2YSOA

Solution structure of the c2h2 type zinc finger (region 656-688) of human zinc finger protein 95 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 656-688) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 95 homolog
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ysoA01
2LCEA 2VRDA 4R2CA 5KL2A 1DGCA 2EOQA 2EPRA 4M9VC 4R2QA 2EP3A 2EJ4A 2ADRA 2WBTA 2CTDA 2BB8A 2EMWA 2EQ0A 1X3CA 1X6EA 2EMGA 4IJDA 4R2SA 4F6NA 2EM3A 2EOOA 2EOXA 2GLIA 2EN3A 1A1KA 2ELYA 2MKDA 2EOIA 1BBOA 2EMZA 2YTFA 2LT7A 1P47A 2YTQA 2DRPA 2E72A 2EN2A 2EOSA 1YUJA 2EQ1A 2EN7A 2EL4A 2LO3A 2WBSA 1TF3A 5KL3A 2EMLA 2EN6A 2YTDA 4R2PA 2EMHA 2EMYA 2EOYA 2YRHA 1BB8A 2I13A 4R2EA 2JPAA 2YRMA 1UN6B 2EMFA 2DMIA 2ENCA 4X9JA 1NCSA 1JK2A 3EPKA 2M9AA 5KL7A 2EOJA 2EPXA 5KL5A 2EMAA 2EL5A 1TF6A 2A25A 2CT1A 2EMXA 2EOMA 2HGHA 3MHSC 2JP9A 2EPPA 1YSAC 2EM0A 2YSOA 1ZU1A 2DLKA 1KJKA 4R2AA 2EPZA 2EM7A 4R2RA 2WCC3 1RMDA 2YTNA 2YTGA 1WJPA 2ENHA 3UK3C 2NABA 3VHTB 2EPUA 4FK5C 2MKNA 1ZR9A 2EL6A 3MHHC 2MDGA 2DLQA 2YRKA 1X6FA 2EM8A 2EOZA 4IS1C 2J7JA 2EORA 2YTIA 1TN9A 4F6MA 4GZNC 2YU8A 5KL4A 1A1LA 1LLMC 2EOHA 2LV2A 2RSIA 2YTEA 2EPCA 2EM5A 1G2DC 3M99B 2YU5A 2EM2A 3EPJA 2EMCA 2YTJA 1UBDC 3EPHA 1ZAAC 2CSHA 1YUIA 5KL6A 1A1IA 4WSGA 2YSPA 1F2IG 2EE8A 2LVHA 2EM9A 2EMKA 1B69A 1MEYC 1X6HA 2EN1A 1A1HA 1JK1A 1G2FC 2EOFA 2EPAA 2PRTA 2D9HA 2RPCA 2EOEA 1Z1BA 1A1FA 2EMIA 4R2DA 2WBUA 3EPLA 2EN4A 1A1GA 2EN8A 2EQ3A 2R1FA 2EM4A 2YTOA 2ELZA 1A1JA 2YTPA 2EM6A 1AAYA 2ENAA 2GHFA 2DGCA 2EMBA 4F2JC 1X5WA
chains in the Genus database with same CATH superfamily
2LCEA 2VRDA 2VQFE 3H09A 1DGCA 2EOQA 2EPRA 3BIDA 4M9VC 3ADLA 1MGTA 5FLXC 4TUGA 1YYWA 3BBGA 2NUEA 2JWOA 3LMLA 4DV2E 2EMWA 1X3CA 4LF9E 2EMGA 2LTSA 2NUGA 3J7AG 2EOOA 3HQ1A 4DV1E 1IMUA 2MKDA 2EOIA 4B3RE 3ECRA 5CFFE 4LF8E 1WHQA 2YTQA 4JI3E 2DRPA 1YZ9A 4YHHE 2EQ1A 1DQ3A 2EPNA 2LO3A 4NXNE 2DIXA 2LRSA 2EMYA 3IWDA 4R2EA 1UN6B 4BBYA 4Q28A 2RSMA 4X9JA 3T1YE 5AC5A 2YWQA 2M9AA 4R03A 4GEQB 5KL5A 1EH7A 2CT1A 1PDAA 3MHSC 2JP9A 2LE2A 2YSOA 4Q35B 3BF2A 4DR2E 4DR7E 2EPZA 2EM7A 2HJJA 3THOB 4F54A 5T6JA 3KZZA 2WCC3 4JV5E 1WJPA 2G7HA 1T4NA 2YZTA 2V88A 4FK5C 4HTGA 2EL6A 2VQEE 5ADZA 4B3TE 1BBGA 4AQYE 2LV2A 5TSEA 2EPCA 2EM5A 1T38A 3M99B 1G2DC 4GKKE 2CSHA 1N3GA 2YSPA 1F2IG 2JOBA 2N3HA 2ODRD 4YY3E 2EM9A 2K4VA 1MEYC 4WX9A 4OX9E 1JK1A 3VYXA 3ADIA 2HHHE 2CPNA 4N4RB 2PRTA 2D9HA 3ZOQB 3TQMA 2EOEA 1Z1BA 4LTYA 5A6JA 1ZBTA 3J7Yp 2EMIA 4R2DA 5AASA 4BMJA 4K0KE 1I94E 3EQ1A 2EQ3A 4DKKA 4DV3E 4LFBE 2EM6A 3ADGA 3THNA 2EPOA 2UXBE 2GHFA 2DGCA 2L33A 1T39A 3JAMC 3J81C 1SR9A 1EH6A 1UILA 5KL2A 3ADJA 2V87A 1IQSA 2EJ4A 1SFEA 2RTXA 2ADRA 2BB8A 1X6EA 5IXMB 2EM3A 4ZYDA 2JYAA 5A2QC 2EN3A 4TUIA 2RQLA 2V8QB 1BBOA 4X62E 4LF4E 4M0VA 1P47A 2KHXA 2L2NA 4KZSA 3QG5C 2EN7A 2V86A 2WBSA 2EMLA 2DSYA 5LL6R 4GKJE 3HPZA 2EOYA 2YRHA 1BB8A 2I13A 2YRMA 4HEIA 4KWYA 4I8OA 1IBKE 2DMIA 3OMLA 2LUPB 4F9AB 1L4SA 4J8ZA 2F4VE 1HR0E 4DR4E 2EL5A 4WXDA 2A25A 2EMXA 1RQ0A 2EPPA 1KJKA 4WYQB 1YPNA 1N36E 3BGHA 2EZ6A 2VE7C 1RMDA 1GQEA 4L5NC 5A6KA 2NABA 3VHTB 2EPUA 1ZR9A 2B9DA 3F6HA 3MHHC 2MDGA 2UXCE 2DLQA 2LTRA 4BCAA 2E1MA 2EOZA 2YPNA 2J7JA 2EORA 4JI7E 1TN9A 4LF7E 4F6MA 4GZNC 2YU8A 2LMZA 4O24A 3HTXA 2K7IA 2L2MA 4F9CB 2YTEA 1FKAE 4M30A 2EM2A 3EPJA 2YTJA 4DUZE 2DB2A 4WSGA 1AH5A 2F8BA 1IQOA 3K6QA 4BHCA 2EMKA 2EN1A 2EOFA 4BC9A 1X48A 2RPCA 3HXLA 4MLQA 2WZOA 4DR1E 2UU9E 2MC5A 2R76A 4BC7A 2EN4A 2MC6A 2JR1A 5IWAE 3C6KA 4DV7E 1A1GA 1GZ6A 2FGGA 1A1JA 4JI1E 5IT9C 2M7QA 2JOXA 2YTPA 4WXCA 4WPYA 5DNYA 2EMBA 1KYQA 1UHZA 3FIGA 2V89A 4R2CA 4DV6E 4X8WA 4R2QA 2MDRA 2WBTA 1XMOE 2CTDA 4R2SA 4LFAE 4IJDA 1YYOA 2EOXA 2GLIA 1HNWE 4ZYGA 2FTXB 2UXDE 4JYAE 2EMZA 2YTFA 2LT7A 4X64E 2EN2A 2EOSA 5AE3A 4DUYE 3L00A 1TF3A 4P7DA 1N34E 2V83A 4R2PA 2EWLA 2YTDA 4LF6E 1NEIA 4NZVA 2KONA 1WRJA 2JPAA 4KHPE 1IBLE 3KZYA 2ENCA 5AC4A 5AE1A 1JK2A 1WHNA 2EMAA 3C6MA 2EOMA 2HGHA 2KOUA 2DLKA 5A6AA 4R2RA 2N8XA 3IWCA 2YTGA 2ENHA 3UK3C 3VYYA 2N3GA 1EKZA 2JXPA 3OTOE 1X6FA 3C4BA 4DR6E 4RH8A 4DR3E 2FV4B 4B3SE 2M1SA 4ZYEA 1A1LA 1X47A 2V85A 2VF1A 1LLMC 4JI4E 2EOHA 1PJTA 4NXME 2RSIA 4L8NA 4B3ME 4LF5E 1PKPA 4RHBB 5IV8B 2EMCA 1HNZE 5BR8E 2RS6A 2NUFA 2UUBE 1T4OA 3LLHA 4JI2E 1EH8A 3AUZA 3RMPA 3DJWA 1A1HA 5A6BD 1G2FC 1WXRA 3DF6A 2EPAA 2H36X 1IBME 2EPKX 1XNQE 2WBUA 1X49A 2EN8A 2R1FA 4LU9A 2EM4A 2ELZA 4O43A 4DV0E 2ENAA 3JTZA 4P78A 1HNXE 1X5WA 1N33E 1PJQA 2Q8UA 2EP3A 1J26A 4BS9A 2B7VA 1T4LB 2LJHA 2EQ0A 4F6NA 1XMQE 2UUCE 2EPLX 4DV5E 2UUAE 2LUQA 2RS7A 1A1KA 2ELYA 2DMYA 2M4IA 4WFTA 2E72A 1YUJA 2HC5A 4X65E 2EL4A 2E5LE 1DI2A 5KL3A 2L3JA 2EN6A 1PJSA 2JVAA 2EMHA 2L92A 2L2KB 3T1HE 1GTKA 1O0WA 2EMFA 4F9BB 3KWRA 2LBSB 4JI0E 4JI6E 4ZYHA 1NCSA 3EPKA 5A69A 5KL7A 2EOJA 2EPXA 5A6BA 3J80C 1TF6A 1QU6A 4BHBA 1YSAC 2EM0A 5LMNE 1ZU1A 4R2AA 3F6GA 4NHRA 3VK6A 4O5GA 2YTNA 4OOGC 5AE2A 2MKNA 2JY9A 2YRKA 4WSPA 1YFHA 1J5EE 2EM8A 4IS1C 2YTIA 1FJGE 2L3CA 5KL4A 4R8OA 1RC7A 2B7TA 2L8TA 2ODRC 3HPSA 2I9IA 3P1XA 2BBGA 1STUA 5F3WA 2YU5A 4O4KA 2NA2A 3MSWA 2B3TB 1UBDC 3EPHA 5LLQA 1ZAAC 1YUIA 4JI5E 5KL6A 4DR5E 1A1IA 2IHR1 2YT4A 2EE8A 2LVHA 3JU0A 1N32E 2GPIA 1B69A 1X6HA 1XNRE 2ZM6E 4LFCE 1YYKA 1A1FA 3IWBA 3EPLA 3C4TA 1ZBQA 5LMUE 2EPMX 2YTOA 2LJUA 4X66E 4M2ZA 4MLVA 4DMIA 4DV4E 1AAYA 1QNTA 3AV0A 4JI8E 2L6MA 4F2JC
chains in the Genus database with same CATH topology
2LCEA 2VRDA 4R2CA 5KL2A 1DGCA 2EOQA 2EPRA 4M9VC 4R2QA 2EP3A 2EJ4A 2ADRA 2WBTA 2CTDA 2BB8A 2EMWA 2EQ0A 1X3CA 1X6EA 2EMGA 4IJDA 4R2SA 4F6NA 2EM3A 2EOOA 2EOXA 2GLIA 2EN3A 1A1KA 2ELYA 2MKDA 2EOIA 1BBOA 2EMZA 2YTFA 2LT7A 1P47A 2YTQA 2DRPA 2E72A 2EN2A 2EOSA 1YUJA 2EQ1A 2EN7A 2EL4A 2LO3A 2WBSA 1TF3A 5KL3A 2EMLA 2EN6A 2YTDA 4R2PA 2EMHA 2EMYA 2EOYA 2YRHA 1BB8A 2I13A 4R2EA 2JPAA 2YRMA 1UN6B 2EMFA 2DMIA 2ENCA 4X9JA 1NCSA 1JK2A 3EPKA 2M9AA 5KL7A 2EOJA 2EPXA 5KL5A 2EMAA 2EL5A 1TF6A 2A25A 2CT1A 2EMXA 2EOMA 2HGHA 3MHSC 2JP9A 2EPPA 1YSAC 2EM0A 2YSOA 1ZU1A 2DLKA 1KJKA 4R2AA 2EPZA 2EM7A 4R2RA 2WCC3 1RMDA 2YTNA 2YTGA 1WJPA 2ENHA 3UK3C 2NABA 3VHTB 2EPUA 4FK5C 2MKNA 1ZR9A 2EL6A 3MHHC 2MDGA 2DLQA 2YRKA 1X6FA 2EM8A 2EOZA 4IS1C 2J7JA 2EORA 2YTIA 1TN9A 4F6MA 4GZNC 2YU8A 5KL4A 1A1LA 1LLMC 2EOHA 2LV2A 2RSIA 2YTEA 2EPCA 2EM5A 1G2DC 3M99B 2YU5A 2EM2A 3EPJA 2EMCA 2YTJA 1UBDC 3EPHA 1ZAAC 2CSHA 1YUIA 5KL6A 1A1IA 4WSGA 2YSPA 1F2IG 2EE8A 2LVHA 2EM9A 2EMKA 1B69A 1MEYC 1X6HA 2EN1A 1A1HA 1JK1A 1G2FC 2EOFA 2EPAA 2PRTA 2D9HA 2RPCA 2EOEA 1Z1BA 1A1FA 2EMIA 4R2DA 2WBUA 3EPLA 2EN4A 1A1GA 2EN8A 2EQ3A 2R1FA 2EM4A 2YTOA 2ELZA 1A1JA 2YTPA 2EM6A 1AAYA 2ENAA 2GHFA 2DGCA 2EMBA 4F2JC 1X5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCE A;  2VRD A;  4R2C A;  5KL2 A;  1DGC A;  2EOQ A;  2EPR A;  4M9V C;  4R2Q A;  2EP3 A;  2EJ4 A;  2ADR A;  2WBT A;  2CTD A;  2BB8 A;  2EMW A;  2EQ0 A;  1X3C A;  1X6E A;  2EMG A;  4IJD A;  4R2S A;  4F6N A;  2EM3 A;  2EOO A;  2EOX A;  2GLI A;  2EN3 A;  1A1K A;  2ELY A;  2MKD A;  2EOI A;  1BBO A;  2EMZ A;  2YTF A;  2LT7 A;  1P47 A;  2YTQ A;  2DRP A;  2E72 A;  2EN2 A;  2EOS A;  1YUJ A;  2EQ1 A;  2EN7 A;  2EL4 A;  2LO3 A;  2WBS A;  1TF3 A;  5KL3 A;  2EML A;  2EN6 A;  2YTD A;  4R2P A;  2EMH A;  2EMY A;  2EOY A;  2YRH A;  1BB8 A;  2I13 A;  4R2E A;  2JPA A;  2YRM A;  1UN6 B;  2EMF A;  2DMI A;  2ENC A;  4X9J A;  1NCS A;  1JK2 A;  3EPK A;  2M9A A;  5KL7 A;  2EOJ A;  2EPX A;  5KL5 A;  2EMA A;  2EL5 A;  1TF6 A;  2A25 A;  2CT1 A;  2EMX A;  2EOM A;  2HGH A;  3MHS C;  2JP9 A;  2EPP A;  1YSA C;  2EM0 A;  2YSO A;  1ZU1 A;  2DLK A;  1KJK A;  4R2A A;  2EPZ A;  2EM7 A;  4R2R A;  2WCC 3;  1RMD A;  2YTN A;  2YTG A;  1WJP A;  2ENH A;  3UK3 C;  2NAB A;  3VHT B;  2EPU A;  4FK5 C;  2MKN A;  1ZR9 A;  2EL6 A;  3MHH C;  2MDG A;  2DLQ A;  2YRK A;  1X6F A;  2EM8 A;  2EOZ A;  4IS1 C;  2J7J A;  2EOR A;  2YTI A;  1TN9 A;  4F6M A;  4GZN C;  2YU8 A;  5KL4 A;  1A1L A;  1LLM C;  2EOH A;  2LV2 A;  2RSI A;  2YTE A;  2EPC A;  2EM5 A;  1G2D C;  3M99 B;  2YU5 A;  2EM2 A;  3EPJ A;  2EMC A;  2YTJ A;  1UBD C;  3EPH A;  1ZAA C;  2CSH A;  1YUI A;  5KL6 A;  1A1I A;  4WSG A;  2YSP A;  1F2I G;  2EE8 A;  2LVH A;  2EM9 A;  2EMK A;  1B69 A;  1MEY C;  1X6H A;  2EN1 A;  1A1H A;  1JK1 A;  1G2F C;  2EOF A;  2EPA A;  2PRT A;  2D9H A;  2RPC A;  2EOE A;  1Z1B A;  1A1F A;  2EMI A;  4R2D A;  2WBU A;  3EPL A;  2EN4 A;  1A1G A;  2EN8 A;  2EQ3 A;  2R1F A;  2EM4 A;  2YTO A;  2ELZ A;  1A1J A;  2YTP A;  2EM6 A;  1AAY A;  2ENA A;  2GHF A;  2DGC A;  2EMB A;  4F2J C;  1X5W A; 
#chains in the Genus database with same CATH topology
 2LCE A;  2VRD A;  2VQF E;  3H09 A;  1DGC A;  2EOQ A;  2EPR A;  3BID A;  4M9V C;  3ADL A;  1MGT A;  5FLX C;  4TUG A;  1YYW A;  3BBG A;  2NUE A;  2JWO A;  3LML A;  4DV2 E;  2EMW A;  1X3C A;  4LF9 E;  2EMG A;  2LTS A;  2NUG A;  3J7A G;  2EOO A;  3HQ1 A;  4DV1 E;  1IMU A;  2MKD A;  2EOI A;  4B3R E;  3ECR A;  5CFF E;  4LF8 E;  1WHQ A;  2YTQ A;  4JI3 E;  2DRP A;  1YZ9 A;  4YHH E;  2EQ1 A;  1DQ3 A;  2EPN A;  2LO3 A;  4NXN E;  2DIX A;  2LRS A;  2EMY A;  3IWD A;  4R2E A;  1UN6 B;  4BBY A;  4Q28 A;  2RSM A;  4X9J A;  3T1Y E;  5AC5 A;  2YWQ A;  2M9A A;  4R03 A;  4GEQ B;  5KL5 A;  1EH7 A;  2CT1 A;  1PDA A;  3MHS C;  2JP9 A;  2LE2 A;  2YSO A;  4Q35 B;  3BF2 A;  4DR2 E;  4DR7 E;  2EPZ A;  2EM7 A;  2HJJ A;  3THO B;  4F54 A;  5T6J A;  3KZZ A;  2WCC 3;  4JV5 E;  1WJP A;  2G7H A;  1T4N A;  2YZT A;  2V88 A;  4FK5 C;  4HTG A;  2EL6 A;  2VQE E;  5ADZ A;  4B3T E;  1BBG A;  4AQY E;  2LV2 A;  5TSE A;  2EPC A;  2EM5 A;  1T38 A;  3M99 B;  1G2D C;  4GKK E;  2CSH A;  1N3G A;  2YSP A;  1F2I G;  2JOB A;  2N3H A;  2ODR D;  4YY3 E;  2EM9 A;  2K4V A;  1MEY C;  4WX9 A;  4OX9 E;  1JK1 A;  3VYX A;  3ADI A;  2HHH E;  2CPN A;  4N4R B;  2PRT A;  2D9H A;  3ZOQ B;  3TQM A;  2EOE A;  1Z1B A;  4LTY A;  5A6J A;  1ZBT A;  3J7Y p;  2EMI A;  4R2D A;  5AAS A;  4BMJ A;  4K0K E;  1I94 E;  3EQ1 A;  2EQ3 A;  4DKK A;  4DV3 E;  4LFB E;  2EM6 A;  3ADG A;  3THN A;  2EPO A;  2UXB E;  2GHF A;  2DGC A;  2L33 A;  1T39 A;  3JAM C;  3J81 C;  1SR9 A;  1EH6 A;  1UIL A;  5KL2 A;  3ADJ A;  2V87 A;  1IQS A;  2EJ4 A;  1SFE A;  2RTX A;  2ADR A;  2BB8 A;  1X6E A;  5IXM B;  2EM3 A;  4ZYD A;  2JYA A;  5A2Q C;  2EN3 A;  4TUI A;  2RQL A;  2V8Q B;  1BBO A;  4X62 E;  4LF4 E;  4M0V A;  1P47 A;  2KHX A;  2L2N A;  4KZS A;  3QG5 C;  2EN7 A;  2V86 A;  2WBS A;  2EML A;  2DSY A;  5LL6 R;  4GKJ E;  3HPZ A;  2EOY A;  2YRH A;  1BB8 A;  2I13 A;  2YRM A;  4HEI A;  4KWY A;  4I8O A;  1IBK E;  2DMI A;  3OML A;  2LUP B;  4F9A B;  1L4S A;  4J8Z A;  2F4V E;  1HR0 E;  4DR4 E;  2EL5 A;  4WXD A;  2A25 A;  2EMX A;  1RQ0 A;  2EPP A;  1KJK A;  4WYQ B;  1YPN A;  1N36 E;  3BGH A;  2EZ6 A;  2VE7 C;  1RMD A;  1GQE A;  4L5N C;  5A6K A;  2NAB A;  3VHT B;  2EPU A;  1ZR9 A;  2B9D A;  3F6H A;  3MHH C;  2MDG A;  2UXC E;  2DLQ A;  2LTR A;  4BCA A;  2E1M A;  2EOZ A;  2YPN A;  2J7J A;  2EOR A;  4JI7 E;  1TN9 A;  4LF7 E;  4F6M A;  4GZN C;  2YU8 A;  2LMZ A;  4O24 A;  3HTX A;  2K7I A;  2L2M A;  4F9C B;  2YTE A;  1FKA E;  4M30 A;  2EM2 A;  3EPJ A;  2YTJ A;  4DUZ E;  2DB2 A;  4WSG A;  1AH5 A;  2F8B A;  1IQO A;  3K6Q A;  4BHC A;  2EMK A;  2EN1 A;  2EOF A;  4BC9 A;  1X48 A;  2RPC A;  3HXL A;  4MLQ A;  2WZO A;  4DR1 E;  2UU9 E;  2MC5 A;  2R76 A;  4BC7 A;  2EN4 A;  2MC6 A;  2JR1 A;  5IWA E;  3C6K A;  4DV7 E;  1A1G A;  1GZ6 A;  2FGG A;  1A1J A;  4JI1 E;  5IT9 C;  2M7Q A;  2JOX A;  2YTP A;  4WXC A;  4WPY A;  5DNY A;  2EMB A;  1KYQ A;  1UHZ A;  3FIG A;  2V89 A;  4R2C A;  4DV6 E;  4X8W A;  4R2Q A;  2MDR A;  2WBT A;  1XMO E;  2CTD A;  4R2S A;  4LFA E;  4IJD A;  1YYO A;  2EOX A;  2GLI A;  1HNW E;  4ZYG A;  2FTX B;  2UXD E;  4JYA E;  2EMZ A;  2YTF A;  2LT7 A;  4X64 E;  2EN2 A;  2EOS A;  5AE3 A;  4DUY E;  3L00 A;  1TF3 A;  4P7D A;  1N34 E;  2V83 A;  4R2P A;  2EWL A;  2YTD A;  4LF6 E;  1NEI A;  4NZV A;  2KON A;  1WRJ A;  2JPA A;  4KHP E;  1IBL E;  3KZY A;  2ENC A;  5AC4 A;  5AE1 A;  1JK2 A;  1WHN A;  2EMA A;  3C6M A;  2EOM A;  2HGH A;  2KOU A;  2DLK A;  5A6A A;  4R2R A;  2N8X A;  3IWC A;  2YTG A;  2ENH A;  3UK3 C;  3VYY A;  2N3G A;  1EKZ A;  2JXP A;  3OTO E;  1X6F A;  3C4B A;  4DR6 E;  4RH8 A;  4DR3 E;  2FV4 B;  4B3S E;  2M1S A;  4ZYE A;  1A1L A;  1X47 A;  2V85 A;  2VF1 A;  1LLM C;  4JI4 E;  2EOH A;  1PJT A;  4NXM E;  2RSI A;  4L8N A;  4B3M E;  4LF5 E;  1PKP A;  4RHB B;  5IV8 B;  2EMC A;  1HNZ E;  5BR8 E;  2RS6 A;  2NUF A;  2UUB E;  1T4O A;  3LLH A;  4JI2 E;  1EH8 A;  3AUZ A;  3RMP A;  3DJW A;  1A1H A;  5A6B D;  1G2F C;  1WXR A;  3DF6 A;  2EPA A;  2H36 X;  1IBM E;  2EPK X;  1XNQ E;  2WBU A;  1X49 A;  2EN8 A;  2R1F A;  4LU9 A;  2EM4 A;  2ELZ A;  4O43 A;  4DV0 E;  2ENA A;  3JTZ A;  4P78 A;  1HNX E;  1X5W A;  1N33 E;  1PJQ A;  2Q8U A;  2EP3 A;  1J26 A;  4BS9 A;  2B7V A;  1T4L B;  2LJH A;  2EQ0 A;  4F6N A;  1XMQ E;  2UUC E;  2EPL X;  4DV5 E;  2UUA E;  2LUQ A;  2RS7 A;  1A1K A;  2ELY A;  2DMY A;  2M4I A;  4WFT A;  2E72 A;  1YUJ A;  2HC5 A;  4X65 E;  2EL4 A;  2E5L E;  1DI2 A;  5KL3 A;  2L3J A;  2EN6 A;  1PJS A;  2JVA A;  2EMH A;  2L92 A;  2L2K B;  3T1H E;  1GTK A;  1O0W A;  2EMF A;  4F9B B;  3KWR A;  2LBS B;  4JI0 E;  4JI6 E;  4ZYH A;  1NCS A;  3EPK A;  5A69 A;  5KL7 A;  2EOJ A;  2EPX A;  5A6B A;  3J80 C;  1TF6 A;  1QU6 A;  4BHB A;  1YSA C;  2EM0 A;  5LMN E;  1ZU1 A;  4R2A A;  3F6G A;  4NHR A;  3VK6 A;  4O5G A;  2YTN A;  4OOG C;  5AE2 A;  2MKN A;  2JY9 A;  2YRK A;  4WSP A;  1YFH A;  1J5E E;  2EM8 A;  4IS1 C;  2YTI A;  1FJG E;  2L3C A;  5KL4 A;  4R8O A;  1RC7 A;  2B7T A;  2L8T A;  2ODR C;  3HPS A;  2I9I A;  3P1X A;  2BBG A;  1STU A;  5F3W A;  2YU5 A;  4O4K A;  2NA2 A;  3MSW A;  2B3T B;  1UBD C;  3EPH A;  5LLQ A;  1ZAA C;  1YUI A;  4JI5 E;  5KL6 A;  4DR5 E;  1A1I A;  2IHR 1;  2YT4 A;  2EE8 A;  2LVH A;  3JU0 A;  1N32 E;  2GPI A;  1B69 A;  1X6H A;  1XNR E;  2ZM6 E;  4LFC E;  1YYK A;  1A1F A;  3IWB A;  3EPL A;  3C4T A;  1ZBQ A;  5LMU E;  2EPM X;  2YTO A;  2LJU A;  4X66 E;  4M2Z A;  4MLV A;  4DMI A;  4DV4 E;  1AAY A;  1QNT A;  3AV0 A;  4JI8 E;  2L6M A;  4F2J C; 
#chains in the Genus database with same CATH homology
 2LCE A;  2VRD A;  4R2C A;  5KL2 A;  1DGC A;  2EOQ A;  2EPR A;  4M9V C;  4R2Q A;  2EP3 A;  2EJ4 A;  2ADR A;  2WBT A;  2CTD A;  2BB8 A;  2EMW A;  2EQ0 A;  1X3C A;  1X6E A;  2EMG A;  4IJD A;  4R2S A;  4F6N A;  2EM3 A;  2EOO A;  2EOX A;  2GLI A;  2EN3 A;  1A1K A;  2ELY A;  2MKD A;  2EOI A;  1BBO A;  2EMZ A;  2YTF A;  2LT7 A;  1P47 A;  2YTQ A;  2DRP A;  2E72 A;  2EN2 A;  2EOS A;  1YUJ A;  2EQ1 A;  2EN7 A;  2EL4 A;  2LO3 A;  2WBS A;  1TF3 A;  5KL3 A;  2EML A;  2EN6 A;  2YTD A;  4R2P A;  2EMH A;  2EMY A;  2EOY A;  2YRH A;  1BB8 A;  2I13 A;  4R2E A;  2JPA A;  2YRM A;  1UN6 B;  2EMF A;  2DMI A;  2ENC A;  4X9J A;  1NCS A;  1JK2 A;  3EPK A;  2M9A A;  5KL7 A;  2EOJ A;  2EPX A;  5KL5 A;  2EMA A;  2EL5 A;  1TF6 A;  2A25 A;  2CT1 A;  2EMX A;  2EOM A;  2HGH A;  3MHS C;  2JP9 A;  2EPP A;  1YSA C;  2EM0 A;  2YSO A;  1ZU1 A;  2DLK A;  1KJK A;  4R2A A;  2EPZ A;  2EM7 A;  4R2R A;  2WCC 3;  1RMD A;  2YTN A;  2YTG A;  1WJP A;  2ENH A;  3UK3 C;  2NAB A;  3VHT B;  2EPU A;  4FK5 C;  2MKN A;  1ZR9 A;  2EL6 A;  3MHH C;  2MDG A;  2DLQ A;  2YRK A;  1X6F A;  2EM8 A;  2EOZ A;  4IS1 C;  2J7J A;  2EOR A;  2YTI A;  1TN9 A;  4F6M A;  4GZN C;  2YU8 A;  5KL4 A;  1A1L A;  1LLM C;  2EOH A;  2LV2 A;  2RSI A;  2YTE A;  2EPC A;  2EM5 A;  1G2D C;  3M99 B;  2YU5 A;  2EM2 A;  3EPJ A;  2EMC A;  2YTJ A;  1UBD C;  3EPH A;  1ZAA C;  2CSH A;  1YUI A;  5KL6 A;  1A1I A;  4WSG A;  2YSP A;  1F2I G;  2EE8 A;  2LVH A;  2EM9 A;  2EMK A;  1B69 A;  1MEY C;  1X6H A;  2EN1 A;  1A1H A;  1JK1 A;  1G2F C;  2EOF A;  2EPA A;  2PRT A;  2D9H A;  2RPC A;  2EOE A;  1Z1B A;  1A1F A;  2EMI A;  4R2D A;  2WBU A;  3EPL A;  2EN4 A;  1A1G A;  2EN8 A;  2EQ3 A;  2R1F A;  2EM4 A;  2YTO A;  2ELZ A;  1A1J A;  2YTP A;  2EM6 A;  1AAY A;  2ENA A;  2GHF A;  2DGC A;  2EMB A;  4F2J C;  1X5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...