2EL6A

Solution structure of the 21th zf-c2h2 domain from human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGAGVNPYKCSQCEKSFSGKLRLLVHQRMHTREKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the 21th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el6A00
1A1GA 1A1KA 2JPAA 1TN9A 3EPLA 2YTNA 3EPKA 2LV2A 4FK5C 1ZAAC 2EMAA 2EMWA 1JK2A 2RSIA 1YUIA 2GHFA 1RMDA 2DMIA 2D9HA 1A1HA 2YU8A 4R2CA 1AAYA 1X5WA 2ENHA 2ELYA 2EMXA 2YTPA 1UN6B 4R2PA 2CSHA 2YTQA 2EQ3A 1KJKA 2DRPA 2LCEA 2CT1A 5KL3A 2HGHA 2YTJA 1ZR9A 1A1FA 2NABA 2EM2A 2YTDA 1MEYC 2EQ1A 4R2QA 2EM9A 2YSPA 2EQ0A 4F6NA 2DGCA 1YUJA 2BB8A 1TF6A 2A25A 3VHTB 1X6FA 2DLKA 2EN1A 2EM5A 2YTGA 4GZNC 1G2DC 2EN3A 2EOEA 2EOHA 2ELZA 2VRDA 2LT7A 2WCC3 2EPRA 2MDGA 4F6MA 4M9VC 1P47A 2EN6A 2EMLA 2RPCA 2EM6A 5KL2A 2EE8A 2EPAA 2EPCA 2EMKA 2EOJA 5KL6A 1B69A 2CTDA 2YU5A 2EM8A 2EOMA 2E72A 2EOIA 1F2IG 5KL4A 2YTIA 2R1FA 2MKDA 2EMIA 2YTOA 2EMZA 2EM7A 2ADRA 2YRHA 2EL4A 1A1JA 1G2FC 2EMCA 2EOXA 1ZU1A 2EOSA 2WBSA 1JK1A 1NCSA 4R2EA 2DLQA 2EP3A 1X3CA 2EM0A 2EOYA 3UK3C 2MKNA 3EPHA 2YTFA 1WJPA 2EOOA 2EMHA 4IJDA 1LLMC 4R2DA 2ENCA 1A1IA 1DGCA 2WBUA 2EN7A 2PRTA 4F2JC 1Z1BA 2EM4A 2WBTA 2LVHA 2EMFA 3M99B 1X6HA 2YTEA 2EL5A 2GLIA 3EPJA 2EPPA 2EL6A 2LO3A 1YSAC 4R2SA 2EN4A 2EMBA 4WSGA 4R2RA 2EOQA 1A1LA 1TF3A 2J7JA 2YRMA 5KL5A 2EOFA 2EN8A 2EPUA 4IS1C 2EM3A 2YSOA 3MHSC 5KL7A 2JP9A 1UBDC 4R2AA 2EJ4A 2EPZA 1X6EA 2EMYA 4X9JA 2EORA 2I13A 3MHHC 2M9AA 2EOZA 2EN2A 1BB8A 2EPXA 2ENAA 2YRKA 1BBOA 2EMGA
chains in the Genus database with same CATH superfamily
3KZZA 2WZOA 2RTXA 2YTNA 3EPKA 4RHBB 4FK5C 2EMWA 2LMZA 2RSIA 4DUYE 3EQ1A 1RMDA 2YU8A 2K7IA 4R2CA 4YY3E 2ELYA 1DI2A 1HNXE 1FJGE 2GPIA 2LJHA 4DV0E 5KL3A 2N3HA 2V85A 4LFAE 4JI3E 2L3CA 1MEYC 5A2QC 4P78A 2EM9A 2VQFE 1T38A 1TF6A 3VHTB 2L3JA 3LMLA 2E1MA 4BCAA 4GZNC 5A6JA 2EOHA 2NUFA 2WCC3 2YT4A 1WHQA 2EE8A 2EPCA 2CTDA 1ZBQA 5KL4A 4BBYA 4TUIA 5IXMB 1IQOA 2EPKX 2VQEE 2LRSA 4DV2E 4X64E 2EOXA 2EOSA 1DQ3A 2DLQA 2EP3A 2EM0A 2RQLA 2EOYA 3UK3C 3EPHA 4DR5E 2YTFA 1WJPA 2V87A 1PKPA 5A69A 2EMHA 2MC5A 3RMPA 3ADJA 2K4VA 4DV6E 1DGCA 1SFEA 2BBGA 4KWYA 2LTSA 5IT9C 1X47A 3HTXA 5AE1A 4J8ZA 2LVHA 2GLIA 4LF4E 4WSPA 1N36E 4WSGA 4MLVA 4NZVA 2UUBE 2EOQA 3IWBA 1TF3A 1BBGA 1GTKA 2J7JA 4F9BB 5TSEA 2B7VA 2JR1A 3FIGA 4ZYHA 2UUCE 5AE2A 5KL7A 4OX9E 4ZYDA 2M1SA 2KONA 4NXNE 4DR7E 1N3GA 1NEIA 2LJUA 3ADIA 2EMYA 4JI5E 2EORA 2V88A 3MHHC 2EN2A 1J5EE 2YRKA 3IWDA 2RS6A 4M30A 1A1GA 2B7TA 1TN9A 2UXDE 1WRJA 5F3WA 2LV2A 2V8QB 2EMAA 4DR4E 3TQMA 5BR8E 4DV1E 2GHFA 3LLHA 2LE2A 5A6BD 2DMIA 2D9HA 1A1HA 4WX9A 4JV5E 3HPZA 2YWQA 2EQ3A 2ODRC 2HJJA 4ZYGA 2L33A 1T39A 2HGHA 2EM2A 3JAMC 4DUZE 1X48A 2VE7C 4R2QA 2EQ0A 4F6NA 1T4LB 1YUJA 1WHNA 5A6KA 2A25A 2LUQA 2DLKA 4LF8E 3BIDA 1G2DC 4LFBE 4BC7A 3THNA 1STUA 2DB2A 2ELZA 2VRDA 3JU0A 3J7Yp 2LT7A 2UXBE 4R03A 2EPRA 2MDGA 1YFHA 1P47A 2EM6A 2KHXA 2EMKA 2EOJA 4DV5E 2ODRD 4M0VA 2EOIA 5LL6R 3OTOE 2MKDA 2YTOA 1XMQE 2JVAA 2ADRA 2LUPB 4N4RB 2YRHA 2F8BA 4NHRA 2EMCA 2DIXA 1JK1A 1NCSA 2EPOA 5CFFE 3HPSA 1T4OA 5LMNE 5IV8B 2EZ6A 2F4VE 2EOOA 1LLMC 1KYQA 1O0WA 1T4NA 2JOXA 2ENCA 4B3ME 4O4KA 3H09A 2L2NA 2PRTA 2EM4A 3ECRA 1X6HA 3EPJA 4R8OA 2EPPA 5T6JA 1YSAC 4R2SA 1YYOA 4F9CB 2EMBA 4R2RA 1A1LA 2V86A 3J81C 3J7AG 4LF6E 2EN8A 2EPUA 4O43A 4IS1C 4B3TE 2L2KB 2YSOA 1J26A 2H36X 4GKKE 3C6MA 2L92A 4LF7E 1UILA 4HTGA 2L2MA 2EPZA 1X6EA 3DF6A 3VYYA 1RC7A 3KZYA 1WXRA 2L8TA 2E5LE 3J80C 3P1XA 2M4IA 4DKKA 1A1KA 2JPAA 5A6AA 3EPLA 5DNYA 2JWOA 2V89A 1HNWE 1ZAAC 4M2ZA 3THOB 1YUIA 4B3SE 3ADLA 1N33E 4LFCE 4JI4E 1XNRE 1GZ6A 2ENHA 2EMXA 1UN6B 4R2PA 1KJKA 2DRPA 3BBGA 2CT1A 3AUZA 1EH7A 4KHPE 1PDAA 3F6GA 2NABA 1EKZA 2YPNA 2EQ1A 3C4BA 2DGCA 1AH5A 3K6QA 5AC4A 1X6FA 2DMYA 2EN1A 2FGGA 4RH8A 3T1HE 2NUGA 2EN3A 5A6BA 1IBLE 4WFTA 4X62E 4GEQB 5IWAE 4M9VC 4BS9A 2EN6A 2L6MA 4YHHE 2RPCA 2EPAA 1N32E 5AASA 4O5GA 3T1YE 3IWCA 4JI6E 2FTXB 2EOMA 1HNZE 4F9AB 1FKAE 4LTYA 4HEIA 2DSYA 2EL4A 3L00A 1A1JA 1G2FC 1YYKA 4ZYEA 1ZU1A 4L5NC 4KZSA 4JI7E 4R2EA 1X3CA 5LMUE 1PJTA 4I8OA 2MKNA 2WBUA 2V83A 4NXME 1IQSA 4GKJE 2UUAE 4F2JC 1Z1BA 2YTEA 1GQEA 2EL5A 4JI0E 2NUEA 2EL6A 4X65E 2B3TB 2EN4A 4LF5E 2YRMA 5AC5A 2EOFA 4L8NA 1I94E 2HC5A 2EM3A 1RQ0A 2JY9A 5FLXC 1EH8A 3C6KA 4BHCA 2JP9A 1UBDC 2EJ4A 1L4SA 1YPNA 4X9JA 2I13A 4DR6E 4F54A 4DV4E 4DMIA 2N8XA 1XMOE 1QNTA 4TUGA 3QG5C 1HR0E 1IBKE 1JK2A 3HQ1A 1MGTA 1YYWA 2CPNA 4WYQB 2G7HA 4B3RE 4JI2E 1AAYA 1X5WA 2IHR1 2YTPA 4WXCA 2CSHA 2YTQA 1SR9A 2LCEA 3KWRA 2YTJA 3MSWA 1ZR9A 1A1FA 4DR3E 2YTDA 3JTZA 4BC9A 1YZ9A 1N34E 4Q35B 2UU9E 4OOGC 2YSPA 2BB8A 4DV7E 2YTGA 4O24A 2EM5A 4Q28A 2UXCE 4DR2E 4DR1E 4WXDA 2R76A 4X8WA 4DV3E 2N3GA 2EOEA 2JOBA 4F6MA 1ZBTA 2EMLA 5KL2A 4JI1E 2EPMX 5KL6A 1B69A 2YU5A 4LU9A 2EM8A 2NA2A 3BGHA 2E72A 1F2IG 1IMUA 2YTIA 2R1FA 2EMIA 2EMZA 2EM7A 2I9IA 4K0KE 4WPYA 2HHHE 2WBSA 3VK6A 2EPLX 4X66E 2RS7A 3F6HA 1PJQA 4JYAE 1X49A 4IJDA 4R2DA 1A1IA 2RSMA 2EN7A 2JXPA 3DJWA 1IBME 2MC6A 2JYAA 4BMJA 2WBTA 5ADZA 3M99B 2EMFA 4MLQA 4BHBA 4LF9E 2LTRA 2LO3A 4AQYE 2M7QA 2B9DA 3ADGA 3C4TA 2YZTA 5AE3A 5KL5A 3HXLA 3AV0A 1UHZA 4JI8E 3MHSC 2LBSB 3ZOQB 3VYXA 2EPNA 3BF2A 4P7DA 4R2AA 2KOUA 1QU6A 1EH6A 2Q8UA 2ZM6E 2FV4B 2M9AA 2EOZA 1BB8A 2EPXA 2VF1A 1XNQE 2ENAA 2MDRA 2EWLA 5LLQA 1BBOA 2EMGA 1PJSA 3OMLA
chains in the Genus database with same CATH topology
1A1GA 1A1KA 2JPAA 1TN9A 3EPLA 2YTNA 3EPKA 2LV2A 4FK5C 1ZAAC 2EMAA 2EMWA 1JK2A 2RSIA 1YUIA 2GHFA 1RMDA 2DMIA 2D9HA 1A1HA 2YU8A 4R2CA 1AAYA 1X5WA 2ENHA 2ELYA 2EMXA 2YTPA 1UN6B 4R2PA 2CSHA 2YTQA 2EQ3A 1KJKA 2DRPA 2LCEA 2CT1A 5KL3A 2HGHA 2YTJA 1ZR9A 1A1FA 2NABA 2EM2A 2YTDA 1MEYC 2EQ1A 4R2QA 2EM9A 2YSPA 2EQ0A 4F6NA 2DGCA 1YUJA 2BB8A 1TF6A 2A25A 3VHTB 1X6FA 2DLKA 2EN1A 2EM5A 2YTGA 4GZNC 1G2DC 2EN3A 2EOEA 2EOHA 2ELZA 2VRDA 2LT7A 2WCC3 2EPRA 2MDGA 4F6MA 4M9VC 1P47A 2EN6A 2EMLA 2RPCA 2EM6A 5KL2A 2EE8A 2EPAA 2EPCA 2EMKA 2EOJA 5KL6A 1B69A 2CTDA 2YU5A 2EM8A 2EOMA 2E72A 2EOIA 1F2IG 5KL4A 2YTIA 2R1FA 2MKDA 2EMIA 2YTOA 2EMZA 2EM7A 2ADRA 2YRHA 2EL4A 1A1JA 1G2FC 2EMCA 2EOXA 1ZU1A 2EOSA 2WBSA 1JK1A 1NCSA 4R2EA 2DLQA 2EP3A 1X3CA 2EM0A 2EOYA 3UK3C 2MKNA 3EPHA 2YTFA 1WJPA 2EOOA 2EMHA 4IJDA 1LLMC 4R2DA 2ENCA 1A1IA 1DGCA 2WBUA 2EN7A 2PRTA 4F2JC 1Z1BA 2EM4A 2WBTA 2LVHA 2EMFA 3M99B 1X6HA 2YTEA 2EL5A 2GLIA 3EPJA 2EPPA 2EL6A 2LO3A 1YSAC 4R2SA 2EN4A 2EMBA 4WSGA 4R2RA 2EOQA 1A1LA 1TF3A 2J7JA 2YRMA 5KL5A 2EOFA 2EN8A 2EPUA 4IS1C 2EM3A 2YSOA 3MHSC 5KL7A 2JP9A 1UBDC 4R2AA 2EJ4A 2EPZA 1X6EA 2EMYA 4X9JA 2EORA 2I13A 3MHHC 2M9AA 2EOZA 2EN2A 1BB8A 2EPXA 2ENAA 2YRKA 1BBOA 2EMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1G A;  1A1K A;  2JPA A;  1TN9 A;  3EPL A;  2YTN A;  3EPK A;  2LV2 A;  4FK5 C;  1ZAA C;  2EMA A;  2EMW A;  1JK2 A;  2RSI A;  1YUI A;  2GHF A;  1RMD A;  2DMI A;  2D9H A;  1A1H A;  2YU8 A;  4R2C A;  1AAY A;  1X5W A;  2ENH A;  2ELY A;  2EMX A;  2YTP A;  1UN6 B;  4R2P A;  2CSH A;  2YTQ A;  2EQ3 A;  1KJK A;  2DRP A;  2LCE A;  2CT1 A;  5KL3 A;  2HGH A;  2YTJ A;  1ZR9 A;  1A1F A;  2NAB A;  2EM2 A;  2YTD A;  1MEY C;  2EQ1 A;  4R2Q A;  2EM9 A;  2YSP A;  2EQ0 A;  4F6N A;  2DGC A;  1YUJ A;  2BB8 A;  1TF6 A;  2A25 A;  3VHT B;  1X6F A;  2DLK A;  2EN1 A;  2EM5 A;  2YTG A;  4GZN C;  1G2D C;  2EN3 A;  2EOE A;  2EOH A;  2ELZ A;  2VRD A;  2LT7 A;  2WCC 3;  2EPR A;  2MDG A;  4F6M A;  4M9V C;  1P47 A;  2EN6 A;  2EML A;  2RPC A;  2EM6 A;  5KL2 A;  2EE8 A;  2EPA A;  2EPC A;  2EMK A;  2EOJ A;  5KL6 A;  1B69 A;  2CTD A;  2YU5 A;  2EM8 A;  2EOM A;  2E72 A;  2EOI A;  1F2I G;  5KL4 A;  2YTI A;  2R1F A;  2MKD A;  2EMI A;  2YTO A;  2EMZ A;  2EM7 A;  2ADR A;  2YRH A;  2EL4 A;  1A1J A;  1G2F C;  2EMC A;  2EOX A;  1ZU1 A;  2EOS A;  2WBS A;  1JK1 A;  1NCS A;  4R2E A;  2DLQ A;  2EP3 A;  1X3C A;  2EM0 A;  2EOY A;  3UK3 C;  2MKN A;  3EPH A;  2YTF A;  1WJP A;  2EOO A;  2EMH A;  4IJD A;  1LLM C;  4R2D A;  2ENC A;  1A1I A;  1DGC A;  2WBU A;  2EN7 A;  2PRT A;  4F2J C;  1Z1B A;  2EM4 A;  2WBT A;  2LVH A;  2EMF A;  3M99 B;  1X6H A;  2YTE A;  2EL5 A;  2GLI A;  3EPJ A;  2EPP A;  2EL6 A;  2LO3 A;  1YSA C;  4R2S A;  2EN4 A;  2EMB A;  4WSG A;  4R2R A;  2EOQ A;  1A1L A;  1TF3 A;  2J7J A;  2YRM A;  5KL5 A;  2EOF A;  2EN8 A;  2EPU A;  4IS1 C;  2EM3 A;  2YSO A;  3MHS C;  5KL7 A;  2JP9 A;  1UBD C;  4R2A A;  2EJ4 A;  2EPZ A;  1X6E A;  2EMY A;  4X9J A;  2EOR A;  2I13 A;  3MHH C;  2M9A A;  2EOZ A;  2EN2 A;  1BB8 A;  2EPX A;  2ENA A;  2YRK A;  1BBO A;  2EMG A; 
#chains in the Genus database with same CATH topology
 3KZZ A;  2WZO A;  2RTX A;  2YTN A;  3EPK A;  4RHB B;  4FK5 C;  2EMW A;  2LMZ A;  2RSI A;  4DUY E;  3EQ1 A;  1RMD A;  2YU8 A;  2K7I A;  4R2C A;  4YY3 E;  2ELY A;  1DI2 A;  1HNX E;  1FJG E;  2GPI A;  2LJH A;  4DV0 E;  5KL3 A;  2N3H A;  2V85 A;  4LFA E;  4JI3 E;  2L3C A;  1MEY C;  5A2Q C;  4P78 A;  2EM9 A;  2VQF E;  1T38 A;  1TF6 A;  3VHT B;  2L3J A;  3LML A;  2E1M A;  4BCA A;  4GZN C;  5A6J A;  2EOH A;  2NUF A;  2WCC 3;  2YT4 A;  1WHQ A;  2EE8 A;  2EPC A;  2CTD A;  1ZBQ A;  5KL4 A;  4BBY A;  4TUI A;  5IXM B;  1IQO A;  2EPK X;  2VQE E;  2LRS A;  4DV2 E;  4X64 E;  2EOX A;  2EOS A;  1DQ3 A;  2DLQ A;  2EP3 A;  2EM0 A;  2RQL A;  2EOY A;  3UK3 C;  3EPH A;  4DR5 E;  2YTF A;  1WJP A;  2V87 A;  1PKP A;  5A69 A;  2EMH A;  2MC5 A;  3RMP A;  3ADJ A;  2K4V A;  4DV6 E;  1DGC A;  1SFE A;  2BBG A;  4KWY A;  2LTS A;  5IT9 C;  1X47 A;  3HTX A;  5AE1 A;  4J8Z A;  2LVH A;  2GLI A;  4LF4 E;  4WSP A;  1N36 E;  4WSG A;  4MLV A;  4NZV A;  2UUB E;  2EOQ A;  3IWB A;  1TF3 A;  1BBG A;  1GTK A;  2J7J A;  4F9B B;  5TSE A;  2B7V A;  2JR1 A;  3FIG A;  4ZYH A;  2UUC E;  5AE2 A;  5KL7 A;  4OX9 E;  4ZYD A;  2M1S A;  2KON A;  4NXN E;  4DR7 E;  1N3G A;  1NEI A;  2LJU A;  3ADI A;  2EMY A;  4JI5 E;  2EOR A;  2V88 A;  3MHH C;  2EN2 A;  1J5E E;  2YRK A;  3IWD A;  2RS6 A;  4M30 A;  1A1G A;  2B7T A;  1TN9 A;  2UXD E;  1WRJ A;  5F3W A;  2LV2 A;  2V8Q B;  2EMA A;  4DR4 E;  3TQM A;  5BR8 E;  4DV1 E;  2GHF A;  3LLH A;  2LE2 A;  5A6B D;  2DMI A;  2D9H A;  1A1H A;  4WX9 A;  4JV5 E;  3HPZ A;  2YWQ A;  2EQ3 A;  2ODR C;  2HJJ A;  4ZYG A;  2L33 A;  1T39 A;  2HGH A;  2EM2 A;  3JAM C;  4DUZ E;  1X48 A;  2VE7 C;  4R2Q A;  2EQ0 A;  4F6N A;  1T4L B;  1YUJ A;  1WHN A;  5A6K A;  2A25 A;  2LUQ A;  2DLK A;  4LF8 E;  3BID A;  1G2D C;  4LFB E;  4BC7 A;  3THN A;  1STU A;  2DB2 A;  2ELZ A;  2VRD A;  3JU0 A;  3J7Y p;  2LT7 A;  2UXB E;  4R03 A;  2EPR A;  2MDG A;  1YFH A;  1P47 A;  2EM6 A;  2KHX A;  2EMK A;  2EOJ A;  4DV5 E;  2ODR D;  4M0V A;  2EOI A;  5LL6 R;  3OTO E;  2MKD A;  2YTO A;  1XMQ E;  2JVA A;  2ADR A;  2LUP B;  4N4R B;  2YRH A;  2F8B A;  4NHR A;  2EMC A;  2DIX A;  1JK1 A;  1NCS A;  2EPO A;  5CFF E;  3HPS A;  1T4O A;  5LMN E;  5IV8 B;  2EZ6 A;  2F4V E;  2EOO A;  1LLM C;  1KYQ A;  1O0W A;  1T4N A;  2JOX A;  2ENC A;  4B3M E;  4O4K A;  3H09 A;  2L2N A;  2PRT A;  2EM4 A;  3ECR A;  1X6H A;  3EPJ A;  4R8O A;  2EPP A;  5T6J A;  1YSA C;  4R2S A;  1YYO A;  4F9C B;  2EMB A;  4R2R A;  1A1L A;  2V86 A;  3J81 C;  3J7A G;  4LF6 E;  2EN8 A;  2EPU A;  4O43 A;  4IS1 C;  4B3T E;  2L2K B;  2YSO A;  1J26 A;  2H36 X;  4GKK E;  3C6M A;  2L92 A;  4LF7 E;  1UIL A;  4HTG A;  2L2M A;  2EPZ A;  1X6E A;  3DF6 A;  3VYY A;  1RC7 A;  3KZY A;  1WXR A;  2L8T A;  2E5L E;  3J80 C;  3P1X A;  2M4I A;  4DKK A;  1A1K A;  2JPA A;  5A6A A;  3EPL A;  5DNY A;  2JWO A;  2V89 A;  1HNW E;  1ZAA C;  4M2Z A;  3THO B;  1YUI A;  4B3S E;  3ADL A;  1N33 E;  4LFC E;  4JI4 E;  1XNR E;  1GZ6 A;  2ENH A;  2EMX A;  1UN6 B;  4R2P A;  1KJK A;  2DRP A;  3BBG A;  2CT1 A;  3AUZ A;  1EH7 A;  4KHP E;  1PDA A;  3F6G A;  2NAB A;  1EKZ A;  2YPN A;  2EQ1 A;  3C4B A;  2DGC A;  1AH5 A;  3K6Q A;  5AC4 A;  1X6F A;  2DMY A;  2EN1 A;  2FGG A;  4RH8 A;  3T1H E;  2NUG A;  2EN3 A;  5A6B A;  1IBL E;  4WFT A;  4X62 E;  4GEQ B;  5IWA E;  4M9V C;  4BS9 A;  2EN6 A;  2L6M A;  4YHH E;  2RPC A;  2EPA A;  1N32 E;  5AAS A;  4O5G A;  3T1Y E;  3IWC A;  4JI6 E;  2FTX B;  2EOM A;  1HNZ E;  4F9A B;  1FKA E;  4LTY A;  4HEI A;  2DSY A;  2EL4 A;  3L00 A;  1A1J A;  1G2F C;  1YYK A;  4ZYE A;  1ZU1 A;  4L5N C;  4KZS A;  4JI7 E;  4R2E A;  1X3C A;  5LMU E;  1PJT A;  4I8O A;  2MKN A;  2WBU A;  2V83 A;  4NXM E;  1IQS A;  4GKJ E;  2UUA E;  4F2J C;  1Z1B A;  2YTE A;  1GQE A;  2EL5 A;  4JI0 E;  2NUE A;  2EL6 A;  4X65 E;  2B3T B;  2EN4 A;  4LF5 E;  2YRM A;  5AC5 A;  2EOF A;  4L8N A;  1I94 E;  2HC5 A;  2EM3 A;  1RQ0 A;  2JY9 A;  5FLX C;  1EH8 A;  3C6K A;  4BHC A;  2JP9 A;  1UBD C;  2EJ4 A;  1L4S A;  1YPN A;  4X9J A;  2I13 A;  4DR6 E;  4F54 A;  4DV4 E;  4DMI A;  2N8X A;  1XMO E;  1QNT A;  4TUG A;  3QG5 C;  1HR0 E;  1IBK E;  1JK2 A;  3HQ1 A;  1MGT A;  1YYW A;  2CPN A;  4WYQ B;  2G7H A;  4B3R E;  4JI2 E;  1AAY A;  1X5W A;  2IHR 1;  2YTP A;  4WXC A;  2CSH A;  2YTQ A;  1SR9 A;  2LCE A;  3KWR A;  2YTJ A;  3MSW A;  1ZR9 A;  1A1F A;  4DR3 E;  2YTD A;  3JTZ A;  4BC9 A;  1YZ9 A;  1N34 E;  4Q35 B;  2UU9 E;  4OOG C;  2YSP A;  2BB8 A;  4DV7 E;  2YTG A;  4O24 A;  2EM5 A;  4Q28 A;  2UXC E;  4DR2 E;  4DR1 E;  4WXD A;  2R76 A;  4X8W A;  4DV3 E;  2N3G A;  2EOE A;  2JOB A;  4F6M A;  1ZBT A;  2EML A;  5KL2 A;  4JI1 E;  2EPM X;  5KL6 A;  1B69 A;  2YU5 A;  4LU9 A;  2EM8 A;  2NA2 A;  3BGH A;  2E72 A;  1F2I G;  1IMU A;  2YTI A;  2R1F A;  2EMI A;  2EMZ A;  2EM7 A;  2I9I A;  4K0K E;  4WPY A;  2HHH E;  2WBS A;  3VK6 A;  2EPL X;  4X66 E;  2RS7 A;  3F6H A;  1PJQ A;  4JYA E;  1X49 A;  4IJD A;  4R2D A;  1A1I A;  2RSM A;  2EN7 A;  2JXP A;  3DJW A;  1IBM E;  2MC6 A;  2JYA A;  4BMJ A;  2WBT A;  5ADZ A;  3M99 B;  2EMF A;  4MLQ A;  4BHB A;  4LF9 E;  2LTR A;  2LO3 A;  4AQY E;  2M7Q A;  2B9D A;  3ADG A;  3C4T A;  2YZT A;  5AE3 A;  5KL5 A;  3HXL A;  3AV0 A;  1UHZ A;  4JI8 E;  3MHS C;  2LBS B;  3ZOQ B;  3VYX A;  2EPN A;  3BF2 A;  4P7D A;  4R2A A;  2KOU A;  1QU6 A;  1EH6 A;  2Q8U A;  2ZM6 E;  2FV4 B;  2M9A A;  2EOZ A;  1BB8 A;  2EPX A;  2VF1 A;  1XNQ E;  2ENA A;  2MDR A;  2EWL A;  5LLQ A;  1BBO A;  2EMG A;  1PJS A;  3OML A; 
#chains in the Genus database with same CATH homology
 1A1G A;  1A1K A;  2JPA A;  1TN9 A;  3EPL A;  2YTN A;  3EPK A;  2LV2 A;  4FK5 C;  1ZAA C;  2EMA A;  2EMW A;  1JK2 A;  2RSI A;  1YUI A;  2GHF A;  1RMD A;  2DMI A;  2D9H A;  1A1H A;  2YU8 A;  4R2C A;  1AAY A;  1X5W A;  2ENH A;  2ELY A;  2EMX A;  2YTP A;  1UN6 B;  4R2P A;  2CSH A;  2YTQ A;  2EQ3 A;  1KJK A;  2DRP A;  2LCE A;  2CT1 A;  5KL3 A;  2HGH A;  2YTJ A;  1ZR9 A;  1A1F A;  2NAB A;  2EM2 A;  2YTD A;  1MEY C;  2EQ1 A;  4R2Q A;  2EM9 A;  2YSP A;  2EQ0 A;  4F6N A;  2DGC A;  1YUJ A;  2BB8 A;  1TF6 A;  2A25 A;  3VHT B;  1X6F A;  2DLK A;  2EN1 A;  2EM5 A;  2YTG A;  4GZN C;  1G2D C;  2EN3 A;  2EOE A;  2EOH A;  2ELZ A;  2VRD A;  2LT7 A;  2WCC 3;  2EPR A;  2MDG A;  4F6M A;  4M9V C;  1P47 A;  2EN6 A;  2EML A;  2RPC A;  2EM6 A;  5KL2 A;  2EE8 A;  2EPA A;  2EPC A;  2EMK A;  2EOJ A;  5KL6 A;  1B69 A;  2CTD A;  2YU5 A;  2EM8 A;  2EOM A;  2E72 A;  2EOI A;  1F2I G;  5KL4 A;  2YTI A;  2R1F A;  2MKD A;  2EMI A;  2YTO A;  2EMZ A;  2EM7 A;  2ADR A;  2YRH A;  2EL4 A;  1A1J A;  1G2F C;  2EMC A;  2EOX A;  1ZU1 A;  2EOS A;  2WBS A;  1JK1 A;  1NCS A;  4R2E A;  2DLQ A;  2EP3 A;  1X3C A;  2EM0 A;  2EOY A;  3UK3 C;  2MKN A;  3EPH A;  2YTF A;  1WJP A;  2EOO A;  2EMH A;  4IJD A;  1LLM C;  4R2D A;  2ENC A;  1A1I A;  1DGC A;  2WBU A;  2EN7 A;  2PRT A;  4F2J C;  1Z1B A;  2EM4 A;  2WBT A;  2LVH A;  2EMF A;  3M99 B;  1X6H A;  2YTE A;  2EL5 A;  2GLI A;  3EPJ A;  2EPP A;  2EL6 A;  2LO3 A;  1YSA C;  4R2S A;  2EN4 A;  2EMB A;  4WSG A;  4R2R A;  2EOQ A;  1A1L A;  1TF3 A;  2J7J A;  2YRM A;  5KL5 A;  2EOF A;  2EN8 A;  2EPU A;  4IS1 C;  2EM3 A;  2YSO A;  3MHS C;  5KL7 A;  2JP9 A;  1UBD C;  4R2A A;  2EJ4 A;  2EPZ A;  1X6E A;  2EMY A;  4X9J A;  2EOR A;  2I13 A;  3MHH C;  2M9A A;  2EOZ A;  2EN2 A;  1BB8 A;  2EPX A;  2ENA A;  2YRK A;  1BBO A;  2EMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...