83 A;  4DMI A;  3C6K A;  2EML A;  2EZ6 A;  1IBK E;  2UUB E;  2RSM A;  2UU9 E;  2LUQ A;  2YRH A;  2KHX A;  4P78 A;  2CSH A;  3F6G A;  2EM0 A;  4OX9 E;  4BS9 A;  1PJT A;  1NEI A;  3J7A G;  3KZY A;  2VQE E;  2EM5 A;  1A1K A;  2JXP A;  2G7H A;  2EPC A;  2YTE A;  4B3T E;  2YTP A;  5DNY A;  4B3R E;  4MLQ A;  2EP3 A;  2RPC A;  2D9H A;  4L8N A;  4JI5 E;  4K0K E;  3IWB A;  1SFE A;  2NUE A;  1X3C A;  3EPL A;  2YTN A;  1PJQ A;  4WSP A;  1X6H A;  5A6A A;  3KWR A;  5AE2 A;  4KHP E;  2B7T A;  4O5G A;  3ADL A;  2HC5 A;  4HEI A;  4BCA A;  5A6K A;  1WRJ A;  2YTG A;  1TF6 A;  2EM2 A;  4WX9 A;  4F2J C;  2EM3 A;  2BB8 A;  1YYK A;  2CPN A;  4NZV A;  2YU5 A;  3J81 C;  3TQM A;  2YRM A;  1DGC A;  1JK2 A;  4JI3 E;  2ODR D;  1XMQ E;  2EM7 A;  3UK3 C;  4O24 A;  1WJP A;  4X62 E;  3ECR A;  4R2S A;  1ZAA C;  1T4O A;  4TUG A;  3IWC A;  1AH5 A;  5AC5 A;  2DSY A;  4KZS A;  1YYO A;  2YTD A;  2KOU A;  4BMJ A;  1N33 E;  4ZYG A;  1J5E E;  4P7D A;  3VK6 A;  4R03 A;  1A1J A;  1LLM C;  2V86 A;  1A1H A;  1L4S A;  4RHB B;  4JI1 E;  1ZBQ A;  4X9J A;  4B3M E;  4M30 A;  1B69 A;  2LE2 A;  1X48 A;  2YWQ A;  2YZT A;  4DUZ E;  4OOG C;  3L00 A;  4BC7 A;  4GKJ E;  3ZOQ B;  2YTJ A;  1ZR9 A;  3RMP A;  1FJG E;  2EMB A;  2L3J A;  2RS6 A;  1GQE A;  2YU8 A;  4LF9 E;  4DR2 E;  4WSG A;  2DMY A;  4DV1 E;  2ELY A;  2LMZ A;  1TN9 A;  3THN A;  2MKN A;  2EMY A;  2EPA A;  2LO3 A;  4DR7 E;  4DUY E;  3VHT B;  1WXR A;  3EQ1 A;  4DV6 E;  2EMF A;  4DV3 E;  1X47 A;  2RTX A;  1EH8 A;  2YTQ A;  2DGC A;  2UUC E;  5F3W A;  2JOB A;  2EMI A;  4R2E A;  4F9B B;  2EOI A;  3BGH A;  2EMK A;  1G2F C;  4F6M A;  3HXL A;  1YSA C;  4RH8 A;  4R2P A;  1WHN A;  3AUZ A;  5KL6 A;  3J80 C;  2CTD A;  2EN1 A;  2MDR A;  2MC6 A;  2EQ1 A;  2EM6 A;  2EPN A;  4LF8 E;  2DMI A;  2EOQ A;  2EM4 A;  4M2Z A;  2DIX A;  4JI8 E;  2LJU A;  1HNX E;  2WBT A;  5AAS A;  4IS1 C;  2EN6 A;  1UN6 B;  5A69 A;  3ADI A;  1A1L A;  1JK1 A;  2JPA A;  4X8W A;  3J7Y p;  2LBS B;  3C6M A;  2HHH E;  1N3G A;  2EMC A;  2L6M A;  3OTO E;  2JY9 A;  4B3S E;  1XMO E;  4F6N A;  2LUP B;  4R2D A;  2EMZ A;  3F6H A;  2L2K B;  4LFC E;  5IV8 B;  2WBU A;  2DRP A;  1RQ0 A;  1YYW A;  2EPL X;  2V88 A;  2YTF A;  4M0V A;  2B3T B;  2R76 A;  2EOX A;  1IQO A;  2EPM X;  2EOH A;  2VF1 A;  4DKK A;  2EN4 A;  4ZYH A;  4F9C B;  2UUA E;  1NCS A;  2LRS A;  4HTG A;  2UXC E;  2B7V A;  2YT4 A;  2EPO A;  4GZN C;  3EPH A;  2VRD A;  1BBG A;  4DV2 E;  4DR1 E;  2EOO A;  2DLK A;  1X49 A;  1EH7 A;  4R2C A;  4BBY A;  1N36 E;  2DLQ A;  2EOF A;  5LL6 R;  2M4I A;  2A25 A;  2EN7 A;  3FIG A;  1G2D C;  1YUI A;  2L33 A;  1DQ3 A;  2I13 A;  4JI2 E;  1MGT A;  2ELZ A;  2KON A;  1YUJ A;  3JAM C;  1IQS A;  2F8B A;  4LFA E;  1UIL A;  4WPY A;  5KL7 A;  4X64 E;  5FLX C;  1FKA E;  2RS7 A;  2L3C A;  3MHH C;  5LMU E;  5AE1 A;  3EPK A;  2B9D A;  4LFB E;  1F2I G;  2E72 A;  2EOJ A;  4ZYD A;  2GHF A;  2ENH A;  2EQ3 A;  2ZM6 E;  3HPZ A;  2EPU A;  4ZYE A;  2EMH A;  4WFT A;  4J8Z A;  2EOE A;  2FV4 B;  4TUI A;  4MLV A;  1BB8 A;  5AC4 A;  1WHQ A;  3QG5 C;  2MKD A;  4JI4 E;  1N34 E;  4BC9 A;  1XNQ E;  5A6B D;  2WBS A;  4DV7 E;  2V85 A;  2WCC 3;  4FK5 C;  4L5N C;  2YTO A;  4DR4 E;  2EN3 A;  1YFH A;  1QU6 A;  4WYQ B;  5A2Q C;  2EPR A;  2LTR A;  5IWA E;  2EJ4 A;  2LJH A;  2N3H A;  2VE7 C;  2R1F A;  4NXM E;  2EN8 A;  4JYA E;  3JTZ A;  2NUF A;  2NAB A;  2LVH A;  5IXM B;  2F4V E;  1HNZ E;  2EPX A;  2L2M A;  3H09 A;  4JI6 E;  1J26 A;  2J7J A;  4DV4 E;  3BF2 A;  2E1M A;  1QNT A;  2N8X A;  2EOR A;  3ADJ A;  3IWD A;  2M1S A;  4AQY E;  3JU0 A;  1GTK A;  2NA2 A;  2GLI A;  3BID A;  2JYA A;  2EL5 A;  2V87 A;  2L92 A;  5BR8 E;  1DI2 A;  2M7Q A;  1ZU1 A;  2EPK X;  3VYX A;  2PRT A;  1YPN A;  2MC5 A;  1KYQ A;  1BBO A;  4DV5 E;  3M99 B;  2N3G A;  4F9A B;  3MHS C;  4LF7 E;  2JWO A;  2HJJ A;  4LF5 E;  2EOY A;  4X66 E;  1RC7 A;  2LV2 A;  2EL4 A;  2V8Q B;  5CFF E;  2JR1 A;  1IBM E;  4R8O A;  4M9V C;  2EMW A;  2LT7 A;  2K4V A;  3K6Q A;  2CT1 A;  2EMG A;  3T1Y E;  4YHH E;  1X6F A;  4WXD A;  5LLQ A;  4BHB A;  1PJS A;  3DF6 A;  2RSI A;  3THO B;  4NXN E;  2HGH A;  2H36 X;  4O43 A;  1X6E A;  4F54 A;  4DV0 E;  2GPI A;  1N32 E;  5KL5 A;  1T4L B;  1A1I A;  2EPP A;  2LTS A;  4DR6 E;  2L2N A;  2FTX B;  4I8O A;  3BBG A;  4X65 E;  3HTX A;  1T39 A;  5KL4 A; 
#chains in the Genus database with same CATH homology
 5KL6 A;  2EM5 A;  5KL3 A;  1A1K A;  2CTD A;  2MDG A;  2EN1 A;  2EOE A;  2EQ0 A;  2EPC A;  2EQ1 A;  2EM6 A;  1BB8 A;  2YTE A;  1RMD A;  2EMA A;  2MKD A;  2YTP A;  2DMI A;  2EOQ A;  2EM4 A;  2EP3 A;  2RPC A;  2JP9 A;  2D9H A;  2YRK A;  2WBS A;  1Z1B A;  2WBT A;  2WCC 3;  1X3C A;  4IS1 C;  2EN6 A;  4R2A A;  3EPL A;  2YTN A;  1UN6 B;  2EOM A;  1X6H A;  4FK5 C;  4IJD A;  1A1L A;  2YTO A;  2LCE A;  1JK1 A;  2JPA A;  2EN3 A;  1KJK A;  2YTG A;  2EPR A;  2EM2 A;  2YSP A;  2EMC A;  2EM3 A;  2EJ4 A;  4F2J C;  1TF6 A;  2BB8 A;  2R1F A;  4F6N A;  2ADR A;  2EN8 A;  4R2D A;  2EMZ A;  2YU5 A;  2M9A A;  2LVH A;  2NAB A;  2YRM A;  1DGC A;  2WBU A;  2DRP A;  2EL6 A;  2ENC A;  1JK2 A;  2EPX A;  2YTF A;  2EM8 A;  2EM7 A;  3UK3 C;  2EOX A;  1WJP A;  4R2Q A;  4R2S A;  1ZAA C;  1TF3 A;  2J7J A;  2EOH A;  2EN4 A;  2EOR A;  2YTD A;  1UBD C;  1NCS A;  1MEY C;  2EN2 A;  2EPZ A;  4R2R A;  2GLI A;  2EL5 A;  4GZN C;  1A1J A;  1LLM C;  3EPH A;  2VRD A;  1A1H A;  1ZU1 A;  4X9J A;  1A1G A;  2EOO A;  2PRT A;  1B69 A;  1P47 A;  1BBO A;  2DLK A;  3M99 B;  2ENA A;  5KL2 A;  3MHS C;  2EOY A;  1A1F A;  1AAY A;  2YSO A;  2YTJ A;  1ZR9 A;  2LV2 A;  4R2C A;  2EE8 A;  2DLQ A;  2EL4 A;  3EPJ A;  2EMB A;  2EOF A;  2EM9 A;  5KL4 A;  2EOZ A;  1X5W A;  2EMX A;  2YU8 A;  2A25 A;  2EN7 A;  4M9V C;  2EMW A;  2YTI A;  1G2D C;  2LT7 A;  1YUI A;  2EMG A;  2CT1 A;  4WSG A;  2ELY A;  1X6F A;  1TN9 A;  2I13 A;  2ELZ A;  1YUJ A;  2MKN A;  2EMY A;  2RSI A;  2EPA A;  2LO3 A;  5KL7 A;  2HGH A;  3VHT B;  2EMF A;  2EOS A;  1X6E A;  3MHH C;  2EML A;  2YTQ A;  2DGC A;  3EPK A;  2EMI A;  4R2E A;  5KL5 A;  1A1I A;  1F2I G;  2E72 A;  2EOJ A;  2EPP A;  2EOI A;  2YRH A;  2EMK A;  2CSH A;  1G2F C;  4F6M A;  2EM0 A;  2GHF A;  1YSA C;  2ENH A;  2EQ3 A;  4R2P A;  2EPU A;  2EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...