2YSOA

Solution structure of the c2h2 type zinc finger (region 656-688) of human zinc finger protein 95 homolog
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 656-688) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 95 homolog
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ysoA01
2YTEA 2EMWA 2EPPA 4R2EA 2J7JA 2DMIA 2EOQA 3MHSC 5KL4A 1A1GA 2LVHA 2GHFA 5KL5A 1ZR9A 2M9AA 2YU5A 1AAYA 2EQ1A 2EM0A 3EPLA 4R2QA 2D9HA 2YRHA 2EOJA 2EOZA 2LCEA 2EMZA 2EM8A 2LT7A 2RPCA 2EOYA 2EMGA 2MKNA 4R2DA 2EMXA 2I13A 2CT1A 2GLIA 1BB8A 2EM6A 2ELZA 2DRPA 1UN6B 2HGHA 2EM2A 2ELYA 2VRDA 2YTPA 2EN6A 2EOIA 2MKDA 4WSGA 2RSIA 2YTQA 2EMCA 2YU8A 3M99B 4X9JA 2EOXA 2EQ0A 2YSPA 1G2FC 2EMAA 2EOEA 2EORA 2ADRA 2CTDA 4FK5C 2EN7A 2EMIA 3UK3C 4IS1C 2A25A 2EN3A 1TN9A 4R2AA 1F2IG 2YRKA 4R2CA 1JK1A 1Z1BA 2MDGA 2EOFA 1X6HA 1YUJA 2NABA 2WBUA 1JK2A 2PRTA 2EOHA 2EMFA 2YTDA 3EPHA 1A1JA 1KJKA 4M9VC 2EM5A 2EOOA 1X5WA 1LLMC 1BBOA 2EMKA 2CSHA 4R2RA 1A1IA 1UBDC 2EM4A 1A1FA 1P47A 1ZAAC 2EN4A 2EN1A 1A1KA 2EPXA 1X6FA 2WBTA 5KL6A 2EL4A 2EQ3A 4R2PA 1A1HA 2EPUA 2DLQA 4R2SA 2YTNA 1WJPA 2EJ4A 2EM3A 3EPKA 2EPZA 2WCC3 5KL7A 2JPAA 1NCSA 1TF6A 2EMBA 3MHHC 2YRMA 4GZNC 2YTGA 3EPJA 2YTFA 2YTOA 1YSAC 2BB8A 2EOSA 2R1FA 1MEYC 2YTIA 1X6EA 5KL2A 2EMHA 2DLKA 2LV2A 4IJDA 2EPCA 2EL5A 3VHTB 2EOMA 2E72A 4F6NA 2YTJA 1TF3A 1YUIA 2EM9A 1ZU1A 2YSOA 2EL6A 2ENHA 1RMDA 2EPRA 2EN8A 1G2DC 2EE8A 2WBSA 1X3CA 1A1LA 4F2JC 2ENCA 1DGCA 4F6MA 2JP9A 2EMLA 2EM7A 2LO3A 2EMYA 2EPAA 2EN2A 2EP3A 1B69A 2DGCA 2ENAA 5KL3A
chains in the Genus database with same CATH superfamily
2YTEA 5F3WA 4R2EA 2J7JA 5LL6R 2N3HA 5BR8E 4DV5E 2LBSB 1A1GA 2F8BA 5KL5A 4JI5E 2M9AA 2UXBE 2EM0A 4X8WA 3VK6A 2M4IA 4R2QA 2EOZA 1IBME 2EMZA 2EM8A 4F54A 1X48A 1T4OA 4RHBB 2I13A 2CT1A 2DRPA 3C6MA 4JI8E 4J8ZA 2LE2A 5AE3A 4F9BB 4BHCA 5A6AA 4L5NC 2EOXA 4BCAA 2B3TB 3F6GA 2EN7A 4B3RE 2EN3A 2F4VE 1F2IG 4LFBE 4R2CA 3T1HE 4LF5E 2L2MA 1Z1BA 4WPYA 1N36E 2G7HA 2V86A 3IWCA 2PRTA 1WRJA 2N8XA 5AC5A 3EPHA 2JOBA 4F9CB 4ZYDA 1KJKA 1GZ6A 3J81C 2DMYA 2EM5A 2ODRC 1X5WA 3EQ1A 3HXLA 2N3GA 1UBDC 2EM4A 1A1FA 1X49A 2Q8UA 1P47A 5A6JA 4DR5E 1A1KA 1T38A 2K7IA 1X6FA 3H09A 2ZM6E 4N4RB 4JI3E 1AH5A 2EPUA 2YWQA 4R2SA 3IWDA 2EJ4A 1QU6A 5FLXC 2MDRA 2VE7C 1NCSA 4LF7E 2EMBA 3MHHC 2HJJA 3J7AG 3ADGA 4LF8E 2YTFA 2B7TA 2YT4A 1I94E 5KL2A 2EMHA 4BS9A 4DMIA 2LV2A 4BBYA 5A6KA 1EH7A 3T1YE 2V8QB 4K0KE 3AV0A 2JR1A 2B7VA 4X65E 3VHTB 2E72A 1ZBQA 1TF3A 2EM9A 4TUGA 2VQFE 4OOGC 3AUZA 2L3CA 4DV0E 2JP9A 2EMLA 2LO3A 2EMYA 2EPAA 2LTSA 1XNRE 2EN2A 2YRHA 2GPIA 1L4SA 2EZ6A 4P7DA 2EPPA 2LJUA 4LF4E 3THOB 2UXDE 1YYWA 2EOQA 5AE2A 1HR0E 2EPOA 2RTXA 2GHFA 1UILA 2YU5A 4O24A 4ZYGA 2FV4B 4BC9A 4WXDA 2EMGA 4YHHE 2DIXA 1T4LB 1HNXE 2ELZA 4DR7E 3BIDA 2ELYA 2YTPA 4DR3E 2EOIA 4WSPA 3LMLA 1XMOE 1UHZA 3ECRA 2EMCA 5AC4A 3M99B 4LFCE 2JXPA 1O0WA 5AE1A 2JWOA 2EOEA 2L3JA 2CTDA 2JY9A 2EMIA 2MC5A 3HTXA 5CFFE 4DV3E 1X6HA 3IWBA 1YUJA 1XMQE 1KYQA 3BBGA 1A1JA 5LMUE 2EOOA 2EPMX 4O43A 4R03A 1XNQE 4GKJE 4KWYA 1LLMC 1PDAA 2EPKX 1A1IA 1NEIA 1YYKA 4DR1E 3HPSA 2EN1A 1N32E 2EPXA 5KL6A 3HPZA 5TSEA 1STUA 4WXCA 4LF9E 4I8OA 2EPNA 2LRSA 4B3ME 3C4TA 4B3TE 3TQMA 1GTKA 1RQ0A 3OTOE 1RC7A 1YSAC 2YTIA 4P78A 3VYYA 4IJDA 4JI7E 1YFHA 1WHQA 2LUPB 4JI6E 3BGHA 4F6NA 1HNWE 1EKZA 2NA2A 1PJQA 2EL6A 2ENHA 4KZSA 1X3CA 4F2JC 1DGCA 4F6MA 5IV8B 2EM7A 4X64E 4DV7E 1IQSA 1B69A 2UUAE 5IXMB 5KL3A 1HNZE 1WHNA 2EMWA 4HTGA 1DI2A 2DMIA 3MHSC 5KL4A 4JI4E 2LVHA 5A69A 1IMUA 4DV2E 4JI1E 4ZYEA 4X66E 2LCEA 2LT7A 2EOYA 4DUZE 2MKNA 1QNTA 2EMXA 2RQLA 2GLIA 2L2KB 1IBKE 4DUYE 2HGHA 2EM2A 4JV5E 4NXNE 3ADIA 1EH8A 2VRDA 2L92A 2WZOA 4WSGA 4BC7A 3C6KA 2YU8A 2M7QA 2LTRA 2UUCE 4GKKE 2NUFA 2YSPA 3JTZA 2EMAA 1J26A 2EWLA 1X47A 1YPNA 4FK5C 4HEIA 3QG5C 4IS1C 2ODRD 4R2AA 2YRKA 3FIGA 1JK1A 2EOFA 2KHXA 1SR9A 2NABA 2WBUA 2MC6A 3C4BA 2EOHA 2EMFA 1J5EE 1MGTA 4AQYE 4DKKA 4NZVA 5A6BA 4L8NA 1YYOA 4R2RA 4M0VA 5AASA 2B9DA 2HC5A 2EN4A 3K6QA 2JYAA 1T4NA 2WBTA 2EL4A 2EPLX 4R2PA 1A1HA 1T39A 2YTNA 4OX9E 3RMPA 2EPZA 5KL7A 2YPNA 2JPAA 1PJSA 2IHR1 2LUQA 4BHBA 2YRMA 2CPNA 2DB2A 2YTGA 4GZNC 2I9IA 2L33A 3ADLA 5DNYA 1WXRA 1N33E 4LU9A 2L6MA 4BMJA 2BB8A 3J7Yp 1MEYC 2V85A 1EH6A 2E1MA 2DLKA 4JYAE 2KOUA 3HQ1A 1IQOA 2UXCE 2EPCA 2L8TA 2EL5A 2UU9E 2EOMA 4WFTA 2JOXA 1YUIA 2KONA 3J80C 2EE8A 1A1LA 2RS7A 2H36X 2V88A 2L2NA 2EP3A 1GQEA 2ENAA 4Q35B 3F6HA 2FTXB 5LMNE 1ZR9A 1YZ9A 1AAYA 2EQ1A 4ZYHA 3P1XA 3EPLA 3JAMC 4JI2E 2JVAA 5A2QC 2D9HA 1PKPA 2EOJA 2RS6A 2VF1A 4RH8A 2RPCA 4R2DA 4F9AB 1BB8A 2EM6A 3JU0A 1UN6B 1FKAE 5ADZA 4MLQA 2EN6A 2MKDA 4NHRA 2RSIA 2YTQA 4M2ZA 1DQ3A 2V89A 4X9JA 4MLVA 2EQ0A 4DR6E 5LLQA 1G2FC 5IWAE 2EORA 4LTYA 2ADRA 4KHPE 3ZOQB 1BBGA 3UK3C 2V87A 2A25A 1TN9A 2MDGA 1JK2A 1N34E 2HHHE 2YTDA 4M9VC 4X62E 1BBOA 1IBLE 2EMKA 1FJGE 2CSHA 5IT9C 4NXME 4M30A 3KWRA 1ZAAC 4JI0E 4O5GA 4LF6E 2YZTA 3DF6A 2LJHA 2NUEA 3LLHA 4DR4E 2UUBE 2EQ3A 4R8OA 5T6JA 2DLQA 1WJPA 3BF2A 2EM3A 3EPKA 2WCC3 2M1SA 3DJWA 1TF6A 2NUGA 3THNA 4TUIA 4O4KA 3KZYA 3EPJA 2E5LE 4WX9A 1PJTA 2YTOA 1N3GA 3OMLA 4GEQB 2R76A 2EOSA 2R1FA 3VYXA 1X6EA 2FGGA 4DV1E 2DSYA 2BBGA 3L00A 3ADJA 4DR2E 4Q28A 4YY3E 4DV6E 2YTJA 4LFAE 3MSWA 1ZU1A 2YSOA 2V83A 1SFEA 2EPRA 1RMDA 2EN8A 3KZZA 1G2DC 2WBSA 4DV4E 1ZBTA 2ENCA 4B3SE 2K4VA 5A6BD 2RSMA 4WYQB 2VQEE 2LMZA 2DGCA
chains in the Genus database with same CATH topology
2YTEA 2EMWA 2EPPA 4R2EA 2J7JA 2DMIA 2EOQA 3MHSC 5KL4A 1A1GA 2LVHA 2GHFA 5KL5A 1ZR9A 2M9AA 2YU5A 1AAYA 2EQ1A 2EM0A 3EPLA 4R2QA 2D9HA 2YRHA 2EOJA 2EOZA 2LCEA 2EMZA 2EM8A 2LT7A 2RPCA 2EOYA 2EMGA 2MKNA 4R2DA 2EMXA 2I13A 2CT1A 2GLIA 1BB8A 2EM6A 2ELZA 2DRPA 1UN6B 2HGHA 2EM2A 2ELYA 2VRDA 2YTPA 2EN6A 2EOIA 2MKDA 4WSGA 2RSIA 2YTQA 2EMCA 2YU8A 3M99B 4X9JA 2EOXA 2EQ0A 2YSPA 1G2FC 2EMAA 2EOEA 2EORA 2ADRA 2CTDA 4FK5C 2EN7A 2EMIA 3UK3C 4IS1C 2A25A 2EN3A 1TN9A 4R2AA 1F2IG 2YRKA 4R2CA 1JK1A 1Z1BA 2MDGA 2EOFA 1X6HA 1YUJA 2NABA 2WBUA 1JK2A 2PRTA 2EOHA 2EMFA 2YTDA 3EPHA 1A1JA 1KJKA 4M9VC 2EM5A 2EOOA 1X5WA 1LLMC 1BBOA 2EMKA 2CSHA 4R2RA 1A1IA 1UBDC 2EM4A 1A1FA 1P47A 1ZAAC 2EN4A 2EN1A 1A1KA 2EPXA 1X6FA 2WBTA 5KL6A 2EL4A 2EQ3A 4R2PA 1A1HA 2EPUA 2DLQA 4R2SA 2YTNA 1WJPA 2EJ4A 2EM3A 3EPKA 2EPZA 2WCC3 5KL7A 2JPAA 1NCSA 1TF6A 2EMBA 3MHHC 2YRMA 4GZNC 2YTGA 3EPJA 2YTFA 2YTOA 1YSAC 2BB8A 2EOSA 2R1FA 1MEYC 2YTIA 1X6EA 5KL2A 2EMHA 2DLKA 2LV2A 4IJDA 2EPCA 2EL5A 3VHTB 2EOMA 2E72A 4F6NA 2YTJA 1TF3A 1YUIA 2EM9A 1ZU1A 2YSOA 2EL6A 2ENHA 1RMDA 2EPRA 2EN8A 1G2DC 2EE8A 2WBSA 1X3CA 1A1LA 4F2JC 2ENCA 1DGCA 4F6MA 2JP9A 2EMLA 2EM7A 2LO3A 2EMYA 2EPAA 2EN2A 2EP3A 1B69A 2DGCA 2ENAA 5KL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTE A;  2EMW A;  2EPP A;  4R2E A;  2J7J A;  2DMI A;  2EOQ A;  3MHS C;  5KL4 A;  1A1G A;  2LVH A;  2GHF A;  5KL5 A;  1ZR9 A;  2M9A A;  2YU5 A;  1AAY A;  2EQ1 A;  2EM0 A;  3EPL A;  4R2Q A;  2D9H A;  2YRH A;  2EOJ A;  2EOZ A;  2LCE A;  2EMZ A;  2EM8 A;  2LT7 A;  2RPC A;  2EOY A;  2EMG A;  2MKN A;  4R2D A;  2EMX A;  2I13 A;  2CT1 A;  2GLI A;  1BB8 A;  2EM6 A;  2ELZ A;  2DRP A;  1UN6 B;  2HGH A;  2EM2 A;  2ELY A;  2VRD A;  2YTP A;  2EN6 A;  2EOI A;  2MKD A;  4WSG A;  2RSI A;  2YTQ A;  2EMC A;  2YU8 A;  3M99 B;  4X9J A;  2EOX A;  2EQ0 A;  2YSP A;  1G2F C;  2EMA A;  2EOE A;  2EOR A;  2ADR A;  2CTD A;  4FK5 C;  2EN7 A;  2EMI A;  3UK3 C;  4IS1 C;  2A25 A;  2EN3 A;  1TN9 A;  4R2A A;  1F2I G;  2YRK A;  4R2C A;  1JK1 A;  1Z1B A;  2MDG A;  2EOF A;  1X6H A;  1YUJ A;  2NAB A;  2WBU A;  1JK2 A;  2PRT A;  2EOH A;  2EMF A;  2YTD A;  3EPH A;  1A1J A;  1KJK A;  4M9V C;  2EM5 A;  2EOO A;  1X5W A;  1LLM C;  1BBO A;  2EMK A;  2CSH A;  4R2R A;  1A1I A;  1UBD C;  2EM4 A;  1A1F A;  1P47 A;  1ZAA C;  2EN4 A;  2EN1 A;  1A1K A;  2EPX A;  1X6F A;  2WBT A;  5KL6 A;  2EL4 A;  2EQ3 A;  4R2P A;  1A1H A;  2EPU A;  2DLQ A;  4R2S A;  2YTN A;  1WJP A;  2EJ4 A;  2EM3 A;  3EPK A;  2EPZ A;  2WCC 3;  5KL7 A;  2JPA A;  1NCS A;  1TF6 A;  2EMB A;  3MHH C;  2YRM A;  4GZN C;  2YTG A;  3EPJ A;  2YTF A;  2YTO A;  1YSA C;  2BB8 A;  2EOS A;  2R1F A;  1MEY C;  2YTI A;  1X6E A;  5KL2 A;  2EMH A;  2DLK A;  2LV2 A;  4IJD A;  2EPC A;  2EL5 A;  3VHT B;  2EOM A;  2E72 A;  4F6N A;  2YTJ A;  1TF3 A;  1YUI A;  2EM9 A;  1ZU1 A;  2YSO A;  2EL6 A;  2ENH A;  1RMD A;  2EPR A;  2EN8 A;  1G2D C;  2EE8 A;  2WBS A;  1X3C A;  1A1L A;  4F2J C;  2ENC A;  1DGC A;  4F6M A;  2JP9 A;  2EML A;  2EM7 A;  2LO3 A;  2EMY A;  2EPA A;  2EN2 A;  2EP3 A;  1B69 A;  2DGC A;  2ENA A;  5KL3 A; 
#chains in the Genus database with same CATH topology
 2YTE A;  5F3W A;  4R2E A;  2J7J A;  5LL6 R;  2N3H A;  5BR8 E;  4DV5 E;  2LBS B;  1A1G A;  2F8B A;  5KL5 A;  4JI5 E;  2M9A A;  2UXB E;  2EM0 A;  4X8W A;  3VK6 A;  2M4I A;  4R2Q A;  2EOZ A;  1IBM E;  2EMZ A;  2EM8 A;  4F54 A;  1X48 A;  1T4O A;  4RHB B;  2I13 A;  2CT1 A;  2DRP A;  3C6M A;  4JI8 E;  4J8Z A;  2LE2 A;  5AE3 A;  4F9B B;  4BHC A;  5A6A A;  4L5N C;  2EOX A;  4BCA A;  2B3T B;  3F6G A;  2EN7 A;  4B3R E;  2EN3 A;  2F4V E;  1F2I G;  4LFB E;  4R2C A;  3T1H E;  4LF5 E;  2L2M A;  1Z1B A;  4WPY A;  1N36 E;  2G7H A;  2V86 A;  3IWC A;  2PRT A;  1WRJ A;  2N8X A;  5AC5 A;  3EPH A;  2JOB A;  4F9C B;  4ZYD A;  1KJK A;  1GZ6 A;  3J81 C;  2DMY A;  2EM5 A;  2ODR C;  1X5W A;  3EQ1 A;  3HXL A;  2N3G A;  1UBD C;  2EM4 A;  1A1F A;  1X49 A;  2Q8U A;  1P47 A;  5A6J A;  4DR5 E;  1A1K A;  1T38 A;  2K7I A;  1X6F A;  3H09 A;  2ZM6 E;  4N4R B;  4JI3 E;  1AH5 A;  2EPU A;  2YWQ A;  4R2S A;  3IWD A;  2EJ4 A;  1QU6 A;  5FLX C;  2MDR A;  2VE7 C;  1NCS A;  4LF7 E;  2EMB A;  3MHH C;  2HJJ A;  3J7A G;  3ADG A;  4LF8 E;  2YTF A;  2B7T A;  2YT4 A;  1I94 E;  5KL2 A;  2EMH A;  4BS9 A;  4DMI A;  2LV2 A;  4BBY A;  5A6K A;  1EH7 A;  3T1Y E;  2V8Q B;  4K0K E;  3AV0 A;  2JR1 A;  2B7V A;  4X65 E;  3VHT B;  2E72 A;  1ZBQ A;  1TF3 A;  2EM9 A;  4TUG A;  2VQF E;  4OOG C;  3AUZ A;  2L3C A;  4DV0 E;  2JP9 A;  2EML A;  2LO3 A;  2EMY A;  2EPA A;  2LTS A;  1XNR E;  2EN2 A;  2YRH A;  2GPI A;  1L4S A;  2EZ6 A;  4P7D A;  2EPP A;  2LJU A;  4LF4 E;  3THO B;  2UXD E;  1YYW A;  2EOQ A;  5AE2 A;  1HR0 E;  2EPO A;  2RTX A;  2GHF A;  1UIL A;  2YU5 A;  4O24 A;  4ZYG A;  2FV4 B;  4BC9 A;  4WXD A;  2EMG A;  4YHH E;  2DIX A;  1T4L B;  1HNX E;  2ELZ A;  4DR7 E;  3BID A;  2ELY A;  2YTP A;  4DR3 E;  2EOI A;  4WSP A;  3LML A;  1XMO E;  1UHZ A;  3ECR A;  2EMC A;  5AC4 A;  3M99 B;  4LFC E;  2JXP A;  1O0W A;  5AE1 A;  2JWO A;  2EOE A;  2L3J A;  2CTD A;  2JY9 A;  2EMI A;  2MC5 A;  3HTX A;  5CFF E;  4DV3 E;  1X6H A;  3IWB A;  1YUJ A;  1XMQ E;  1KYQ A;  3BBG A;  1A1J A;  5LMU E;  2EOO A;  2EPM X;  4O43 A;  4R03 A;  1XNQ E;  4GKJ E;  4KWY A;  1LLM C;  1PDA A;  2EPK X;  1A1I A;  1NEI A;  1YYK A;  4DR1 E;  3HPS A;  2EN1 A;  1N32 E;  2EPX A;  5KL6 A;  3HPZ A;  5TSE A;  1STU A;  4WXC A;  4LF9 E;  4I8O A;  2EPN A;  2LRS A;  4B3M E;  3C4T A;  4B3T E;  3TQM A;  1GTK A;  1RQ0 A;  3OTO E;  1RC7 A;  1YSA C;  2YTI A;  4P78 A;  3VYY A;  4IJD A;  4JI7 E;  1YFH A;  1WHQ A;  2LUP B;  4JI6 E;  3BGH A;  4F6N A;  1HNW E;  1EKZ A;  2NA2 A;  1PJQ A;  2EL6 A;  2ENH A;  4KZS A;  1X3C A;  4F2J C;  1DGC A;  4F6M A;  5IV8 B;  2EM7 A;  4X64 E;  4DV7 E;  1IQS A;  1B69 A;  2UUA E;  5IXM B;  5KL3 A;  1HNZ E;  1WHN A;  2EMW A;  4HTG A;  1DI2 A;  2DMI A;  3MHS C;  5KL4 A;  4JI4 E;  2LVH A;  5A69 A;  1IMU A;  4DV2 E;  4JI1 E;  4ZYE A;  4X66 E;  2LCE A;  2LT7 A;  2EOY A;  4DUZ E;  2MKN A;  1QNT A;  2EMX A;  2RQL A;  2GLI A;  2L2K B;  1IBK E;  4DUY E;  2HGH A;  2EM2 A;  4JV5 E;  4NXN E;  3ADI A;  1EH8 A;  2VRD A;  2L92 A;  2WZO A;  4WSG A;  4BC7 A;  3C6K A;  2YU8 A;  2M7Q A;  2LTR A;  2UUC E;  4GKK E;  2NUF A;  2YSP A;  3JTZ A;  2EMA A;  1J26 A;  2EWL A;  1X47 A;  1YPN A;  4FK5 C;  4HEI A;  3QG5 C;  4IS1 C;  2ODR D;  4R2A A;  2YRK A;  3FIG A;  1JK1 A;  2EOF A;  2KHX A;  1SR9 A;  2NAB A;  2WBU A;  2MC6 A;  3C4B A;  2EOH A;  2EMF A;  1J5E E;  1MGT A;  4AQY E;  4DKK A;  4NZV A;  5A6B A;  4L8N A;  1YYO A;  4R2R A;  4M0V A;  5AAS A;  2B9D A;  2HC5 A;  2EN4 A;  3K6Q A;  2JYA A;  1T4N A;  2WBT A;  2EL4 A;  2EPL X;  4R2P A;  1A1H A;  1T39 A;  2YTN A;  4OX9 E;  3RMP A;  2EPZ A;  5KL7 A;  2YPN A;  2JPA A;  1PJS A;  2IHR 1;  2LUQ A;  4BHB A;  2YRM A;  2CPN A;  2DB2 A;  2YTG A;  4GZN C;  2I9I A;  2L33 A;  3ADL A;  5DNY A;  1WXR A;  1N33 E;  4LU9 A;  2L6M A;  4BMJ A;  2BB8 A;  3J7Y p;  1MEY C;  2V85 A;  1EH6 A;  2E1M A;  2DLK A;  4JYA E;  2KOU A;  3HQ1 A;  1IQO A;  2UXC E;  2EPC A;  2L8T A;  2EL5 A;  2UU9 E;  2EOM A;  4WFT A;  2JOX A;  1YUI A;  2KON A;  3J80 C;  2EE8 A;  1A1L A;  2RS7 A;  2H36 X;  2V88 A;  2L2N A;  2EP3 A;  1GQE A;  2ENA A;  4Q35 B;  3F6H A;  2FTX B;  5LMN E;  1ZR9 A;  1YZ9 A;  1AAY A;  2EQ1 A;  4ZYH A;  3P1X A;  3EPL A;  3JAM C;  4JI2 E;  2JVA A;  5A2Q C;  2D9H A;  1PKP A;  2EOJ A;  2RS6 A;  2VF1 A;  4RH8 A;  2RPC A;  4R2D A;  4F9A B;  1BB8 A;  2EM6 A;  3JU0 A;  1UN6 B;  1FKA E;  5ADZ A;  4MLQ A;  2EN6 A;  2MKD A;  4NHR A;  2RSI A;  2YTQ A;  4M2Z A;  1DQ3 A;  2V89 A;  4X9J A;  4MLV A;  2EQ0 A;  4DR6 E;  5LLQ A;  1G2F C;  5IWA E;  2EOR A;  4LTY A;  2ADR A;  4KHP E;  3ZOQ B;  1BBG A;  3UK3 C;  2V87 A;  2A25 A;  1TN9 A;  2MDG A;  1JK2 A;  1N34 E;  2HHH E;  2YTD A;  4M9V C;  4X62 E;  1BBO A;  1IBL E;  2EMK A;  1FJG E;  2CSH A;  5IT9 C;  4NXM E;  4M30 A;  3KWR A;  1ZAA C;  4JI0 E;  4O5G A;  4LF6 E;  2YZT A;  3DF6 A;  2LJH A;  2NUE A;  3LLH A;  4DR4 E;  2UUB E;  2EQ3 A;  4R8O A;  5T6J A;  2DLQ A;  1WJP A;  3BF2 A;  2EM3 A;  3EPK A;  2WCC 3;  2M1S A;  3DJW A;  1TF6 A;  2NUG A;  3THN A;  4TUI A;  4O4K A;  3KZY A;  3EPJ A;  2E5L E;  4WX9 A;  1PJT A;  2YTO A;  1N3G A;  3OML A;  4GEQ B;  2R76 A;  2EOS A;  2R1F A;  3VYX A;  1X6E A;  2FGG A;  4DV1 E;  2DSY A;  2BBG A;  3L00 A;  3ADJ A;  4DR2 E;  4Q28 A;  4YY3 E;  4DV6 E;  2YTJ A;  4LFA E;  3MSW A;  1ZU1 A;  2YSO A;  2V83 A;  1SFE A;  2EPR A;  1RMD A;  2EN8 A;  3KZZ A;  1G2D C;  2WBS A;  4DV4 E;  1ZBT A;  2ENC A;  4B3S E;  2K4V A;  5A6B D;  2RSM A;  4WYQ B;  2VQE E;  2LMZ A;  2DGC A; 
#chains in the Genus database with same CATH homology
 2YTE A;  2EMW A;  2EPP A;  4R2E A;  2J7J A;  2DMI A;  2EOQ A;  3MHS C;  5KL4 A;  1A1G A;  2LVH A;  2GHF A;  5KL5 A;  1ZR9 A;  2M9A A;  2YU5 A;  1AAY A;  2EQ1 A;  2EM0 A;  3EPL A;  4R2Q A;  2D9H A;  2YRH A;  2EOJ A;  2EOZ A;  2LCE A;  2EMZ A;  2EM8 A;  2LT7 A;  2RPC A;  2EOY A;  2EMG A;  2MKN A;  4R2D A;  2EMX A;  2I13 A;  2CT1 A;  2GLI A;  1BB8 A;  2EM6 A;  2ELZ A;  2DRP A;  1UN6 B;  2HGH A;  2EM2 A;  2ELY A;  2VRD A;  2YTP A;  2EN6 A;  2EOI A;  2MKD A;  4WSG A;  2RSI A;  2YTQ A;  2EMC A;  2YU8 A;  3M99 B;  4X9J A;  2EOX A;  2EQ0 A;  2YSP A;  1G2F C;  2EMA A;  2EOE A;  2EOR A;  2ADR A;  2CTD A;  4FK5 C;  2EN7 A;  2EMI A;  3UK3 C;  4IS1 C;  2A25 A;  2EN3 A;  1TN9 A;  4R2A A;  1F2I G;  2YRK A;  4R2C A;  1JK1 A;  1Z1B A;  2MDG A;  2EOF A;  1X6H A;  1YUJ A;  2NAB A;  2WBU A;  1JK2 A;  2PRT A;  2EOH A;  2EMF A;  2YTD A;  3EPH A;  1A1J A;  1KJK A;  4M9V C;  2EM5 A;  2EOO A;  1X5W A;  1LLM C;  1BBO A;  2EMK A;  2CSH A;  4R2R A;  1A1I A;  1UBD C;  2EM4 A;  1A1F A;  1P47 A;  1ZAA C;  2EN4 A;  2EN1 A;  1A1K A;  2EPX A;  1X6F A;  2WBT A;  5KL6 A;  2EL4 A;  2EQ3 A;  4R2P A;  1A1H A;  2EPU A;  2DLQ A;  4R2S A;  2YTN A;  1WJP A;  2EJ4 A;  2EM3 A;  3EPK A;  2EPZ A;  2WCC 3;  5KL7 A;  2JPA A;  1NCS A;  1TF6 A;  2EMB A;  3MHH C;  2YRM A;  4GZN C;  2YTG A;  3EPJ A;  2YTF A;  2YTO A;  1YSA C;  2BB8 A;  2EOS A;  2R1F A;  1MEY C;  2YTI A;  1X6E A;  5KL2 A;  2EMH A;  2DLK A;  2LV2 A;  4IJD A;  2EPC A;  2EL5 A;  3VHT B;  2EOM A;  2E72 A;  4F6N A;  2YTJ A;  1TF3 A;  1YUI A;  2EM9 A;  1ZU1 A;  2YSO A;  2EL6 A;  2ENH A;  1RMD A;  2EPR A;  2EN8 A;  1G2D C;  2EE8 A;  2WBS A;  1X3C A;  1A1L A;  4F2J C;  2ENC A;  1DGC A;  4F6M A;  2JP9 A;  2EML A;  2EM7 A;  2LO3 A;  2EMY A;  2EPA A;  2EN2 A;  2EP3 A;  1B69 A;  2DGC A;  2ENA A;  5KL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...