2EL6A

Solution structure of the 21th zf-c2h2 domain from human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGAGVNPYKCSQCEKSFSGKLRLLVHQRMHTREKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the 21th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el6A00
2CTDA 2EQ1A 2LCEA 2EMBA 4WSGA 4R2QA 1JK2A 1X3CA 1BBOA 2EMCA 4R2PA 1ZAAC 4FK5C 2EN1A 2DLQA 2EPZA 2EL4A 2EOYA 2YU8A 1TF6A 1KJKA 1TF3A 2EOMA 3EPHA 2EM2A 3MHHC 2EJ4A 2EMWA 2EMKA 2EPXA 2DRPA 3UK3C 2NABA 2DMIA 1LLMC 2ELYA 2YRMA 1F2IG 1A1HA 2YTDA 2EMGA 1YUIA 2EM8A 5KL4A 2EM9A 1X6EA 2EM5A 2BB8A 2EMYA 2CT1A 3EPLA 4X9JA 2JPAA 1Z1BA 4R2AA 4R2EA 1JK1A 2EOZA 3M99B 5KL6A 1X6FA 1A1JA 2ENCA 2ENAA 1ZR9A 5KL5A 2YTOA 1WJPA 2EOSA 2YTQA 2EMLA 2YTFA 2LT7A 1P47A 3MHSC 2YTGA 1RMDA 2WBUA 2YTIA 2MDGA 2GLIA 1DGCA 1MEYC 2EM3A 5KL3A 2EM4A 2VRDA 2WBTA 4M9VC 1YUJA 2JP9A 2EPCA 1A1FA 2EN2A 4IS1C 2YU5A 2EMXA 3EPKA 1A1LA 2MKNA 2R1FA 1G2FC 1NCSA 1A1IA 2EPAA 5KL7A 2DLKA 2ELZA 4IJDA 1ZU1A 2D9HA 4R2SA 2EMAA 2LVHA 2EN3A 2LO3A 2PRTA 3VHTB 2YTJA 2EMIA 2A25A 2CSHA 1BB8A 2EMHA 2J7JA 4R2DA 2WBSA 1YSAC 2EOIA 1A1KA 2EOOA 2EM0A 2EP3A 2EOHA 2HGHA 2E72A 2ADRA 2EOQA 2YRHA 2EM7A 1B69A 2RPCA 2MKDA 2YSPA 2EN6A 2EOJA 2YSOA 4R2CA 4GZNC 2EPRA 2EPUA 1X5WA 2ENHA 2EL6A 2EL5A 2EN4A 2M9AA 4F6NA 2EQ3A 3EPJA 2YTNA 1TN9A 1X6HA 2EMFA 4F2JC 2EPPA 2EOXA 2LV2A 2RSIA 2YTEA 4R2RA 1UN6B 2I13A 2EE8A 2WCC3 1A1GA 2EORA 2EN7A 1AAYA 2EOFA 4F6MA 1UBDC 2EM6A 2EQ0A 5KL2A 2EN8A 2EMZA 1G2DC 2YTPA 2DGCA 2EOEA 2GHFA 2YRKA
chains in the Genus database with same CATH superfamily
4KWYA 2H36X 1NEIA 2L6MA 3J81C 1KYQA 5A6BA 4LF7E 1X3CA 1ZAAC 4GKJE 4FK5C 1TF6A 2YU8A 4HEIA 2B7VA 2ODRC 5CFFE 4O5GA 1TF3A 4LFCE 4JI4E 2ODRD 2RS6A 2EJ4A 2EMWA 3UK3C 5A6KA 4X62E 2ELYA 2EMGA 3IWCA 5KL4A 3T1YE 2EM9A 4DV5E 2I9IA 3BGHA 2EPKX 3M99B 1FKAE 5IXMB 2ENAA 3L00A 3DJWA 3F6HA 5A69A 2EPNA 1T4NA 1YZ9A 1P47A 3MHSC 2UXBE 3HPSA 2GLIA 2HC5A 1T38A 4P78A 2M4IA 2EM4A 2V86A 4R8OA 1HNXE 3K6QA 2L2NA 1I94E 1PDAA 2EPCA 4MLQA 3RMPA 4F9BB 2KOUA 1YYOA 1G2FC 1NCSA 2ELZA 4IJDA 5AE2A 4TUIA 2RS7A 2LUQA 2G7HA 1XNQE 2EMAA 2EZ6A 2PRTA 3VHTB 4JV5E 2J7JA 2V8QB 2IHR1 4F54A 2EOIA 1A1KA 2HHHE 4M30A 2YRHA 1HR0E 2EN6A 1PJTA 1WRJA 1EH8A 4O43A 1O0WA 4BHCA 4DMIA 2ENHA 4J8ZA 4ZYHA 2L2MA 1ZBQA 2NUGA 1IMUA 1T4OA 1DI2A 4WX9A 4DV6E 2KHXA 2BBGA 2YTNA 4DR5E 2EMFA 1YFHA 2M1SA 2LV2A 3OMLA 1T39A 4R2RA 5AC4A 4WXDA 2JVAA 1HNWE 2EOFA 3F6GA 1J5EE 2DGCA 4L5NC 1IBKE 2GHFA 2CTDA 1N36E 4P7DA 4WSGA 2YPNA 4R2QA 4KZSA 1WHQA 2LUPB 2DB2A 2EL4A 1QNTA 4X8WA 2LBSB 4L8NA 4NHRA 1X49A 4OOGC 4ZYEA 2KONA 4RH8A 1X47A 5LMUE 4BBYA 2UXDE 2EPXA 3QG5C 4DV7E 2DMIA 5DNYA 1X6EA 2B3TB 4ZYDA 3EPLA 4X9JA 4MLVA 1IBLE 4R2AA 4R2EA 5T6JA 2DMYA 1JK1A 2V85A 3THOB 2VQFE 4WPYA 4JI2E 4F9AB 1GZ6A 1X6FA 2EPOA 4JI5E 1ZR9A 3EQ1A 3IWBA 4DR7E 1PJSA 2VE7C 3TQMA 4Q28A 1SFEA 2LT7A 1RMDA 2VRDA 1PJQA 5AE1A 3FIGA 2HJJA 4M9VC 4BHBA 2EN2A 3OTOE 1RC7A 2YU5A 2EMXA 3EPKA 2JYAA 2R1FA 1MGTA 2GPIA 2RQLA 1A1IA 2EPAA 5KL7A 3AV0A 2LVHA 2B9DA 2EN3A 2LO3A 2CSHA 2Q8UA 1N34E 2EMHA 2B7TA 2LE2A 5FLXC 3J7AG 3BF2A 4X64E 2V88A 2EOOA 2EM0A 2EP3A 3JU0A 2EOHA 2E72A 2EOQA 2F8BA 5BR8E 2EM7A 2YSPA 3J80C 2EOJA 1ZBTA 1BBGA 2EPRA 4NZVA 1X5WA 4BCAA 3JAMC 1WHNA 1XMOE 2EL6A 3BBGA 2EL5A 3C6KA 3H09A 4YHHE 3HTXA 2EQ3A 2FTXB 2JR1A 2L2KB 1X6HA 5IWAE 4DUZE 2EOXA 4LF6E 2RSIA 4JYAE 4BC7A 5IV8B 5A2QC 2I13A 4NXME 4OX9E 4JI7E 3KWRA 2LTRA 2L3JA 2EM6A 2YT4A 2EMZA 2V89A 2V87A 2YTPA 1N33E 2EOEA 3VYXA 4BS9A 2EQ1A 2LCEA 2EMBA 3HXLA 1JK2A 4F9CB 1BBOA 2EMCA 2VF1A 2EPZA 3P1XA 4JI8E 3ADGA 2LMZA 2L3CA 3EPHA 1T4LB 2JOXA 3MHHC 2EPLX 2EMKA 2DRPA 4LTYA 2YRMA 1YUIA 2EM8A 3JTZA 2EM5A 1J26A 2BB8A 4JI3E 2EMYA 2JPAA 2FGGA 1Z1BA 4B3SE 2JWOA 2EPMX 2EOZA 4YY3E 1EKZA 2ENCA 2ZM6E 5KL5A 4WFTA 5A6AA 1AH5A 1GTKA 2YTFA 3ADIA 4N4RB 1DGCA 1EH7A 4DKKA 5KL3A 1YUJA 1A1FA 3ADJA 4WYQB 5A6JA 4LFBE 5TSEA 2JOBA 1HNZE 1UILA 2NA2A 5LLQA 2DLKA 1ZU1A 2D9HA 5AC5A 2JXPA 4R2SA 1XNRE 4DR6E 2FV4B 3IWDA 5IT9C 2YTJA 4K0KE 4TUGA 4LFAE 5AE3A 4R2DA 4RHBB 2WBSA 3C6MA 1YSAC 1IQOA 1GQEA 1B69A 2UUAE 2RPCA 2E1MA 4X66E 2UU9E 1FJGE 4GKKE 4M2ZA 1IBME 4Q35B 4B3RE 2M9AA 4O24A 4KHPE 1IQSA 3EPJA 4DV3E 4I8OA 2EPPA 4LU9A 2YTEA 3VYYA 4DR2E 2EE8A 3ZOQB 3HPZA 1A1GA 2EN7A 1N32E 5F3WA 4LF5E 3ECRA 1UBDC 5KL2A 1G2DC 2K4VA 1RQ0A 2L8TA 4M0VA 4R2PA 4DV1E 3BIDA 2EN1A 2DLQA 2LJUA 4DV4E 2N8XA 2EOYA 4DUYE 4NXNE 1KJKA 4O4KA 2K7IA 3LLHA 2EOMA 2L33A 2VQEE 2EM2A 3HQ1A 4HTGA 2EWLA 2NABA 2WZOA 1LLMC 1F2IG 4DV0E 1A1HA 1YYWA 2YTDA 3KZYA 3AUZA 2CT1A 3MSWA 5A6BD 3DF6A 2MDRA 4BC9A 1WXRA 1XMQE 3C4TA 2JY9A 2LTSA 5KL6A 5LMNE 2DIXA 4LF9E 1A1JA 3T1HE 2YTOA 1WJPA 2R76A 2EOSA 2YTQA 2LJHA 4ZYGA 2EMLA 2YTGA 2WBUA 2MC5A 2YTIA 4DR1E 2LRSA 2MDGA 2N3GA 1MEYC 2EM3A 2N3HA 2WBTA 2YWQA 3KZZA 2YZTA 2JP9A 2UXCE 3C4BA 5ADZA 4IS1C 1SR9A 4DR4E 1A1LA 2MKNA 4DV2E 2M7QA 2NUFA 1L4SA 4X65E 4B3TE 4JI0E 2NUEA 1N3GA 2EMIA 2A25A 1BB8A 3LMLA 2CPNA 2RTXA 1UHZA 2HGHA 2ADRA 4BMJA 3J7Yp 2MKDA 2YSOA 4R2CA 4DR3E 4GZNC 4LF4E 2EPUA 2V83A 2UUCE 1YYKA 2UUBE 4LF8E 1QU6A 2F4VE 1EH6A 5LL6R 2EN4A 4F6NA 4JI6E 4JI1E 2L92A 1TN9A 4B3ME 4R03A 4F2JC 3ADLA 1PKPA 2RSMA 4WSPA 1UN6B 1X48A 1STUA 2WCC3 2EORA 2MC6A 4GEQB 1YPNA 4WXCA 1AAYA 5AASA 4F6MA 4AQYE 2EQ0A 2E5LE 1DQ3A 2EN8A 3THNA 3VK6A 2DSYA 2YRKA
chains in the Genus database with same CATH topology
2CTDA 2EQ1A 2LCEA 2EMBA 4WSGA 4R2QA 1JK2A 1X3CA 1BBOA 2EMCA 4R2PA 1ZAAC 4FK5C 2EN1A 2DLQA 2EPZA 2EL4A 2EOYA 2YU8A 1TF6A 1KJKA 1TF3A 2EOMA 3EPHA 2EM2A 3MHHC 2EJ4A 2EMWA 2EMKA 2EPXA 2DRPA 3UK3C 2NABA 2DMIA 1LLMC 2ELYA 2YRMA 1F2IG 1A1HA 2YTDA 2EMGA 1YUIA 2EM8A 5KL4A 2EM9A 1X6EA 2EM5A 2BB8A 2EMYA 2CT1A 3EPLA 4X9JA 2JPAA 1Z1BA 4R2AA 4R2EA 1JK1A 2EOZA 3M99B 5KL6A 1X6FA 1A1JA 2ENCA 2ENAA 1ZR9A 5KL5A 2YTOA 1WJPA 2EOSA 2YTQA 2EMLA 2YTFA 2LT7A 1P47A 3MHSC 2YTGA 1RMDA 2WBUA 2YTIA 2MDGA 2GLIA 1DGCA 1MEYC 2EM3A 5KL3A 2EM4A 2VRDA 2WBTA 4M9VC 1YUJA 2JP9A 2EPCA 1A1FA 2EN2A 4IS1C 2YU5A 2EMXA 3EPKA 1A1LA 2MKNA 2R1FA 1G2FC 1NCSA 1A1IA 2EPAA 5KL7A 2DLKA 2ELZA 4IJDA 1ZU1A 2D9HA 4R2SA 2EMAA 2LVHA 2EN3A 2LO3A 2PRTA 3VHTB 2YTJA 2EMIA 2A25A 2CSHA 1BB8A 2EMHA 2J7JA 4R2DA 2WBSA 1YSAC 2EOIA 1A1KA 2EOOA 2EM0A 2EP3A 2EOHA 2HGHA 2E72A 2ADRA 2EOQA 2YRHA 2EM7A 1B69A 2RPCA 2MKDA 2YSPA 2EN6A 2EOJA 2YSOA 4R2CA 4GZNC 2EPRA 2EPUA 1X5WA 2ENHA 2EL6A 2EL5A 2EN4A 2M9AA 4F6NA 2EQ3A 3EPJA 2YTNA 1TN9A 1X6HA 2EMFA 4F2JC 2EPPA 2EOXA 2LV2A 2RSIA 2YTEA 4R2RA 1UN6B 2I13A 2EE8A 2WCC3 1A1GA 2EORA 2EN7A 1AAYA 2EOFA 4F6MA 1UBDC 2EM6A 2EQ0A 5KL2A 2EN8A 2EMZA 1G2DC 2YTPA 2DGCA 2EOEA 2GHFA 2YRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTD A;  2EQ1 A;  2LCE A;  2EMB A;  4WSG A;  4R2Q A;  1JK2 A;  1X3C A;  1BBO A;  2EMC A;  4R2P A;  1ZAA C;  4FK5 C;  2EN1 A;  2DLQ A;  2EPZ A;  2EL4 A;  2EOY A;  2YU8 A;  1TF6 A;  1KJK A;  1TF3 A;  2EOM A;  3EPH A;  2EM2 A;  3MHH C;  2EJ4 A;  2EMW A;  2EMK A;  2EPX A;  2DRP A;  3UK3 C;  2NAB A;  2DMI A;  1LLM C;  2ELY A;  2YRM A;  1F2I G;  1A1H A;  2YTD A;  2EMG A;  1YUI A;  2EM8 A;  5KL4 A;  2EM9 A;  1X6E A;  2EM5 A;  2BB8 A;  2EMY A;  2CT1 A;  3EPL A;  4X9J A;  2JPA A;  1Z1B A;  4R2A A;  4R2E A;  1JK1 A;  2EOZ A;  3M99 B;  5KL6 A;  1X6F A;  1A1J A;  2ENC A;  2ENA A;  1ZR9 A;  5KL5 A;  2YTO A;  1WJP A;  2EOS A;  2YTQ A;  2EML A;  2YTF A;  2LT7 A;  1P47 A;  3MHS C;  2YTG A;  1RMD A;  2WBU A;  2YTI A;  2MDG A;  2GLI A;  1DGC A;  1MEY C;  2EM3 A;  5KL3 A;  2EM4 A;  2VRD A;  2WBT A;  4M9V C;  1YUJ A;  2JP9 A;  2EPC A;  1A1F A;  2EN2 A;  4IS1 C;  2YU5 A;  2EMX A;  3EPK A;  1A1L A;  2MKN A;  2R1F A;  1G2F C;  1NCS A;  1A1I A;  2EPA A;  5KL7 A;  2DLK A;  2ELZ A;  4IJD A;  1ZU1 A;  2D9H A;  4R2S A;  2EMA A;  2LVH A;  2EN3 A;  2LO3 A;  2PRT A;  3VHT B;  2YTJ A;  2EMI A;  2A25 A;  2CSH A;  1BB8 A;  2EMH A;  2J7J A;  4R2D A;  2WBS A;  1YSA C;  2EOI A;  1A1K A;  2EOO A;  2EM0 A;  2EP3 A;  2EOH A;  2HGH A;  2E72 A;  2ADR A;  2EOQ A;  2YRH A;  2EM7 A;  1B69 A;  2RPC A;  2MKD A;  2YSP A;  2EN6 A;  2EOJ A;  2YSO A;  4R2C A;  4GZN C;  2EPR A;  2EPU A;  1X5W A;  2ENH A;  2EL6 A;  2EL5 A;  2EN4 A;  2M9A A;  4F6N A;  2EQ3 A;  3EPJ A;  2YTN A;  1TN9 A;  1X6H A;  2EMF A;  4F2J C;  2EPP A;  2EOX A;  2LV2 A;  2RSI A;  2YTE A;  4R2R A;  1UN6 B;  2I13 A;  2EE8 A;  2WCC 3;  1A1G A;  2EOR A;  2EN7 A;  1AAY A;  2EOF A;  4F6M A;  1UBD C;  2EM6 A;  2EQ0 A;  5KL2 A;  2EN8 A;  2EMZ A;  1G2D C;  2YTP A;  2DGC A;  2EOE A;  2GHF A;  2YRK A; 
#chains in the Genus database with same CATH topology
 4KWY A;  2H36 X;  1NEI A;  2L6M A;  3J81 C;  1KYQ A;  5A6B A;  4LF7 E;  1X3C A;  1ZAA C;  4GKJ E;  4FK5 C;  1TF6 A;  2YU8 A;  4HEI A;  2B7V A;  2ODR C;  5CFF E;  4O5G A;  1TF3 A;  4LFC E;  4JI4 E;  2ODR D;  2RS6 A;  2EJ4 A;  2EMW A;  3UK3 C;  5A6K A;  4X62 E;  2ELY A;  2EMG A;  3IWC A;  5KL4 A;  3T1Y E;  2EM9 A;  4DV5 E;  2I9I A;  3BGH A;  2EPK X;  3M99 B;  1FKA E;  5IXM B;  2ENA A;  3L00 A;  3DJW A;  3F6H A;  5A69 A;  2EPN A;  1T4N A;  1YZ9 A;  1P47 A;  3MHS C;  2UXB E;  3HPS A;  2GLI A;  2HC5 A;  1T38 A;  4P78 A;  2M4I A;  2EM4 A;  2V86 A;  4R8O A;  1HNX E;  3K6Q A;  2L2N A;  1I94 E;  1PDA A;  2EPC A;  4MLQ A;  3RMP A;  4F9B B;  2KOU A;  1YYO A;  1G2F C;  1NCS A;  2ELZ A;  4IJD A;  5AE2 A;  4TUI A;  2RS7 A;  2LUQ A;  2G7H A;  1XNQ E;  2EMA A;  2EZ6 A;  2PRT A;  3VHT B;  4JV5 E;  2J7J A;  2V8Q B;  2IHR 1;  4F54 A;  2EOI A;  1A1K A;  2HHH E;  4M30 A;  2YRH A;  1HR0 E;  2EN6 A;  1PJT A;  1WRJ A;  1EH8 A;  4O43 A;  1O0W A;  4BHC A;  4DMI A;  2ENH A;  4J8Z A;  4ZYH A;  2L2M A;  1ZBQ A;  2NUG A;  1IMU A;  1T4O A;  1DI2 A;  4WX9 A;  4DV6 E;  2KHX A;  2BBG A;  2YTN A;  4DR5 E;  2EMF A;  1YFH A;  2M1S A;  2LV2 A;  3OML A;  1T39 A;  4R2R A;  5AC4 A;  4WXD A;  2JVA A;  1HNW E;  2EOF A;  3F6G A;  1J5E E;  2DGC A;  4L5N C;  1IBK E;  2GHF A;  2CTD A;  1N36 E;  4P7D A;  4WSG A;  2YPN A;  4R2Q A;  4KZS A;  1WHQ A;  2LUP B;  2DB2 A;  2EL4 A;  1QNT A;  4X8W A;  2LBS B;  4L8N A;  4NHR A;  1X49 A;  4OOG C;  4ZYE A;  2KON A;  4RH8 A;  1X47 A;  5LMU E;  4BBY A;  2UXD E;  2EPX A;  3QG5 C;  4DV7 E;  2DMI A;  5DNY A;  1X6E A;  2B3T B;  4ZYD A;  3EPL A;  4X9J A;  4MLV A;  1IBL E;  4R2A A;  4R2E A;  5T6J A;  2DMY A;  1JK1 A;  2V85 A;  3THO B;  2VQF E;  4WPY A;  4JI2 E;  4F9A B;  1GZ6 A;  1X6F A;  2EPO A;  4JI5 E;  1ZR9 A;  3EQ1 A;  3IWB A;  4DR7 E;  1PJS A;  2VE7 C;  3TQM A;  4Q28 A;  1SFE A;  2LT7 A;  1RMD A;  2VRD A;  1PJQ A;  5AE1 A;  3FIG A;  2HJJ A;  4M9V C;  4BHB A;  2EN2 A;  3OTO E;  1RC7 A;  2YU5 A;  2EMX A;  3EPK A;  2JYA A;  2R1F A;  1MGT A;  2GPI A;  2RQL A;  1A1I A;  2EPA A;  5KL7 A;  3AV0 A;  2LVH A;  2B9D A;  2EN3 A;  2LO3 A;  2CSH A;  2Q8U A;  1N34 E;  2EMH A;  2B7T A;  2LE2 A;  5FLX C;  3J7A G;  3BF2 A;  4X64 E;  2V88 A;  2EOO A;  2EM0 A;  2EP3 A;  3JU0 A;  2EOH A;  2E72 A;  2EOQ A;  2F8B A;  5BR8 E;  2EM7 A;  2YSP A;  3J80 C;  2EOJ A;  1ZBT A;  1BBG A;  2EPR A;  4NZV A;  1X5W A;  4BCA A;  3JAM C;  1WHN A;  1XMO E;  2EL6 A;  3BBG A;  2EL5 A;  3C6K A;  3H09 A;  4YHH E;  3HTX A;  2EQ3 A;  2FTX B;  2JR1 A;  2L2K B;  1X6H A;  5IWA E;  4DUZ E;  2EOX A;  4LF6 E;  2RSI A;  4JYA E;  4BC7 A;  5IV8 B;  5A2Q C;  2I13 A;  4NXM E;  4OX9 E;  4JI7 E;  3KWR A;  2LTR A;  2L3J A;  2EM6 A;  2YT4 A;  2EMZ A;  2V89 A;  2V87 A;  2YTP A;  1N33 E;  2EOE A;  3VYX A;  4BS9 A;  2EQ1 A;  2LCE A;  2EMB A;  3HXL A;  1JK2 A;  4F9C B;  1BBO A;  2EMC A;  2VF1 A;  2EPZ A;  3P1X A;  4JI8 E;  3ADG A;  2LMZ A;  2L3C A;  3EPH A;  1T4L B;  2JOX A;  3MHH C;  2EPL X;  2EMK A;  2DRP A;  4LTY A;  2YRM A;  1YUI A;  2EM8 A;  3JTZ A;  2EM5 A;  1J26 A;  2BB8 A;  4JI3 E;  2EMY A;  2JPA A;  2FGG A;  1Z1B A;  4B3S E;  2JWO A;  2EPM X;  2EOZ A;  4YY3 E;  1EKZ A;  2ENC A;  2ZM6 E;  5KL5 A;  4WFT A;  5A6A A;  1AH5 A;  1GTK A;  2YTF A;  3ADI A;  4N4R B;  1DGC A;  1EH7 A;  4DKK A;  5KL3 A;  1YUJ A;  1A1F A;  3ADJ A;  4WYQ B;  5A6J A;  4LFB E;  5TSE A;  2JOB A;  1HNZ E;  1UIL A;  2NA2 A;  5LLQ A;  2DLK A;  1ZU1 A;  2D9H A;  5AC5 A;  2JXP A;  4R2S A;  1XNR E;  4DR6 E;  2FV4 B;  3IWD A;  5IT9 C;  2YTJ A;  4K0K E;  4TUG A;  4LFA E;  5AE3 A;  4R2D A;  4RHB B;  2WBS A;  3C6M A;  1YSA C;  1IQO A;  1GQE A;  1B69 A;  2UUA E;  2RPC A;  2E1M A;  4X66 E;  2UU9 E;  1FJG E;  4GKK E;  4M2Z A;  1IBM E;  4Q35 B;  4B3R E;  2M9A A;  4O24 A;  4KHP E;  1IQS A;  3EPJ A;  4DV3 E;  4I8O A;  2EPP A;  4LU9 A;  2YTE A;  3VYY A;  4DR2 E;  2EE8 A;  3ZOQ B;  3HPZ A;  1A1G A;  2EN7 A;  1N32 E;  5F3W A;  4LF5 E;  3ECR A;  1UBD C;  5KL2 A;  1G2D C;  2K4V A;  1RQ0 A;  2L8T A;  4M0V A;  4R2P A;  4DV1 E;  3BID A;  2EN1 A;  2DLQ A;  2LJU A;  4DV4 E;  2N8X A;  2EOY A;  4DUY E;  4NXN E;  1KJK A;  4O4K A;  2K7I A;  3LLH A;  2EOM A;  2L33 A;  2VQE E;  2EM2 A;  3HQ1 A;  4HTG A;  2EWL A;  2NAB A;  2WZO A;  1LLM C;  1F2I G;  4DV0 E;  1A1H A;  1YYW A;  2YTD A;  3KZY A;  3AUZ A;  2CT1 A;  3MSW A;  5A6B D;  3DF6 A;  2MDR A;  4BC9 A;  1WXR A;  1XMQ E;  3C4T A;  2JY9 A;  2LTS A;  5KL6 A;  5LMN E;  2DIX A;  4LF9 E;  1A1J A;  3T1H E;  2YTO A;  1WJP A;  2R76 A;  2EOS A;  2YTQ A;  2LJH A;  4ZYG A;  2EML A;  2YTG A;  2WBU A;  2MC5 A;  2YTI A;  4DR1 E;  2LRS A;  2MDG A;  2N3G A;  1MEY C;  2EM3 A;  2N3H A;  2WBT A;  2YWQ A;  3KZZ A;  2YZT A;  2JP9 A;  2UXC E;  3C4B A;  5ADZ A;  4IS1 C;  1SR9 A;  4DR4 E;  1A1L A;  2MKN A;  4DV2 E;  2M7Q A;  2NUF A;  1L4S A;  4X65 E;  4B3T E;  4JI0 E;  2NUE A;  1N3G A;  2EMI A;  2A25 A;  1BB8 A;  3LML A;  2CPN A;  2RTX A;  1UHZ A;  2HGH A;  2ADR A;  4BMJ A;  3J7Y p;  2MKD A;  2YSO A;  4R2C A;  4DR3 E;  4GZN C;  4LF4 E;  2EPU A;  2V83 A;  2UUC E;  1YYK A;  2UUB E;  4LF8 E;  1QU6 A;  2F4V E;  1EH6 A;  5LL6 R;  2EN4 A;  4F6N A;  4JI6 E;  4JI1 E;  2L92 A;  1TN9 A;  4B3M E;  4R03 A;  4F2J C;  3ADL A;  1PKP A;  2RSM A;  4WSP A;  1UN6 B;  1X48 A;  1STU A;  2WCC 3;  2EOR A;  2MC6 A;  4GEQ B;  1YPN A;  4WXC A;  1AAY A;  5AAS A;  4F6M A;  4AQY E;  2EQ0 A;  2E5L E;  1DQ3 A;  2EN8 A;  3THN A;  3VK6 A;  2DSY A;  2YRK A; 
#chains in the Genus database with same CATH homology
 2CTD A;  2EQ1 A;  2LCE A;  2EMB A;  4WSG A;  4R2Q A;  1JK2 A;  1X3C A;  1BBO A;  2EMC A;  4R2P A;  1ZAA C;  4FK5 C;  2EN1 A;  2DLQ A;  2EPZ A;  2EL4 A;  2EOY A;  2YU8 A;  1TF6 A;  1KJK A;  1TF3 A;  2EOM A;  3EPH A;  2EM2 A;  3MHH C;  2EJ4 A;  2EMW A;  2EMK A;  2EPX A;  2DRP A;  3UK3 C;  2NAB A;  2DMI A;  1LLM C;  2ELY A;  2YRM A;  1F2I G;  1A1H A;  2YTD A;  2EMG A;  1YUI A;  2EM8 A;  5KL4 A;  2EM9 A;  1X6E A;  2EM5 A;  2BB8 A;  2EMY A;  2CT1 A;  3EPL A;  4X9J A;  2JPA A;  1Z1B A;  4R2A A;  4R2E A;  1JK1 A;  2EOZ A;  3M99 B;  5KL6 A;  1X6F A;  1A1J A;  2ENC A;  2ENA A;  1ZR9 A;  5KL5 A;  2YTO A;  1WJP A;  2EOS A;  2YTQ A;  2EML A;  2YTF A;  2LT7 A;  1P47 A;  3MHS C;  2YTG A;  1RMD A;  2WBU A;  2YTI A;  2MDG A;  2GLI A;  1DGC A;  1MEY C;  2EM3 A;  5KL3 A;  2EM4 A;  2VRD A;  2WBT A;  4M9V C;  1YUJ A;  2JP9 A;  2EPC A;  1A1F A;  2EN2 A;  4IS1 C;  2YU5 A;  2EMX A;  3EPK A;  1A1L A;  2MKN A;  2R1F A;  1G2F C;  1NCS A;  1A1I A;  2EPA A;  5KL7 A;  2DLK A;  2ELZ A;  4IJD A;  1ZU1 A;  2D9H A;  4R2S A;  2EMA A;  2LVH A;  2EN3 A;  2LO3 A;  2PRT A;  3VHT B;  2YTJ A;  2EMI A;  2A25 A;  2CSH A;  1BB8 A;  2EMH A;  2J7J A;  4R2D A;  2WBS A;  1YSA C;  2EOI A;  1A1K A;  2EOO A;  2EM0 A;  2EP3 A;  2EOH A;  2HGH A;  2E72 A;  2ADR A;  2EOQ A;  2YRH A;  2EM7 A;  1B69 A;  2RPC A;  2MKD A;  2YSP A;  2EN6 A;  2EOJ A;  2YSO A;  4R2C A;  4GZN C;  2EPR A;  2EPU A;  1X5W A;  2ENH A;  2EL6 A;  2EL5 A;  2EN4 A;  2M9A A;  4F6N A;  2EQ3 A;  3EPJ A;  2YTN A;  1TN9 A;  1X6H A;  2EMF A;  4F2J C;  2EPP A;  2EOX A;  2LV2 A;  2RSI A;  2YTE A;  4R2R A;  1UN6 B;  2I13 A;  2EE8 A;  2WCC 3;  1A1G A;  2EOR A;  2EN7 A;  1AAY A;  2EOF A;  4F6M A;  1UBD C;  2EM6 A;  2EQ0 A;  5KL2 A;  2EN8 A;  2EMZ A;  1G2D C;  2YTP A;  2DGC A;  2EOE A;  2GHF A;  2YRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...