4MLVA

Crystal structure of bacillus megaterium porphobilinogen deaminase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
290
Chain Sequence
SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKLLIDRVKEELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porphobilinogen deaminase
publication title Structural evidence for the partially oxidized dipyrromethene and dipyrromethanone forms of the cofactor of porphobilinogen deaminase: structures of the Bacillus megaterium enzyme at near-atomic resolution.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transferase
total genus 102
structure length 290
sequence length 311
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 4mlvA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA02
1B0LA 2Y7RA 4G8HA 4QSEA 4LZ8A 2HAVA 4R9FA 3MBPA 5CMKA 5A5XB 1MH3A 4F39A 4JBZA 1LB8A 2ESNA 5LOMA 2V3TA 3ONMA 3IO4A 3O66A 3KOTA 4K3FA 5DT6A 3BFTA 2I48A 2Y7WA 2DVCA 3LSWA 1M5FA 2DYXA 3N5LA 3EHTA 4IGTA 1SW5A 3FJ7A 1WDNA 2OJTA 4IO5A 2Q2CA 3EPEA 3FVKA 1NNPA 3PMWA 3W9WA 4JXIA 3MVYA 2AIXA 4RPOA 1P1UA 3QK6A 4YKIA 5H8FB 5ITPA 1XVYA 2YJPA 3OEKA 1ZJLA 4R73A 1NL5A 2PT1A 4IO7A 4H8JA 1IXIA 4YKJA 1M5BA 3TEPA 1ZLQA 3FV1A 4X1BA 1HSJA 3MZBA 2I49A 1DTGA 4M4GA 1B3FA 2Z8DA 4BDMA 3KJ7A 4YAHX 5JTYB 1B4ZA 2XX8A 1YAEA 5HM4B 1MRPA 5I59B 1PC3A 4I1DA 2RC9A 3PUXE 2REGA 4EQ7A 4R75A 3L6HA 3C33A 3HO7A 2DE2A 2AL5A 5FTIA 3G3IA 5B70A 4R2BA 1YPNA 4BDLA 2FYIA 1QUIA 3OD7A 1AIVA 4F18A 1TWYA 2I3VA 3CI8A 1NH7A 4RPNA 2HAUA 1JVYA 3TCGA 4F31B 4GF8A 1WVJA 2NOOA 4QRZA 2UVJA 1MS7A 4EF1A 2OBGA 3OSRA 3C35A 2ALUA 3IB2A 3CSGA 2UYEA 1FQEA 4PETA 4YKKA 2XXUA 2O51A 2V3QA 4YZZA 5CBSA 4PFUA 2CMOA 1N3XA 4XKRA 1ZBMA 2P0SA 3RLFE 1URSA 3K02A 3KFMA 4ONYA 2AL4A 4OZ9A 4Q5TA 1DOTA 1SI1A 3OO7A 3E13X 2Y7KA 4BDQA 4NF8A 1B05A 3RQTA 4ZZEA 4H5FA 3K6UA 4OFLA 3UK4A 3M3LA 4OXVA 5FHNA 2QMWA 1H45A 1QVSA 4OETA 1FQFA 1M5DA 2I4BA 3B6WA 3I3VA 4H5GA 4U4SA 4IO2A 4LQ2A 1ATGA 3KSXA 1MY1A 2O69A 4ELPA 3ODBA 3GBBA 3RY3A 1A8FA 2XXXA 2Z8EA 2CZLA 4KR5A 3B7DA 2DP8A 2ONKE 1N0TA 3OSQA 4EXKA 2OWTA 1LCTA 5H8QB 3T93B 1O63A 1MDP1 2X7QA 4JWXA 1DTZA 1TT1A 1F9BA 3T9UA 3S9NC 1IITA 4H0WA 2B3FA 4KI0E 1H44A 1UTHB 1B9JA 3KJTA 3V83A 4E0XA 3C31A 4DXBA 3TDJA 3LBSA 4L17A 5AA2B 4ZEKA 1B58A 2DQVA 2X7PA 1QW0A 3ZKKA 4NE4A 4PFYA 3VDFA 2O68A 4H6DA 3TZAA 4IY6A 1PDAA 1VE4A 3SEYA 2XXIA 2NWJA 1GGGA 1OQGA 1Y3QA 1MM7A 2BJJX 3PGFA 4EF2A 4F29A 4LATA 4DXUA 3RT8A 3O6IA 4NF4A 5FTHA 1FTJA 2F5XA 1EZOA 4NF5A 3SKPA 1D9VA 4MF3A 4XTCQ 1MQJA 1OVBA 4OMBA 1ZMGA 4NTLA 1NNFA 3RTFB 2ANJA 3SEVA 2DWIA 3IOUA 3C4MA 3PMXA 3T9HB 3DP6A 3MP1A 1M5EA 3GXAA 1DMBA 1D3KA 4MH5A 1B7ZA 3VV5A 4YB7A 2NVUB 4Q30B 2FA7A 2F7BA 3FJMA 4H65A 2A5TB 1D9YA 4QFOA 3D4GA 4THIA 3U94A 1LLSA 3SESA 4QFLA 1I6AA 4KCCA 2I3WA 2Z23A 3VE1B 4FATA 1QKBA 4ZZAA 3VVFA 1L5TA 4Z7EA 3IK6B 2YPNA 3A3UA 3MP8A 1POTA 3P7IA 4WXJA 5F1QA 4X9TA 5I58B 5K2YA 3G3FA 1N7XA 1LFHA 2DWAA 3VXCA 1B3EA 2Y7PA 3MZ1A 1B40A 4LONB 1Y20A 2QSXA 1GVCA 3KBRA 2V3UA 3FVNA 3VXBA 4RY1A 2GFEA 3CSBA 5HBCA 2R9JA 3ZS6A 4N13A 3QIMA 3IX1A 4XKQA 3O28A 5BUUA 4NF6A 1IZ1A 3RTWB 2HXWA 1FQDA 4UACA 4BLAA 4IB2A 4G77A 1B6HA 1JW4A 2M8CA 4BDNA 4JWOA 3T9VA 5CM6A 5TU0A 2F97A 2XXTA 1XOCA 1IUDA 5JEIA 4G4PA 1LFGA 5DEXB 5IKBA 2IEEA 3KN3A 4GWOA 4N07A 4OFOA 4HTGA 4EQ9A 2GHAA 2QS3A 3RT6B 4Q8RA 1Y1MA 3IJOB 5DVJA 1MQHA 5M2VA 3S4UA 1LAHE 4AQ4A 1P1QA 3U1OA 1VFEA 1FTKA 4ZE8A 4G2ZA 3SEWA 4R74A 3GBAA 4DE8A 1NNTA 3DP8A 5AA4B 3TCFA 2XXVA 2ZYNA 3G3JA 3IOWA 2H9BA 3N6TA 2V25A 2PYYA 3MPKA 4TOZA 4U22A 4ZE9A 2O7UA 1MXUA 3PPOA 3KN8A 4FE8A 3MVXA 1N76A 5DTBA 4C1TA 2UVHA 1MQDA 1B1HA 3OO6A 2UVGA 5CI5A 3O6HA 3O6GA 1LBBA 3KEIA 1A8EA 4R6KA 3QUFA 4AB5A 1FTLA 3OOAA 4TQUQ 4KYEA 2O7IA 1POY1 5I2KA 1Y3NA 4U21A 1B5IA 1O64A 4NWDA 4U2RA 4LP2B 5FHMA 4P0IA 1MPCA 2Z22A 1WODA 3EHUA 1BTJA 1PB8A 4XIGQ 4PP0A 4GRKA 3IR1A 2HEUA 4GOTA 2F34A 2DSFA 5KZTA 5I57A 3B6QA 4GQOA 2ONSA 3IAZA 3CIJA 4GIZA 2PVUA 1Q1KA 5A5XA 2AYSA 3D4CA 3FVOA 4JSDA 3C32A 4XXUA 4TLMB 1ANFA 1MY0A 3R6UA 1OVTA 3UP9A 2XD2A 2I4CA 4EXLA 1JEVA 4YICA 3FVGA 2RINA 4C1UA 4DZ1A 1A40A 4IGRA 4JDFA 3PPPA 2RCAA 5I56B 2XXYA 3BBRA 4MFIA 1QUKA 3V89B 2QS4A 3K1NA 4QSCA 2G29A 3K4UA 5I84A 1DPEA 5H8FA 3TTMA 3UN6A 4O3CA 1SBPA 3PPQA 3IB1A 1SW2A 1PEBA 1LAXA 4F3BA 1NH8A 2DS9A 1XHYA 1Q35A 1AH5A 3VFJA 4GVOA 3TELA 2VD2A 5AA3A 2FNCA 2DXRA 3PMVA 4GLIA 4DIGA 4ZEFA 4ELOA 4X1DA 4YB5A 4G8MA 5KDTB 4NWCA 5JTYA 2ZYKA 3WAFA 3G3KA 5I59A 1Z7NE 3CFLA 3S9LC 3FD3A 4P11A 4LZ7A 4BDOA 3T9XB 4LUBA 2Z8FA 4EQBA 4FORA 1CE2A 2H25A 4EDPA 4MLVA 1B4HA 2X26A 5CMMA 3VLVA 4E0WA 1FQCA 3A09A 1YCJA 5DVFA 2HZKA 1EH3A 3S9MC 4FEBA 4FAJA 1LBCA 3LC8A 3QYTA 3KGCA 4NMYA 3T66A 1N04A 3DLNA 3HSTA 5KCJB 3EN3A 2QPQA 2HFBA 2IA4A 3PPRA 2V93A 4OWDA 3H3GA 3MP6A 1FTOA 3H7MA 2ZYMA 4H8IA 3G3GA 4GD5A 5AA1A 2RCBA 1J1NA 3M3FA 2O1LA 1O7TA 3M3KA 5CMBA 4G68B 3E9XA 1Y9UA 3LSFB 2D21A 3K1MA 3VVDA 5H8NB 1MXZA 2H4IA 4EUOA 3U92A 4RNSA 5B7DA 2A5SA 2QS2A 3LR1A 4FECA 1FTMA 1URDA 2P2AA 3L6GA 3PUVE 3N6UA 5ELVA 2RKMA 3U93A 3IOVA 5CRYA 4LZ5A 2Q88A 1QKAA 3W9VA 3BFUA 1B1XA 5TP9B 1IEJA 3LUYA 5L8DA 3TODA 3FXQA 2DE3A 3TUSA 1P1NA 1USYH 3FUZA 2RC7A 4ZDMA 1QUJA 4NEDA 3TCHA 1XVXA 5H8QA 1B3GA 3PUYE 3ILUB 1MY2A 2ZMBA 5TPAB 3B6TA 5H8HB 3RPWA 1RYXA 3FXUA 3JV9A 3IORA 3VVEA 4IY5A 1UTHA 4HW8A 1II5A 4F2OA 3Q28A 1NNKA 1LB9A 1EZPA 3VLWA 3PUZE 5I2NB 3DP4A 4F22A 2D5WA 2PX1A 1QJMA 3TQLA 2VD3A 1MY3A 3H6WA 3H6VA 3U72A 3T96B 4GL8A 5AA2A 1UIVA 2Q2AA 3FJGA 5ICTA 2ZNSA 3LSLA 2PT2A 1MQIA 4U4XA 4OEUA 1MXWA 1UTBB 2VHAA 3IOTA 3MAMA 1N3WA 3EF7A 1A55A 4OHNA 4OFJA 4ZS9A 3KOSA 2XX7A 1NMUA 3UGWA 2HCAA 2PMSA 4ESXA 1FQBA 3MQ9A 3MVZA 1MPBA 4ESWA 3R7XA 3RN8A 2O1MA 1US5A 5JK4A 4N6PA 3MWBA 4F1VA 4YMBA 4PQJA 3PU5A 4KQPA 3K6VA 3QAXA 4OESA 2OWSA 2WKYA 4FIMA 2O84X 2DE4A 3Q25A 4U23A 3SEXA 3IB0A 2A5TA 5F7VA 3OENA 2F6PA 1LCFA 1MQGA 1LSTA 2UXAA 3V5AA 2QS1A 2E0SA 2RC8A 1EZ9A 4KD5A 1M5CA 5K2XA 1IQ7A 3CFZA 4POXA 2F6GA 2LAOA 1XT8A 2UVIA 4DDDA 4PFTA 4R72A 1Y4TA 1JW1A 3ILTB 5I58A 3O2AA 3ECRA 4F1YA 2HQ0A 4RJZA 4ELRA 4WEDA 4YU0A 5H8SA 1XS5A 4R9GA 3K2DA 3O9PA 3N26A 3EQ1A 3ZSFA 3FGSA 1US4A 1MG1A 4IO4A 1MPDA 1I69A 4LVQA 4OYVA 2DOJA 3KG2A 1Y3PA 1B2HA 1JETA 4XKNA 1MXVA 4HCWA 1IIWA 3QXMA 4OTEA 1N84A 2OLBA 3LSXA 3U8QA 4H1XA 3PPNA 3JYRA 3K1PA 2I0CA 5J1DA 3O97A 3SERA 3THIA 2H99A 1PBQA 4R2FA 3SDFA 2ZXTA 4Q0CA 4G68C 5DEXA 3PUWE 4R6YA 2ZNUA 4KPTA 3K6WA 1PB7A 2E1SA 3QUJA 4OEVA 4ZEBA 1AL3A 4OERA 1OQHA 1H43A 2H98A 4DCYA 2Q8JA 2NUVA 3AXFA 4I8CA 1JQFA 3OO9A 1SVXB 2G93A 3OMBA 1MXYA 4ND9A 3MUQA 5AA4A 3TTRA 3GLBA 4ZECA 2O6AA 2OZZA 2OCUA 3E4RA 2KLFA 1VR5A 3FXRA 2F78A 4R6HA 3TTLA 3SETA 3RNNA 3FATA 1SDXA 1AMFA 1ZTYA 4KYSA 3K0VA 4AB6A 2V84A 1QULA 1UQWA 4RK2A 1P1WA 2F8DA 3TQWA 4I9DA 4YKPA 4ELQA 3IL1B 1SYHA 3ZKLA 5L9OA 4M1VA 4KYDA 2QL3A 1USYE 4NF8B 4F3GA 4RYAA 4LA9A 1JNFA 3VLUA 2GRVA 3FASA 2UYFA 4ZEIA 4G8NA 3MC2A 1IXGA 3CVGA 4UA8A 4WEPA 5DVIA 1MY4A 3JZJA 3CG1A 3K01A 1HSEA 1LGBC 1Y1ZA 1XC1A 4OENA 3CR9A 3OXNA 2NXOA 3SEUA 1B5JA 4LQ5A 3HPIA 5L9MA 1R6ZA 1B7HA 5DYHA 1SD3A 2DXYA 2XXQA 5L9SA 2DWJA 4QF9A 3HCQA 5ITOA 4OQOA 4OVJA 3O29A 4PFWA 4DCXA 1ZU0A 3KSJA 1MH4A 1P99A 3UORA 3S2VA 1ZKBA 4IO6A 4X48A 1SQYA 4GXSB 1TXFA 4QFKA 1GTKA 5I56A 4YB6A 1YTVA 4QHQA 4C0RA 2GHBA 1A7LA 2R71A 4F3PA 3FIRA 1OLAA 1H3DA 1RKMA 3HV1A 5CC2A 3V8XB 3UA8A 4RA1A 4NF4B 4FJPA 4NF5B 1R9LA 3K6XA 3TKDA 3OO8A 1MXXA 3Q29A 3Q26A 2QRYA 1PB9A 2Q9TA 1B0HA 2F36A 5KDTA 3M8UA 4JB7A 3G7WA 1ZIUA 1LFIA 4IO3A 5AA2D 1D4NA 1S50A 5BWJA 3HHGA 4MBPA 3C9HA 3C36A 5HPQA 3PD8A 3MPLA 3FZVA 3RUMA 1Y4CA 2F7CA 4QFNA 1LAFE 1CB6A 4JWYA 4GXAA 2OK2A 3IJXB 1B46A 3BKIB 3T22A 1T0KA 3R26A 4QFPA 3TFLA 3H06B 3IO6A 3H6TA 4F19A 1MDQA 4F1UA 2XXHA 2W7YA 4O3AA 4RK9A 1BKAA 2YLNA 1GR2A 1IXCA 3RGYA 4KHZE 2XXRA 1Z7ME 4PE5B 1TFDA 1DPPA 1VFDA 1P1OA 5CBRA 3UIFA 1LAGE 1R1NA 5ISUA 2B3BA 2ONRA 2ZNTA 4U1OA 4QSDA 4WKMA 4P0GA 2VP1A 2ZYOA 4JSOA 4ECFA 2GH9A 3Q27A 1SYIA 5KCJA 1JVXA 4KFQA 3EHSA 1ELJA 3GZGA 3MJNA 1NFTA 5FHOA 3G3HA 1B5HA 1SW1A 2Y7IA 1FQAA 3QSLA 4F2QA 3MVWA 3TTKA 1SI0A 4HS7A 1S9TA 1A54A 4ISUA 3OEMA 1JW5A 3MZ9A 2D3IA 2XXWA 4U1ZA 1IXHA 4NF6B 3F11A 4G68A 3TYHA 1JEUA 4GFRA 3I6VA 4GL0A 4KCDA 3HHFA 1OLCA 5H8NA 4I62A 3FV2A 2Q89A 3A3CA 2REJA 1RYOA 3I5OA 4DXCA 1H76A 3PD9A 4XKPA 2F35A 1OMPA 3KN7A 2XXPA 5EYFA 5EHMA 1HSLA 1GV8A 3KZGA 1DSNA 2XD3A 1PBPA 5TP9A 1FW0A 3CG3A 4Z0IA 2I6EA 3WAEA 3TAJA 4MLQA 1AOVA 3TPAA 1KWHA 3K00A 3CRBA 1I6BA 1TFAA 2VOZA 3C34A 1B3LA 1UIUA 3OELA 5TPAA 3TMGA 2QMXA 1NKXA 3TTNA 5H8HA 2DWHA 5CMCA 4ZEDA 1BLFA 1B3HA 2DVZA 1N7WA 3H4ZA 2B65A 1BP5A 4BDRA 3DM0A 2PBWA 5I2NA 2Y84A 1SW4A 2QJEA 4HCYA 2H5YA 3N94A 1VSOA 2I0BA 3USDA 2VGQA 4O3BA 2ABHA 3H6UA 1FCKA 3HN0A 1B32A 2RF1A 2F7AA 3S9EA 4POWA 1OIBA 1UTBA 4F3SA 4DLDA 2I58A 4YMAA 1URGA 3PV0E 3E3KA 1EU8A 1BIYA 1B52A 3DELB 5I2KB 1S7YA 5ICQA 2HZLA 3W15C 2THIA 1MM6A 4TLLB 5EHSA 2R6GE 4H67A 3H03A 2XHDA 5IAIA 1A99A 2P1SA 3CFXA 4RXLA 1B7UA 1R9QA 1B51A 2XX9A 3MW0A 5I57B 5AE4A 1I6QA 4FEDA
chains in the Genus database with same CATH superfamily
1B0LA 2Y7RA 1K9YA 2EL5A 4G8HA 4KHPE 2XXKA 4QSEA 4LZ8A 2HAVA 4R9FA 3MBPA 5CMKA 4OA4A 2UUBE 3OMLA 5A5XB 1MH3A 4F39A 4JBZA 1EYJA 1LB8A 2ESNA 2EMZA 5LOMA 1BBGA 3VYYA 4WFTA 1FSAA 2V3TA 3ONMA 3D1RA 3IO4A 3O66A 4NGUA 3KOTA 4I8OA 2RTXA 5I7IA 4K3FA 5DT6A 2ZZWA 3BFTA 2I48A 2Y7WA 2DVCA 4N6KA 3LSWA 5KL6A 2EOIA 1EKZA 1M5FA 2DYXA 3C4TA 3N5LA 4WX9A 3EHTA 4IGTA 1SW5A 5A6KA 4N91A 3FJ7A 1WDNA 1XNRE 2OJTA 4IR8A 4IO5A 2Q2CA 3EPEA 3FVKA 4AS5A 1NNPA 3PMWA 3W9WA 4JXIA 3MVYA 3JAMC 2AIXA 4RPOA 2KOUA 1P1UA 3QK6A 4YKIA 5H8FB 5ITPA 1XVYA 5IZZA 4N8YA 2YJPA 3OEKA 1ZJLA 4R73A 1NL5A 2PT1A 4IO7A 5AC4A 2EJ4A 2HJJA 4H8JA 1IXIA 4O4KA 4YKJA 2VRDA 3IFCA 1M5BA 2CZIA 1AAYA 3TEPA 2M1SA 1ZLQA 3HXLA 3FV1A 2EOYA 4X1BA 1HSJA 3MZBA 2I49A 1DTGA 2EOQA 1FPBA 4M4GA 1B3FA 2DIXA 5LLQA 2Z8DA 1YYOA 4BDMA 3KJ7A 4YAHX 5JTYB 3J7AG 2LTSA 1B4ZA 2XX8A 5EYGA 2NA2A 1YAEA 1T39A 5HM4B 1FPKA 4I40A 1MRPA 5I59B 1PC3A 4I3EA 4IS1C 4I1DA 2RC9A 3PUXE 2REGA 1YYZA 4EQ7A 1X3CA 2EM3A 4R75A 3L6HA 3C33A 1FPLA 2DE2A 3HO7A 1J5EE 2AL5A 3QG5C 2N3GA 5FTIA 3G3IA 5B70A 4R2BA 2WCC3 1YPNA 4BDLA 2FYIA 1QUIA 4PAIA 3OD7A 1AIVA 4F18A 4B3RE 1TWYA 3T1HE 3VYXA 2I3VA 3CI8A 2HPGA 1NH7A 4RPNA 1UILA 1EH6A 2HAUA 1JVYA 3TCGA 1LBVA 4OVTA 4F31B 4GF8A 1WVJA 1NUXA 2NOOA 3LLHA 3VHTB 5ADZA 4DI4B 4QRZA 2UVJA 1MS7A 4R2AA 4EF1A 2OBGA 3OSRA 2MKNA 2B7VA 4I3YA 4NAPA 2L3JA 3C35A 2ALUA 3RYDA 1FPFA 3IB2A 3EPKA 3CSGA 2QFLA 4R2SA 1FQEA 2UYEA 4PETA 3ADLA 5CFFE 4YKKA 2XXUA 2O51A 5IWAE 2V3QA 4YZZA 2EL4A 2JR1A 3THNA 3KBZA 5CBSA 2YT4A 1ZAAC 5J16A 4PFUA 2CMOA 1N3XA 4XKRA 1ZBMA 2P0SA 3RLFE 1URSA 3K02A 4DUZE 3MHHC 3KFMA 4ONYA 3J81C 1A1IA 2AL4A 4OZ9A 3MHSC 5EQAA 4Q5TA 1DOTA 1SI1A 3OO7A 3E13X 1FJGE 2Y7KA 4BDQA 1X6EA 4NF8A 3C4BA 1N32E 3L00A 1BB8A 1B05A 3RQTA 4ZZEA 4H5FA 2EN1A 3K6UA 4OFLA 3UK4A 3M3LA 4OXVA 5FHNA 2ZZVA 2QMWA 2JOXA 2B4MA 1H45A 4G61A 4M30A 4PDDA 4OVQA 3ZOQB 1JP4A 1FQFA 1QVSA 4OETA 1M5DA 2I4BA 3B6WA 2VT5A 3I3VA 1IMCA 5DNYA 4HXVA 4H5GA 4U4SA 4IO2A 4LQ2A 1ATGA 3KSXA 2MKZA 1MY1A 2O69A 2LJUA 4OVSA 4ELPA 2CPNA 3ODBA 1ZBTA 3GBBA 3RY3A 1RDZA 1A8FA 1KA1A 2XXXA 2Z8EA 2CZLA 4KR5A 3B7DA 4JI6E 1LBZA 2YSPA 2DP8A 2ONKE 5IZ3A 1N0TA 2YU8A 3OSQA 4EXKA 2DRPA 2OWTA 4X65E 1LCTA 2EN3A 5H8QB 3T93B 1O63A 1MDP1 2EQ3A 2X7QA 3T1YE 2DLKA 4JWXA 4BHCA 2LUPB 1DTZA 1TT1A 5FBPA 1F9BA 3T9UA 2EMGA 3S9NC 2NUFA 1IITA 3B50A 4H0WA 2B3FA 4KI0E 1H44A 1UTHB 1NV2A 1B9JA 3KJTA 3V83A 2L3CA 4E0XA 3KZYA 3C31A 4DXBA 5I5PA 1DGCA 3TDJA 3LBSA 4O24A 4L17A 5AA2B 1T4OA 4GWXA 4WYQB 4JI8E 4ZEKA 1B58A 2DQVA 2X7PA 1QW0A 2QVRA 3ZKKA 4NE4A 4BC7A 4PFYA 3VDFA 2O68A 4P7DA 4H6DA 1TF3A 3H09A 3TZAA 4IY6A 1PDAA 1INPA 1VE4A 4KZSA 1GZ6A 2LE2A 2XXIA 3SEYA 2YTGA 4PFRA 2NWJA 1GGGA 2EMBA 1OQGA 1Y3QA 1MM7A 2BJJX 3PGFA 2L2KB 4EF2A 1FBGA 2XWIA 4F29A 4LATA 4DXUA 2JYAA 3RT8A 3O6IA 4NF4A 2F5XA 1FTJA 5FTHA 1EZOA 4NF5A 3SKPA 1A1GA 1D9VA 4MF3A 4XTCQ 1MQJA 1OVBA 4OMBA 1ZMGA 2YTPA 4NTLA 4R2DA 1NNFA 3RTFB 4P1EA 2ANJA 1EYKA 3SEVA 2DWIA 1YYKA 3IOUA 2VF1A 3C4MA 2EPZA 2LTRA 3PMXA 3T9HB 3DP6A 3MP1A 1M5EA 3GXAA 1FBPA 4R2CA 1DMBA 1D3KA 4MH5A 1B7ZA 3VV5A 4YB7A 2NVUB 4Q30B 2FA7A 2E72A 3BIHA 2L6MA 2F7BA 2BBGA 4NF0A 3FJMA 4H65A 2IHR1 2A5TB 2EOHA 2YTOA 2ZM6E 2JJKA 1D9YA 4GWZA 4QFOA 3D4GA 4THIA 2Q8UA 4WXDA 1X47A 1LLSA 3U94A 3SESA 1Z1BA 4QFLA 1DBZA 1I6AA 4KCCA 2I3WA 2LCEA 2EP3A 2EM6A 2Z23A 5IGAA 4ZYEA 3VE1B 4FATA 1KYQA 1QKBA 4ZZAA 3VVFA 1L5TA 4KWYA 4Z7EA 2YPNA 3A3UA 3IK6B 3MP8A 1POTA 3P7IA 4WXJA 2DDKA 4X9TA 5F1QA 2A25A 5I58B 1FBFA 5K2YA 2JOBA 3G3FA 3B8BA 4OVPA 4P3LA 1KZ8A 1N7XA 1LFHA 2DGCA 5AE1A 2DWAA 3VXCA 1EH8A 2EPKX 1B3EA 2Y7PA 3MZ1A 4R2PA 2EMCA 4GZNC 2EM2A 1B40A 2EN2A 4LONB 5AE2A 3IWCA 1Y20A 2QSXA 1GVCA 3KBRA 2V3UA 3FVNA 3VXBA 1A1FA 2GFEA 4RY1A 3CSBA 5HBCA 3EPLA 2R9JA 1D9QA 4DR1E 1LBXA 3C6KA 1LLMC 3ZS6A 4N13A 5BR8E 3QIMA 3U65A 3IX1A 4XKQA 3O28A 5BUUA 4NF6A 2F8BA 1IZ1A 3RTWB 2HXWA 2EM7A 3J7Yp 1FQDA 1ZU1A 4UACA 4BLAA 4RHBB 3SZPA 4IB2A 1CNQA 4G77A 2YTJA 1B6HA 1JW4A 2M8CA 4BDNA 2YTFA 4GBVA 4JWOA 3T9VA 4JI2E 5CM6A 5TU0A 2F97A 2XXTA 2FHYA 1XOCA 4GX4A 4LF8E 1IUDA 2EPOA 1X6HA 5JEIA 4G4PA 1LFGA 5DEXB 5IKBA 2PCRA 2IEEA 3KN3A 2JXPA 4GWOA 4N07A 4OFOA 2L92A 4HTGA 4B3TE 4EQ9A 2GHAA 2QS3A 3RT6B 2EORA 4Q8RA 4PTKA 2FBPA 1Y1MA 1DK4A 3IJOB 4PAKA 5DVJA 1MQHA 5M2VA 3S4UA 1LAHE 4AQ4A 2P3VA 3MSWA 1P1QA 4N15A 3U1OA 1X49A 2VPNA 3HTXA 1VFEA 3K6QA 1FTKA 3RPLB 4GX6A 4ZE8A 4G2ZA 3SEWA 4NQ8A 4R74A 4P78A 3GBAA 4UABA 3IWBA 4DE8A 1NUYA 5AASA 1NNTA 3A29A 3DP8A 3EKIA 5AA4B 3TCFA 2ZYNA 2XXVA 2EZ6A 4DV5E 3G3JA 3IOWA 4QXDA 4PAFA 1XNQE 2H9BA 2E1MA 3T0JA 3N6TA 2V25A 2PYYA 1J26A 3MPKA 4TOZA 4U22A 4ZE9A 1WHQA 2RPCA 2O7UA 1MXUA 2EPLX 2G7HA 3PPOA 3FBPA 3KN8A 4GKJE 4FE8A 3MVXA 1N76A 5DTBA 4C1TA 2UXDE 4PGNA 2N8XA 2UVHA 1MQDA 1BBOA 1FBDA 2Y5LA 1B1HA 3OO6A 2UVGA 2GHFA 5CI5A 3O6HA 3O6GA 5IZ1A 1LBBA 2YTNA 3KEIA 1FPIA 1A8EA 2EM0A 4R6KA 5AE3A 3QUFA 4AB5A 1FTLA 3QMFA 4P56A 2JWOA 3OOAA 4TQUQ 1WHNA 2ENAA 5KL4A 1HNWE 1HNXE 4R03A 1DI2A 2O7IA 4KYEA 1POY1 5I2KA 1STUA 4MJOA 1Y3NA 4U21A 1B5IA 1O64A 4NWDA 4U2RA 4LP2B 4PFIA 5FHMA 2L8TA 2Z22A 1MPCA 2EN6A 1WODA 3EHUA 1NV6A 2WEFA 4P0IA 2UXCE 1BTJA 1I94E 1PB8A 4XIGQ 4PP0A 2R8TA 4GRKA 1YZ9A 3KZZA 3IR1A 2HEUA 4GOTA 2F34A 2DSFA 5KZTA 5I57A 3B6QA 4GQOA 3KC1A 2ONSA 3IAZA 1DCUA 1JK1A 3CIJA 2YSOA 4LN5A 4GIZA 2PVUA 1Q1KA 2K7IA 2XWVA 5A5XA 5KL7A 2AYSA 1TF6A 2EPAA 3MYUA 5LTCA 1FJ6A 3D4CA 2ELYA 3FVOA 4JSDA 2JP9A 3C32A 1NV5A 4XXUA 3F6HA 4TLMB 2EOXA 1ANFA 1MY0A 3R6UA 1OVTA 1GQEA 3UP9A 1FBHA 2XD2A 1HNZE 4TUIA 2I4CA 2KR0A 4GWYA 4HE2A 1NEIA 4EXLA 2YU5A 1JEVA 4YICA 3FVGA 2RINA 4C1UA 4DZ1A 1A40A 4IGRA 2EPCA 4JDFA 3PPPA 4X04A 2RCAA 5I56B 2XXYA 3BBRA 1IMBA 4MFIA 1QUKA 3V89B 2QS4A 1EYIA 3K1NA 4QSCA 2G29A 3K4UA 2WYPA 5I84A 1DPEA 5H8FA 3TTMA 3UN6A 1SFEA 4O3CA 1SBPA 3PPQA 3IB1A 1UN6B 1SW2A 1PEBA 1LAXA 2FGGA 4N4UA 3BBGA 4F3BA 3GYYA 1G2FC 1NH8A 2DS9A 2YTDA 2EPXA 1XHYA 1Q35A 1AH5A 5TSEA 2L33A 3VFJA 4GVOA 4MNPA 3TELA 2VD2A 3JU0A 2FNCA 5AA3A 2DXRA 3PMVA 4GLIA 4DIGA 4H45A 4ZEFA 4ELOA 3PTYA 4X1DA 4YB5A 2R76A 5F3WA 2MDRA 4G8MA 3KWRA 4LFCE 4NWCA 5KDTB 3E79A 5JTYA 2ZYKA 3WAFA 3G3KA 4JV5E 5I59A 2EPMX 1Z7NE 2EOSA 2N3HA 1YUIA 3CFLA 3S9LC 2JVAA 3J80C 3FD3A 4MCOA 4P11A 1NV1A 4N8GA 4LZ7A 2EWLA 4BDOA 3LV0A 2EMLA 5LMUE 1WXRA 3T9XB 4F2JC 2Z8FA 4JI3E 4LUBA 1FBEA 4EQBA 2RSIA 4FORA 4JYAE 2H36X 4R2QA 3TQMA 1CE2A 2WZOA 2QVUA 2H25A 4EDPA 4MLVA 1B4HA 2MC6A 5LL6R 2F4VE 1T38A 2X26A 2B9DA 5CMMA 3VLVA 4E0WA 1FQCA 4FBPA 3A09A 4MIJA 1YCJA 5DVFA 2HZKA 1EH3A 3S9MC 4P47A 4FEBA 4FAJA 1LBCA 3LC8A 3QYTA 4IJDA 3OTOE 2HC5A 3KGCA 1LBWA 2CEXA 4NMYA 3T66A 1N04A 3DLNA 3HSTA 2WBSA 5KCJB 3EN3A 2QPQA 5A5LA 2B4LA 2HFBA 5A2QC 2IA4A 3PPRA 2V93A 4OWDA 2DB2A 5IV8B 3H3GA 4X8RA 3MP6A 1WRJA 1FTOA 3H7MA 2ZYMA 1IQSA 4H8IA 3G3GA 4GD5A 2K4VA 5AA1A 4LF9E 2RCBA 1J1NA 3M3FA 4M9VC 2O1LA 2EMFA 1O7TA 4MAGA 4GKKE 4JI5E 4O7MA 1FJ9A 1ZR9A 3M3KA 5CMBA 4G68B 3E9XA 1Y9UA 3LSFB 2D21A 3K1MA 3VVDA 3BIGA 2D9HA 5H8NB 4XF5A 1MXZA 2H4IA 4EUOA 3U92A 2P3NA 4RNSA 5ET6A 4PF6A 5LDZA 5B7DA 2A5SA 2QS2A 1KA0A 3LR1A 2DMIA 4FECA 1FTMA 1URDA 2P2AA 3L6GA 3PUVE 4DV4E 3N6UA 2EOEA 2FTXB 2FIXA 5ELVA 2RKMA 2YZTA 4XEQA 3IFAA 3U93A 2R1FA 3IOVA 3EPHA 5CRYA 4LZ5A 2Q88A 1QKAA 5IXMB 4O94A 4NHRA 4DR4E 3BFUA 2KHXA 3W9VA 2EPRA 1B1XA 5TP9B 4X62E 2DLQA 1IEJA 3LUYA 1FPDA 5L8DA 3TODA 2ADRA 1RC7A 3FXQA 2DE3A 3TUSA 1P1NA 4DKKA 1USYH 2VPOA 3FUZA 2RC7A 4ZDMA 1QUJA 4NEDA 2LT7A 3TCHA 2Y5KA 1XVXA 5H8QA 1B3GA 3PUYE 3ILUB 1MY2A 2ZMBA 5TPAB 3B6TA 5H8HB 3RPWA 1RYXA 2EM4A 2LRSA 1PKPA 3FXUA 3JV9A 4BMJA 2EOJA 3IORA 3VVEA 4IY5A 1UTHA 4GWSA 4HW8A 1II5A 1G0IA 4F2OA 3Q28A 1NNKA 1LB9A 2NUGA 4PFBA 1EZPA 3VLWA 3PUZE 5I2NB 2WX9A 3DP4A 4F22A 2D5WA 2LJHA 4X66E 2PX1A 1QJMA 2EM9A 3TQLA 2VD3A 1MY3A 4YHHE 3H6WA 3H6VA 3U72A 2V87A 3T96B 3M99B 4GL8A 5AA2A 5AC5A 1UIVA 3E78A 2Q2AA 1IMAA 4DR6E 3FJGA 4X64E 2WBTA 2EPPA 1LEVA 5ICTA 2GLIA 2ZNSA 3LSLA 4GWWA 4PBQA 2PT2A 1MQIA 4U4XA 4OEUA 1MXWA 1UTBB 2VHAA 3IOTA 2ELZA 2UXBE 3MAMA 1N3WA 3EF7A 1A55A 4OHNA 4OFJA 4ZS9A 3KOSA 1G0HA 2XX7A 1NMUA 2F3BA 4GEQB 3UGWA 5T6JA 2HCAA 2PMSA 4ESXA 1FQBA 1SR9A 3MQ9A 4PCDA 3MVZA 3T1BA 1T4LB 4R8OA 1MPBA 4ESWA 4DUYE 2BJIA 2MKDA 3R7XA 2XWKA 4M2ZA 3RN8A 2O1MA 3JTZA 1US5A 4F54A 1MEYC 5JK4A 2CTDA 4N6PA 2EOFA 3MWBA 4F1VA 4YMBA 1ZBQA 4O5GA 4PQJA 3PU5A 2EL6A 4KQPA 3K6VA 4OX9E 3QAXA 4OESA 2EPUA 1VDWA 2OWSA 2WKYA 2YRMA 3HPZA 4FIMA 2O84X 1Q9DA 2DE4A 3BGHA 4RH8A 3Q25A 4U23A 1N34E 2LMZA 3SEXA 3IB0A 3ADJA 4LF5E 2A5TA 4L8NA 5F7VA 2MC5A 3AUZA 3OENA 2F6PA 1LCFA 2HHHE 1MQGA 1LSTA 2UXAA 3ISPA 3V5AA 2QS1A 2E0SA 1LBYA 2RC8A 4O7IA 1EZ9A 4KD5A 1M5CA 5K2XA 1NCSA 1IQ7A 3CFZA 3LMLA 5KL3A 2VQFE 4AS4A 5ET5A 2FVZA 4F9BB 4POXA 3AV0A 2F6GA 2LAOA 1XT8A 2UVIA 4DDDA 4PFTA 4R72A 1Y4TA 1JW1A 3ILTB 5I58A 3O2AA 2MDGA 4PC9A 3ECRA 4F1YA 1IMUA 2HQ0A 4LFAE 1TN9A 4RJZA 4JVDA 4WSGA 4N4RB 1A1JA 4ELRA 3NOHA 4WEDA 4YU0A 4ZYGA 4B3ME 4B3SE 4NG7A 5H8SA 4BC9A 4MHFA 1XS5A 5ESYA 2Q8MA 5A6BA 4R9GA 3K2DA 1NUZA 3O9PA 2LBSB 3N26A 1RDYA 3EQ1A 4DR2E 3ZSFA 3FGSA 3LUZA 2PFZA 1DQ3A 1MGTA 2WBBA 1MG1A 1US4A 4IO4A 1MPDA 1I69A 2DOJA 4LVQA 4OYVA 3KG2A 1Y3PA 1X48A 1B2HA 2HGHA 1JETA 4XKNA 5KL2A 1MXVA 4HCWA 1RMDA 1IIWA 3QXMA 1RQ0A 2ODRC 1N84A 4OTEA 2OLBA 4DV3E 3LSXA 2EMXA 2E5LE 3U8QA 2LUQA 4MNCA 4H1XA 3PPNA 3JYRA 3K1PA 2I0CA 5J1DA 4F9CB 3O97A 2RS7A 3SERA 3DF6A 3THIA 2DSYA 2H99A 1PBQA 1B69A 4HEIA 1JK2A 4R2FA 1N36E 2CZHA 3SDFA 2ZXTA 2VQEE 4Q0CA 4DR5E 4G68C 4NXNE 4ZYHA 4L5NC 4LFBE 5DEXA 3PUWE 4JI7E 2EN7A 1FPJA 4R6YA 2JPAA 2ZNUA 4KPTA 3K6WA 1PB7A 2EN8A 2E1SA 3QUJA 2I13A 2RQLA 4MEVA 4OEVA 4ZEBA 1AL3A 1SPIA 3KC0A 4OERA 1IQOA 2XWOA 4WSPA 1KJKA 1FPEA 1OQHA 2EM8A 2EMWA 1H43A 4AQYE 2H98A 4DCYA 1XI6A 2HXRA 2YRHA 2Q8JA 2NUVA 2OX3A 4PDHA 3AXFA 2V4CA 4I8CA 1JQFA 3OO9A 2RSMA 1SVXB 2G93A 3RPLA 3OMBA 4BBYA 1MXYA 2I9IA 3HQ1A 1YYWA 4ND9A 4JVIA 3MUQA 2EQ1A 5AA4A 3TTRA 3GLBA 4ZECA 4K0KE 2O6AA 4WXCA 2OZZA 2OCUA 1AWBA 3E4RA 2KLFA 1VR5A 3FXRA 2ENHA 2F78A 4R6HA 3TTLA 3SETA 1X5WA 3RNNA 3FATA 1SDXA 1AMFA 1ZTYA 4KYSA 3K0VA 2V84A 4AB6A 5F24A 2F3DA 1QULA 1UQWA 2EPNA 1F2IG 1FTAA 1YFHA 4RK2A 2B7TA 4LU9A 1P1WA 4O43A 4Q35B 2F8DA 2YTQA 3EPJA 3FXBA 4BS9A 2KQZA 3TQWA 4NZVA 4I9DA 4YKPA 4ELQA 4BHBA 2VE7C 4GBWA 2FIEA 3IL1B 2LVHA 3BF2A 2EOOA 1SYHA 2CT1A 3ZKLA 5L9OA 4DV2E 2L2NA 4M1VA 3DJWA 1FKAE 4KYDA 2QL3A 1USYE 1A1KA 1A1HA 4NF8B 4M0VA 4F3GA 4NXME 4O8MA 4RYAA 4LA9A 1JNFA 3VLUA 4BCAA 2GRVA 1YUJA 4MNIA 3FASA 2UYFA 5ET8A 4G8NA 4ZEIA 2JY9A 4DV0E 3MC2A 1IXGA 3CVGA 4UA8A 4WEPA 5DVIA 1MY4A 2PFYA 4KXPA 1EH7A 2EMYA 1UHZA 3JZJA 2RS6A 3CG1A 2ENCA 3K01A 1HSEA 1LGBC 1Y1ZA 1XC1A 4OENA 3CR9A 3OXNA 4DMIA 1G2DC 2NXOA 3ADGA 3SEUA 3F6GA 4MX6A 5IT9C 5IZ3B 1B5JA 4LQ5A 1RDXA 3HPIA 5L9MA 1R6ZA 1XMOE 1B7HA 1NV4A 1T4NA 4HE1A 5DYHA 1SD3A 3IWDA 2DXYA 2XXQA 4PGPA 2DWJA 5L9SA 4QF9A 5EQ9A 3HCQA 5ITOA 1K9ZA 4OQOA 4OVJA 3O29A 3HFUA 4PFWA 1ZU0A 4DI3D 3KSJA 4DCXA 1MH4A 1P99A 3UORA 4OANA 3S2VA 1IBKE 1ZKBA 1IBME 4IO6A 4F6NA 3UK3C 4X48A 4QBAA 1QU6A 1SQYA 2WBDA 5EQ7A 4YY3E 4GXSB 1TXFA 4QFKA 1GTKA 5I56A 4YB6A 1YTVA 4QHQA 4C0RA 1NV0A 2GHBA 1IBLE 2YWQA 2XA5A 2M4IA 4H46A 4JI1E 1A7LA 4LF6E 3BIDA 2V8QB 2J7JA 2R71A 4F3PA 3FIRA 1OLAA 1H3DA 3MSTA 1RKMA 3HV1A 5CC2A 2KONA 3V8XB 3UA8A 4RA1A 2ODRD 4DR3E 4NF4B 4FJPA 4NF5B 4P8BA 1R9LA 3K6XA 3TKDA 4R2EA 4LTYA 3OO8A 1MXXA 3VK6A 3Q29A 2M9AA 3ADIA 3Q26A 2YTIA 4J8ZA 2QRYA 4F9AB 1PB9A 2Q9TA 1B0HA 2F36A 5KDTA 3M8UA 4JB7A 1X6FA 3G7WA 2NUEA 4FK5C 1ZIUA 1LFIA 4IO3A 5AA2D 1D4NA 1A1LA 1S50A 2CEYA 5BWJA 3HHGA 4MBPA 3C9HA 3C36A 5HPQA 3PD8A 2V85A 4OVRA 3MPLA 2FV4B 3FZVA 3THOB 3RUMA 1Y4CA 2F7CA 2V88A 4QFNA 2EQ0A 1LAFE 4JI0E 1CB6A 2Q74A 4JWYA 4GXAA 2OK2A 4P9KA 1P47A 3IJXB 1B46A 3BKIB 3T22A 1T0KA 4WPYA 3R26A 4QFPA 3TFLA 3RMPA 3H06B 4Q28A 3IO6A 3H6TA 4F19A 1MDQA 5I3SA 4F1UA 2XXHA 2EMHA 2W7YA 4O3AA 4RK9A 1BKAA 4GX3A 2YLNA 1GR2A 1IXCA 1YXIA 3RGYA 4KHZE 1QNTA 2XXRA 1Z7ME 4PE5B 1TFDA 2V89A 1DPPA 1VFDA 1P1OA 5CBRA 2V86A 1PJSA 3UIFA 5A6AA 1LAGE 1R1NA 5ISUA 1YZ0A 2B3BA 2ONRA 2ZNTA 4QSDA 4U1OA 4WKMA 4P0GA 4X8WA 2VP1A 2ZYOA 4JSOA 1BK4A 4LF7E 1FPGA 4ECFA 2EMKA 2GH9A 3Q27A 1SYIA 1PJQA 5KCJA 1JVXA 4KFQA 1FBCA 1WJPA 3EHSA 1ELJA 4MMPA 3GZGA 3MJNA 1NFTA 5FHOA 3G3HA 5KL5A 1B5HA 1SW1A 2Y7IA 2ZZXA 3CHGA 1FQAA 3QSLA 4F2QA 1NI9A 4GWUA 2EM5A 3MVWA 3TTKA 1SI0A 2B3TB 1S9TA 2GQ1A 4HS7A 1A54A 4ISUA 2NABA 3OEMA 2PRTA 1JW5A 3MZ9A 2D3IA 2XXWA 4U1ZA 1IXHA 4NF6B 3F11A 4X9JA 4G68A 1JEUA 3TYHA 4GFRA 3I6VA 4GL0A 4KCDA 3HHFA 4PBHA 3HPSA 1O0WA 4R2RA 1OLCA 5H8NA 4I62A 1IMDA 2EN4A 3FV2A 4NX1A 2Q89A 3A3CA 2CSHA 2REJA 2LV2A 2GPIA 4HE0A 4NN3A 1RYOA 3I5OA 3P1XA 4DXCA 1H76A 3PD9A 4XKPA 5EYHA 2F35A 1OMPA 1NUWA 3KN7A 2XXPA 5EYFA 5EHMA 1HSLA 1GV8A 3KZGA 1IMEA 5A6BD 1IMFA 1DSNA 2XD3A 1PBPA 5TP9A 4DV1E 1FW0A 1N3GA 3CG3A 4N81A 1FRPA 4Z0IA 2I6EA 3WAEA 4N6DA 5A69A 3TAJA 2HHMA 4MLQA 1AOVA 2V83A 3TPAA 1KWHA 3K00A 3CRBA 1I6BA 2EMAA 4DR7E 4PF8A 1TFAA 2VOZA 3C34A 4ZYDA 1B3LA 1UIUA 3OELA 5TPAA 3TMGA 2QMXA 1NKXA 3TTNA 5H8HA 2CZKA 2DWHA 5CMCA 2EOMA 4ZEDA 2UUAE 1BLFA 5A6JA 2DMYA 1B3HA 2DVZA 2WYKA 1N7WA 3H4ZA 4PE3A 2B65A 1L4SA 1BP5A 4BDRA 3DM0A 2PBWA 5I2NA 1XMQE 2Y84A 1SW4A 2OWZA 2QJEA 4HCYA 4LF4E 2H5YA 3N94A 1VSOA 1HR0E 2I0BA 3USDA 1UBDC 2VGQA 4O3BA 2ABHA 3H6UA 1FCKA 3HN0A 4JVCA 4DV7E 1B32A 4N17A 2RF1A 2F7AA 1N33E 3S9EA 4POWA 2L2MA 3ROJA 1OIBA 1UTBA 5DW8A 5LMNE 4F3SA 2WBUA 4OOGC 4DLDA 2I58A 4YMAA 1URGA 3PV0E 3E3KA 1EU8A 1BIYA 1B52A 4P1LA 4TUGA 5EQ8A 3FIGA 3DELB 2YTEA 4DV6E 5I2KB 1S7YA 2EE8A 2QVVA 5IM2A 1YSAC 5ICQA 2UU9E 2HZLA 1NV3A 3W15C 2UUCE 5FLXC 2THIA 5ET7A 1MM6A 4TLLB 2BB8A 5EHSA 2R6GE 4NHBA 1NV7A 4H67A 3H03A 2YRKA 2LO3A 4F6MA 2XHDA 5IAIA 1A99A 2M7QA 1PJTA 2P1SA 3C6MA 4JI4E 5T3JA 3CFXA 2EMIA 4RXLA 1B7UA 1R9QA 1B51A 2XX9A 2L5VA 1QGXA 2EOZA 3MW0A 5I57B 5AE4A 1I6QA 4XFEA 4FEDA
chains in the Genus database with same CATH topology
1B0LA 2Y7RA 4G8HA 4QSEA 4LZ8A 2HAVA 4R9FA 3MBPA 5CMKA 5A5XB 1MH3A 4F39A 4JBZA 1LB8A 2ESNA 5LOMA 2V3TA 3ONMA 3IO4A 3O66A 3KOTA 4K3FA 5DT6A 3BFTA 2I48A 2Y7WA 2DVCA 3LSWA 1M5FA 2DYXA 3N5LA 3EHTA 4IGTA 1SW5A 3FJ7A 1WDNA 2OJTA 4IO5A 2Q2CA 3EPEA 3FVKA 1NNPA 3PMWA 3W9WA 4JXIA 3MVYA 2AIXA 4RPOA 1P1UA 3QK6A 4YKIA 5H8FB 5ITPA 1XVYA 2YJPA 3OEKA 1ZJLA 4R73A 1NL5A 2PT1A 4IO7A 4H8JA 1IXIA 4YKJA 1M5BA 3TEPA 1ZLQA 3FV1A 4X1BA 1HSJA 3MZBA 2I49A 1DTGA 4M4GA 1B3FA 2Z8DA 4BDMA 3KJ7A 4YAHX 5JTYB 1B4ZA 2XX8A 1YAEA 5HM4B 1MRPA 5I59B 1PC3A 4I1DA 2RC9A 3PUXE 2REGA 4EQ7A 4R75A 3L6HA 3C33A 3HO7A 2DE2A 2AL5A 5FTIA 3G3IA 5B70A 4R2BA 1YPNA 4BDLA 2FYIA 1QUIA 3OD7A 1AIVA 4F18A 1TWYA 2I3VA 3CI8A 1NH7A 4RPNA 2HAUA 1JVYA 3TCGA 4F31B 4GF8A 1WVJA 2NOOA 4QRZA 2UVJA 1MS7A 4EF1A 2OBGA 3OSRA 3C35A 2ALUA 3IB2A 3CSGA 2UYEA 1FQEA 4PETA 4YKKA 2XXUA 2O51A 2V3QA 4YZZA 5CBSA 4PFUA 2CMOA 1N3XA 4XKRA 1ZBMA 2P0SA 3RLFE 1URSA 3K02A 3KFMA 4ONYA 2AL4A 4OZ9A 4Q5TA 1DOTA 1SI1A 3OO7A 3E13X 2Y7KA 4BDQA 4NF8A 1B05A 3RQTA 4ZZEA 4H5FA 3K6UA 4OFLA 3UK4A 3M3LA 4OXVA 5FHNA 2QMWA 1H45A 1QVSA 4OETA 1FQFA 1M5DA 2I4BA 3B6WA 3I3VA 4H5GA 4U4SA 4IO2A 4LQ2A 1ATGA 3KSXA 1MY1A 2O69A 4ELPA 3ODBA 3GBBA 3RY3A 1A8FA 2XXXA 2Z8EA 2CZLA 4KR5A 3B7DA 2DP8A 2ONKE 1N0TA 3OSQA 4EXKA 2OWTA 1LCTA 5H8QB 3T93B 1O63A 1MDP1 2X7QA 4JWXA 1DTZA 1TT1A 1F9BA 3T9UA 3S9NC 1IITA 4H0WA 2B3FA 4KI0E 1H44A 1UTHB 1B9JA 3KJTA 3V83A 4E0XA 3C31A 4DXBA 3TDJA 3LBSA 4L17A 5AA2B 4ZEKA 1B58A 2DQVA 2X7PA 1QW0A 3ZKKA 4NE4A 4PFYA 3VDFA 2O68A 4H6DA 3TZAA 4IY6A 1PDAA 1VE4A 3SEYA 2XXIA 2NWJA 1GGGA 1OQGA 1Y3QA 1MM7A 2BJJX 3PGFA 4EF2A 4F29A 4LATA 4DXUA 3RT8A 3O6IA 4NF4A 5FTHA 1FTJA 2F5XA 1EZOA 4NF5A 3SKPA 1D9VA 4MF3A 4XTCQ 1MQJA 1OVBA 4OMBA 1ZMGA 4NTLA 1NNFA 3RTFB 2ANJA 3SEVA 2DWIA 3IOUA 3C4MA 3PMXA 3T9HB 3DP6A 3MP1A 1M5EA 3GXAA 1DMBA 1D3KA 4MH5A 1B7ZA 3VV5A 4YB7A 2NVUB 4Q30B 2FA7A 2F7BA 3FJMA 4H65A 2A5TB 1D9YA 4QFOA 3D4GA 4THIA 3U94A 1LLSA 3SESA 4QFLA 1I6AA 4KCCA 2I3WA 2Z23A 3VE1B 4FATA 1QKBA 4ZZAA 3VVFA 1L5TA 4Z7EA 3IK6B 2YPNA 3A3UA 3MP8A 1POTA 3P7IA 4WXJA 5F1QA 4X9TA 5I58B 5K2YA 3G3FA 1N7XA 1LFHA 2DWAA 3VXCA 1B3EA 2Y7PA 3MZ1A 1B40A 4LONB 1Y20A 2QSXA 1GVCA 3KBRA 2V3UA 3FVNA 3VXBA 4RY1A 2GFEA 3CSBA 5HBCA 2R9JA 3ZS6A 4N13A 3QIMA 3IX1A 4XKQA 3O28A 5BUUA 4NF6A 1IZ1A 3RTWB 2HXWA 1FQDA 4UACA 4BLAA 4IB2A 4G77A 1B6HA 1JW4A 2M8CA 4BDNA 4JWOA 3T9VA 5CM6A 5TU0A 2F97A 2XXTA 1XOCA 1IUDA 5JEIA 4G4PA 1LFGA 5DEXB 5IKBA 2IEEA 3KN3A 4GWOA 4N07A 4OFOA 4HTGA 4EQ9A 2GHAA 2QS3A 3RT6B 4Q8RA 1Y1MA 3IJOB 5DVJA 1MQHA 5M2VA 3S4UA 1LAHE 4AQ4A 1P1QA 3U1OA 1VFEA 1FTKA 4ZE8A 4G2ZA 3SEWA 4R74A 3GBAA 4DE8A 1NNTA 3DP8A 5AA4B 3TCFA 2XXVA 2ZYNA 3G3JA 3IOWA 2H9BA 3N6TA 2V25A 2PYYA 3MPKA 4TOZA 4U22A 4ZE9A 2O7UA 1MXUA 3PPOA 3KN8A 4FE8A 3MVXA 1N76A 5DTBA 4C1TA 2UVHA 1MQDA 1B1HA 3OO6A 2UVGA 5CI5A 3O6HA 3O6GA 1LBBA 3KEIA 1A8EA 4R6KA 3QUFA 4AB5A 1FTLA 3OOAA 4TQUQ 4KYEA 2O7IA 1POY1 5I2KA 1Y3NA 4U21A 1B5IA 1O64A 4NWDA 4U2RA 4LP2B 5FHMA 4P0IA 1MPCA 2Z22A 1WODA 3EHUA 1BTJA 1PB8A 4XIGQ 4PP0A 4GRKA 3IR1A 2HEUA 4GOTA 2F34A 2DSFA 5KZTA 5I57A 3B6QA 4GQOA 2ONSA 3IAZA 3CIJA 4GIZA 2PVUA 1Q1KA 5A5XA 2AYSA 3D4CA 3FVOA 4JSDA 3C32A 4XXUA 4TLMB 1ANFA 1MY0A 3R6UA 1OVTA 3UP9A 2XD2A 2I4CA 4EXLA 1JEVA 4YICA 3FVGA 2RINA 4C1UA 4DZ1A 1A40A 4IGRA 4JDFA 3PPPA 2RCAA 5I56B 2XXYA 3BBRA 4MFIA 1QUKA 3V89B 2QS4A 3K1NA 4QSCA 2G29A 3K4UA 5I84A 1DPEA 5H8FA 3TTMA 3UN6A 4O3CA 1SBPA 3PPQA 3IB1A 1SW2A 1PEBA 1LAXA 4F3BA 1NH8A 2DS9A 1XHYA 1Q35A 1AH5A 3VFJA 4GVOA 3TELA 2VD2A 5AA3A 2FNCA 2DXRA 3PMVA 4GLIA 4DIGA 4ZEFA 4ELOA 4X1DA 4YB5A 4G8MA 5KDTB 4NWCA 5JTYA 2ZYKA 3WAFA 3G3KA 5I59A 1Z7NE 3CFLA 3S9LC 3FD3A 4P11A 4LZ7A 4BDOA 3T9XB 4LUBA 2Z8FA 4EQBA 4FORA 1CE2A 2H25A 4EDPA 4MLVA 1B4HA 2X26A 5CMMA 3VLVA 4E0WA 1FQCA 3A09A 1YCJA 5DVFA 2HZKA 1EH3A 3S9MC 4FEBA 4FAJA 1LBCA 3LC8A 3QYTA 3KGCA 4NMYA 3T66A 1N04A 3DLNA 3HSTA 5KCJB 3EN3A 2QPQA 2HFBA 2IA4A 3PPRA 2V93A 4OWDA 3H3GA 3MP6A 1FTOA 3H7MA 2ZYMA 4H8IA 3G3GA 4GD5A 5AA1A 2RCBA 1J1NA 3M3FA 2O1LA 1O7TA 3M3KA 5CMBA 4G68B 3E9XA 1Y9UA 3LSFB 2D21A 3K1MA 3VVDA 5H8NB 1MXZA 2H4IA 4EUOA 3U92A 4RNSA 5B7DA 2A5SA 2QS2A 3LR1A 4FECA 1FTMA 1URDA 2P2AA 3L6GA 3PUVE 3N6UA 5ELVA 2RKMA 3U93A 3IOVA 5CRYA 4LZ5A 2Q88A 1QKAA 3W9VA 3BFUA 1B1XA 5TP9B 1IEJA 3LUYA 5L8DA 3TODA 3FXQA 2DE3A 3TUSA 1P1NA 1USYH 3FUZA 2RC7A 4ZDMA 1QUJA 4NEDA 3TCHA 1XVXA 5H8QA 1B3GA 3PUYE 3ILUB 1MY2A 2ZMBA 5TPAB 3B6TA 5H8HB 3RPWA 1RYXA 3FXUA 3JV9A 3IORA 3VVEA 4IY5A 1UTHA 4HW8A 1II5A 4F2OA 3Q28A 1NNKA 1LB9A 1EZPA 3VLWA 3PUZE 5I2NB 3DP4A 4F22A 2D5WA 2PX1A 1QJMA 3TQLA 2VD3A 1MY3A 3H6WA 3H6VA 3U72A 3T96B 4GL8A 5AA2A 1UIVA 2Q2AA 3FJGA 5ICTA 2ZNSA 3LSLA 2PT2A 1MQIA 4U4XA 4OEUA 1MXWA 1UTBB 2VHAA 3IOTA 3MAMA 1N3WA 3EF7A 1A55A 4OHNA 4OFJA 4ZS9A 3KOSA 2XX7A 1NMUA 3UGWA 2HCAA 2PMSA 4ESXA 1FQBA 3MQ9A 3MVZA 1MPBA 4ESWA 3R7XA 3RN8A 2O1MA 1US5A 5JK4A 4N6PA 3MWBA 4F1VA 4YMBA 4PQJA 3PU5A 4KQPA 3K6VA 3QAXA 4OESA 2OWSA 2WKYA 4FIMA 2O84X 2DE4A 3Q25A 4U23A 3SEXA 3IB0A 2A5TA 5F7VA 3OENA 2F6PA 1LCFA 1MQGA 1LSTA 2UXAA 3V5AA 2QS1A 2E0SA 2RC8A 1EZ9A 4KD5A 1M5CA 5K2XA 1IQ7A 3CFZA 4POXA 2F6GA 2LAOA 1XT8A 2UVIA 4DDDA 4PFTA 4R72A 1Y4TA 1JW1A 3ILTB 5I58A 3O2AA 3ECRA 4F1YA 2HQ0A 4RJZA 4ELRA 4WEDA 4YU0A 5H8SA 1XS5A 4R9GA 3K2DA 3O9PA 3N26A 3EQ1A 3ZSFA 3FGSA 1US4A 1MG1A 4IO4A 1MPDA 1I69A 4LVQA 4OYVA 2DOJA 3KG2A 1Y3PA 1B2HA 1JETA 4XKNA 1MXVA 4HCWA 1IIWA 3QXMA 4OTEA 1N84A 2OLBA 3LSXA 3U8QA 4H1XA 3PPNA 3JYRA 3K1PA 2I0CA 5J1DA 3O97A 3SERA 3THIA 2H99A 1PBQA 4R2FA 3SDFA 2ZXTA 4Q0CA 4G68C 5DEXA 3PUWE 4R6YA 2ZNUA 4KPTA 3K6WA 1PB7A 2E1SA 3QUJA 4OEVA 4ZEBA 1AL3A 4OERA 1OQHA 1H43A 2H98A 4DCYA 2Q8JA 2NUVA 3AXFA 4I8CA 1JQFA 3OO9A 1SVXB 2G93A 3OMBA 1MXYA 4ND9A 3MUQA 5AA4A 3TTRA 3GLBA 4ZECA 2O6AA 2OZZA 2OCUA 3E4RA 2KLFA 1VR5A 3FXRA 2F78A 4R6HA 3TTLA 3SETA 3RNNA 3FATA 1SDXA 1AMFA 1ZTYA 4KYSA 3K0VA 4AB6A 2V84A 1QULA 1UQWA 4RK2A 1P1WA 2F8DA 3TQWA 4I9DA 4YKPA 4ELQA 3IL1B 1SYHA 3ZKLA 5L9OA 4M1VA 4KYDA 2QL3A 1USYE 4NF8B 4F3GA 4RYAA 4LA9A 1JNFA 3VLUA 2GRVA 3FASA 2UYFA 4ZEIA 4G8NA 3MC2A 1IXGA 3CVGA 4UA8A 4WEPA 5DVIA 1MY4A 3JZJA 3CG1A 3K01A 1HSEA 1LGBC 1Y1ZA 1XC1A 4OENA 3CR9A 3OXNA 2NXOA 3SEUA 1B5JA 4LQ5A 3HPIA 5L9MA 1R6ZA 1B7HA 5DYHA 1SD3A 2DXYA 2XXQA 5L9SA 2DWJA 4QF9A 3HCQA 5ITOA 4OQOA 4OVJA 3O29A 4PFWA 4DCXA 1ZU0A 3KSJA 1MH4A 1P99A 3UORA 3S2VA 1ZKBA 4IO6A 4X48A 1SQYA 4GXSB 1TXFA 4QFKA 1GTKA 5I56A 4YB6A 1YTVA 4QHQA 4C0RA 2GHBA 1A7LA 2R71A 4F3PA 3FIRA 1OLAA 1H3DA 1RKMA 3HV1A 5CC2A 3V8XB 3UA8A 4RA1A 4NF4B 4FJPA 4NF5B 1R9LA 3K6XA 3TKDA 3OO8A 1MXXA 3Q29A 3Q26A 2QRYA 1PB9A 2Q9TA 1B0HA 2F36A 5KDTA 3M8UA 4JB7A 3G7WA 1ZIUA 1LFIA 4IO3A 5AA2D 1D4NA 1S50A 5BWJA 3HHGA 4MBPA 3C9HA 3C36A 5HPQA 3PD8A 3MPLA 3FZVA 3RUMA 1Y4CA 2F7CA 4QFNA 1LAFE 1CB6A 4JWYA 4GXAA 2OK2A 3IJXB 1B46A 3BKIB 3T22A 1T0KA 3R26A 4QFPA 3TFLA 3H06B 3IO6A 3H6TA 4F19A 1MDQA 4F1UA 2XXHA 2W7YA 4O3AA 4RK9A 1BKAA 2YLNA 1GR2A 1IXCA 3RGYA 4KHZE 2XXRA 1Z7ME 4PE5B 1TFDA 1DPPA 1VFDA 1P1OA 5CBRA 3UIFA 1LAGE 1R1NA 5ISUA 2B3BA 2ONRA 2ZNTA 4U1OA 4QSDA 4WKMA 4P0GA 2VP1A 2ZYOA 4JSOA 4ECFA 2GH9A 3Q27A 1SYIA 5KCJA 1JVXA 4KFQA 3EHSA 1ELJA 3GZGA 3MJNA 1NFTA 5FHOA 3G3HA 1B5HA 1SW1A 2Y7IA 1FQAA 3QSLA 4F2QA 3MVWA 3TTKA 1SI0A 4HS7A 1S9TA 1A54A 4ISUA 3OEMA 1JW5A 3MZ9A 2D3IA 2XXWA 4U1ZA 1IXHA 4NF6B 3F11A 4G68A 3TYHA 1JEUA 4GFRA 3I6VA 4GL0A 4KCDA 3HHFA 1OLCA 5H8NA 4I62A 3FV2A 2Q89A 3A3CA 2REJA 1RYOA 3I5OA 4DXCA 1H76A 3PD9A 4XKPA 2F35A 1OMPA 3KN7A 2XXPA 5EYFA 5EHMA 1HSLA 1GV8A 3KZGA 1DSNA 2XD3A 1PBPA 5TP9A 1FW0A 3CG3A 4Z0IA 2I6EA 3WAEA 3TAJA 4MLQA 1AOVA 3TPAA 1KWHA 3K00A 3CRBA 1I6BA 1TFAA 2VOZA 3C34A 1B3LA 1UIUA 3OELA 5TPAA 3TMGA 2QMXA 1NKXA 3TTNA 5H8HA 2DWHA 5CMCA 4ZEDA 1BLFA 1B3HA 2DVZA 1N7WA 3H4ZA 2B65A 1BP5A 4BDRA 3DM0A 2PBWA 5I2NA 2Y84A 1SW4A 2QJEA 4HCYA 2H5YA 3N94A 1VSOA 2I0BA 3USDA 2VGQA 4O3BA 2ABHA 3H6UA 1FCKA 3HN0A 1B32A 2RF1A 2F7AA 3S9EA 4POWA 1OIBA 1UTBA 4F3SA 4DLDA 2I58A 4YMAA 1URGA 3PV0E 3E3KA 1EU8A 1BIYA 1B52A 3DELB 5I2KB 1S7YA 5ICQA 2HZLA 3W15C 2THIA 1MM6A 4TLLB 5EHSA 2R6GE 4H67A 3H03A 2XHDA 5IAIA 1A99A 2P1SA 3CFXA 4RXLA 1B7UA 1R9QA 1B51A 2XX9A 3MW0A 5I57B 5AE4A 1I6QA 4FEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B0L A;  2Y7R A;  4G8H A;  4QSE A;  4LZ8 A;  2HAV A;  4R9F A;  3MBP A;  5CMK A;  5A5X B;  1MH3 A;  4F39 A;  4JBZ A;  1LB8 A;  2ESN A;  5LOM A;  2V3T A;  3ONM A;  3IO4 A;  3O66 A;  3KOT A;  4K3F A;  5DT6 A;  3BFT A;  2I48 A;  2Y7W A;  2DVC A;  3LSW A;  1M5F A;  2DYX A;  3N5L A;  3EHT A;  4IGT A;  1SW5 A;  3FJ7 A;  1WDN A;  2OJT A;  4IO5 A;  2Q2C A;  3EPE A;  3FVK A;  1NNP A;  3PMW A;  3W9W A;  4JXI A;  3MVY A;  2AIX A;  4RPO A;  1P1U A;  3QK6 A;  4YKI A;  5H8F B;  5ITP A;  1XVY A;  2YJP A;  3OEK A;  1ZJL A;  4R73 A;  1NL5 A;  2PT1 A;  4IO7 A;  4H8J A;  1IXI A;  4YKJ A;  1M5B A;  3TEP A;  1ZLQ A;  3FV1 A;  4X1B A;  1HSJ A;  3MZB A;  2I49 A;  1DTG A;  4M4G A;  1B3F A;  2Z8D A;  4BDM A;  3KJ7 A;  4YAH X;  5JTY B;  1B4Z A;  2XX8 A;  1YAE A;  5HM4 B;  1MRP A;  5I59 B;  1PC3 A;  4I1D A;  2RC9 A;  3PUX E;  2REG A;  4EQ7 A;  4R75 A;  3L6H A;  3C33 A;  3HO7 A;  2DE2 A;  2AL5 A;  5FTI A;  3G3I A;  5B70 A;  4R2B A;  1YPN A;  4BDL A;  2FYI A;  1QUI A;  3OD7 A;  1AIV A;  4F18 A;  1TWY A;  2I3V A;  3CI8 A;  1NH7 A;  4RPN A;  2HAU A;  1JVY A;  3TCG A;  4F31 B;  4GF8 A;  1WVJ A;  2NOO A;  4QRZ A;  2UVJ A;  1MS7 A;  4EF1 A;  2OBG A;  3OSR A;  3C35 A;  2ALU A;  3IB2 A;  3CSG A;  2UYE A;  1FQE A;  4PET A;  4YKK A;  2XXU A;  2O51 A;  2V3Q A;  4YZZ A;  5CBS A;  4PFU A;  2CMO A;  1N3X A;  4XKR A;  1ZBM A;  2P0S A;  3RLF E;  1URS A;  3K02 A;  3KFM A;  4ONY A;  2AL4 A;  4OZ9 A;  4Q5T A;  1DOT A;  1SI1 A;  3OO7 A;  3E13 X;  2Y7K A;  4BDQ A;  4NF8 A;  1B05 A;  3RQT A;  4ZZE A;  4H5F A;  3K6U A;  4OFL A;  3UK4 A;  3M3L A;  4OXV A;  5FHN A;  2QMW A;  1H45 A;  1QVS A;  4OET A;  1FQF A;  1M5D A;  2I4B A;  3B6W A;  3I3V A;  4H5G A;  4U4S A;  4IO2 A;  4LQ2 A;  1ATG A;  3KSX A;  1MY1 A;  2O69 A;  4ELP A;  3ODB A;  3GBB A;  3RY3 A;  1A8F A;  2XXX A;  2Z8E A;  2CZL A;  4KR5 A;  3B7D A;  2DP8 A;  2ONK E;  1N0T A;  3OSQ A;  4EXK A;  2OWT A;  1LCT A;  5H8Q B;  3T93 B;  1O63 A;  1MDP 1;  2X7Q A;  4JWX A;  1DTZ A;  1TT1 A;  1F9B A;  3T9U A;  3S9N C;  1IIT A;  4H0W A;  2B3F A;  4KI0 E;  1H44 A;  1UTH B;  1B9J A;  3KJT A;  3V83 A;  4E0X A;  3C31 A;  4DXB A;  3TDJ A;  3LBS A;  4L17 A;  5AA2 B;  4ZEK A;  1B58 A;  2DQV A;  2X7P A;  1QW0 A;  3ZKK A;  4NE4 A;  4PFY A;  3VDF A;  2O68 A;  4H6D A;  3TZA A;  4IY6 A;  1PDA A;  1VE4 A;  3SEY A;  2XXI A;  2NWJ A;  1GGG A;  1OQG A;  1Y3Q A;  1MM7 A;  2BJJ X;  3PGF A;  4EF2 A;  4F29 A;  4LAT A;  4DXU A;  3RT8 A;  3O6I A;  4NF4 A;  5FTH A;  1FTJ A;  2F5X A;  1EZO A;  4NF5 A;  3SKP A;  1D9V A;  4MF3 A;  4XTC Q;  1MQJ A;  1OVB A;  4OMB A;  1ZMG A;  4NTL A;  1NNF A;  3RTF B;  2ANJ A;  3SEV A;  2DWI A;  3IOU A;  3C4M A;  3PMX A;  3T9H B;  3DP6 A;  3MP1 A;  1M5E A;  3GXA A;  1DMB A;  1D3K A;  4MH5 A;  1B7Z A;  3VV5 A;  4YB7 A;  2NVU B;  4Q30 B;  2FA7 A;  2F7B A;  3FJM A;  4H65 A;  2A5T B;  1D9Y A;  4QFO A;  3D4G A;  4THI A;  3U94 A;  1LLS A;  3SES A;  4QFL A;  1I6A A;  4KCC A;  2I3W A;  2Z23 A;  3VE1 B;  4FAT A;  1QKB A;  4ZZA A;  3VVF A;  1L5T A;  4Z7E A;  3IK6 B;  2YPN A;  3A3U A;  3MP8 A;  1POT A;  3P7I A;  4WXJ A;  5F1Q A;  4X9T A;  5I58 B;  5K2Y A;  3G3F A;  1N7X A;  1LFH A;  2DWA A;  3VXC A;  1B3E A;  2Y7P A;  3MZ1 A;  1B40 A;  4LON B;  1Y20 A;  2QSX A;  1GVC A;  3KBR A;  2V3U A;  3FVN A;  3VXB A;  4RY1 A;  2GFE A;  3CSB A;  5HBC A;  2R9J A;  3ZS6 A;  4N13 A;  3QIM A;  3IX1 A;  4XKQ A;  3O28 A;  5BUU A;  4NF6 A;  1IZ1 A;  3RTW B;  2HXW A;  1FQD A;  4UAC A;  4BLA A;  4IB2 A;  4G77 A;  1B6H A;  1JW4 A;  2M8C A;  4BDN A;  4JWO A;  3T9V A;  5CM6 A;  5TU0 A;  2F97 A;  2XXT A;  1XOC A;  1IUD A;  5JEI A;  4G4P A;  1LFG A;  5DEX B;  5IKB A;  2IEE A;  3KN3 A;  4GWO A;  4N07 A;  4OFO A;  4HTG A;  4EQ9 A;  2GHA A;  2QS3 A;  3RT6 B;  4Q8R A;  1Y1M A;  3IJO B;  5DVJ A;  1MQH A;  5M2V A;  3S4U A;  1LAH E;  4AQ4 A;  1P1Q A;  3U1O A;  1VFE A;  1FTK A;  4ZE8 A;  4G2Z A;  3SEW A;  4R74 A;  3GBA A;  4DE8 A;  1NNT A;  3DP8 A;  5AA4 B;  3TCF A;  2XXV A;  2ZYN A;  3G3J A;  3IOW A;  2H9B A;  3N6T A;  2V25 A;  2PYY A;  3MPK A;  4TOZ A;  4U22 A;  4ZE9 A;  2O7U A;  1MXU A;  3PPO A;  3KN8 A;  4FE8 A;  3MVX A;  1N76 A;  5DTB A;  4C1T A;  2UVH A;  1MQD A;  1B1H A;  3OO6 A;  2UVG A;  5CI5 A;  3O6H A;  3O6G A;  1LBB A;  3KEI A;  1A8E A;  4R6K A;  3QUF A;  4AB5 A;  1FTL A;  3OOA A;  4TQU Q;  4KYE A;  2O7I A;  1POY 1;  5I2K A;  1Y3N A;  4U21 A;  1B5I A;  1O64 A;  4NWD A;  4U2R A;  4LP2 B;  5FHM A;  4P0I A;  1MPC A;  2Z22 A;  1WOD A;  3EHU A;  1BTJ A;  1PB8 A;  4XIG Q;  4PP0 A;  4GRK A;  3IR1 A;  2HEU A;  4GOT A;  2F34 A;  2DSF A;  5KZT A;  5I57 A;  3B6Q A;  4GQO A;  2ONS A;  3IAZ A;  3CIJ A;  4GIZ A;  2PVU A;  1Q1K A;  5A5X A;  2AYS A;  3D4C A;  3FVO A;  4JSD A;  3C32 A;  4XXU A;  4TLM B;  1ANF A;  1MY0 A;  3R6U A;  1OVT A;  3UP9 A;  2XD2 A;  2I4C A;  4EXL A;  1JEV A;  4YIC A;  3FVG A;  2RIN A;  4C1U A;  4DZ1 A;  1A40 A;  4IGR A;  4JDF A;  3PPP A;  2RCA A;  5I56 B;  2XXY A;  3BBR A;  4MFI A;  1QUK A;  3V89 B;  2QS4 A;  3K1N A;  4QSC A;  2G29 A;  3K4U A;  5I84 A;  1DPE A;  5H8F A;  3TTM A;  3UN6 A;  4O3C A;  1SBP A;  3PPQ A;  3IB1 A;  1SW2 A;  1PEB A;  1LAX A;  4F3B A;  1NH8 A;  2DS9 A;  1XHY A;  1Q35 A;  1AH5 A;  3VFJ A;  4GVO A;  3TEL A;  2VD2 A;  5AA3 A;  2FNC A;  2DXR A;  3PMV A;  4GLI A;  4DIG A;  4ZEF A;  4ELO A;  4X1D A;  4YB5 A;  4G8M A;  5KDT B;  4NWC A;  5JTY A;  2ZYK A;  3WAF A;  3G3K A;  5I59 A;  1Z7N E;  3CFL A;  3S9L C;  3FD3 A;  4P11 A;  4LZ7 A;  4BDO A;  3T9X B;  4LUB A;  2Z8F A;  4EQB A;  4FOR A;  1CE2 A;  2H25 A;  4EDP A;  4MLV A;  1B4H A;  2X26 A;  5CMM A;  3VLV A;  4E0W A;  1FQC A;  3A09 A;  1YCJ A;  5DVF A;  2HZK A;  1EH3 A;  3S9M C;  4FEB A;  4FAJ A;  1LBC A;  3LC8 A;  3QYT A;  3KGC A;  4NMY A;  3T66 A;  1N04 A;  3DLN A;  3HST A;  5KCJ B;  3EN3 A;  2QPQ A;  2HFB A;  2IA4 A;  3PPR A;  2V93 A;  4OWD A;  3H3G A;  3MP6 A;  1FTO A;  3H7M A;  2ZYM A;  4H8I A;  3G3G A;  4GD5 A;  5AA1 A;  2RCB A;  1J1N A;  3M3F A;  2O1L A;  1O7T A;  3M3K A;  5CMB A;  4G68 B;  3E9X A;  1Y9U A;  3LSF B;  2D21 A;  3K1M A;  3VVD A;  5H8N B;  1MXZ A;  2H4I A;  4EUO A;  3U92 A;  4RNS A;  5B7D A;  2A5S A;  2QS2 A;  3LR1 A;  4FEC A;  1FTM A;  1URD A;  2P2A A;  3L6G A;  3PUV E;  3N6U A;  5ELV A;  2RKM A;  3U93 A;  3IOV A;  5CRY A;  4LZ5 A;  2Q88 A;  1QKA A;  3W9V A;  3BFU A;  1B1X A;  5TP9 B;  1IEJ A;  3LUY A;  5L8D A;  3TOD A;  3FXQ A;  2DE3 A;  3TUS A;  1P1N A;  1USY H;  3FUZ A;  2RC7 A;  4ZDM A;  1QUJ A;  4NED A;  3TCH A;  1XVX A;  5H8Q A;  1B3G A;  3PUY E;  3ILU B;  1MY2 A;  2ZMB A;  5TPA B;  3B6T A;  5H8H B;  3RPW A;  1RYX A;  3FXU A;  3JV9 A;  3IOR A;  3VVE A;  4IY5 A;  1UTH A;  4HW8 A;  1II5 A;  4F2O A;  3Q28 A;  1NNK A;  1LB9 A;  1EZP A;  3VLW A;  3PUZ E;  5I2N B;  3DP4 A;  4F22 A;  2D5W A;  2PX1 A;  1QJM A;  3TQL A;  2VD3 A;  1MY3 A;  3H6W A;  3H6V A;  3U72 A;  3T96 B;  4GL8 A;  5AA2 A;  1UIV A;  2Q2A A;  3FJG A;  5ICT A;  2ZNS A;  3LSL A;  2PT2 A;  1MQI A;  4U4X A;  4OEU A;  1MXW A;  1UTB B;  2VHA A;  3IOT A;  3MAM A;  1N3W A;  3EF7 A;  1A55 A;  4OHN A;  4OFJ A;  4ZS9 A;  3KOS A;  2XX7 A;  1NMU A;  3UGW A;  2HCA A;  2PMS A;  4ESX A;  1FQB A;  3MQ9 A;  3MVZ A;  1MPB A;  4ESW A;  3R7X A;  3RN8 A;  2O1M A;  1US5 A;  5JK4 A;  4N6P A;  3MWB A;  4F1V A;  4YMB A;  4PQJ A;  3PU5 A;  4KQP A;  3K6V A;  3QAX A;  4OES A;  2OWS A;  2WKY A;  4FIM A;  2O84 X;  2DE4 A;  3Q25 A;  4U23 A;  3SEX A;  3IB0 A;  2A5T A;  5F7V A;  3OEN A;  2F6P A;  1LCF A;  1MQG A;  1LST A;  2UXA A;  3V5A A;  2QS1 A;  2E0S A;  2RC8 A;  1EZ9 A;  4KD5 A;  1M5C A;  5K2X A;  1IQ7 A;  3CFZ A;  4POX A;  2F6G A;  2LAO A;  1XT8 A;  2UVI A;  4DDD A;  4PFT A;  4R72 A;  1Y4T A;  1JW1 A;  3ILT B;  5I58 A;  3O2A A;  3ECR A;  4F1Y A;  2HQ0 A;  4RJZ A;  4ELR A;  4WED A;  4YU0 A;  5H8S A;  1XS5 A;  4R9G A;  3K2D A;  3O9P A;  3N26 A;  3EQ1 A;  3ZSF A;  3FGS A;  1US4 A;  1MG1 A;  4IO4 A;  1MPD A;  1I69 A;  4LVQ A;  4OYV A;  2DOJ A;  3KG2 A;  1Y3P A;  1B2H A;  1JET A;  4XKN A;  1MXV A;  4HCW A;  1IIW A;  3QXM A;  4OTE A;  1N84 A;  2OLB A;  3LSX A;  3U8Q A;  4H1X A;  3PPN A;  3JYR A;  3K1P A;  2I0C A;  5J1D A;  3O97 A;  3SER A;  3THI A;  2H99 A;  1PBQ A;  4R2F A;  3SDF A;  2ZXT A;  4Q0C A;  4G68 C;  5DEX A;  3PUW E;  4R6Y A;  2ZNU A;  4KPT A;  3K6W A;  1PB7 A;  2E1S A;  3QUJ A;  4OEV A;  4ZEB A;  1AL3 A;  4OER A;  1OQH A;  1H43 A;  2H98 A;  4DCY A;  2Q8J A;  2NUV A;  3AXF A;  4I8C A;  1JQF A;  3OO9 A;  1SVX B;  2G93 A;  3OMB A;  1MXY A;  4ND9 A;  3MUQ A;  5AA4 A;  3TTR A;  3GLB A;  4ZEC A;  2O6A A;  2OZZ A;  2OCU A;  3E4R A;  2KLF A;  1VR5 A;  3FXR A;  2F78 A;  4R6H A;  3TTL A;  3SET A;  3RNN A;  3FAT A;  1SDX A;  1AMF A;  1ZTY A;  4KYS A;  3K0V A;  4AB6 A;  2V84 A;  1QUL A;  1UQW A;  4RK2 A;  1P1W A;  2F8D A;  3TQW A;  4I9D A;  4YKP A;  4ELQ A;  3IL1 B;  1SYH A;  3ZKL A;  5L9O A;  4M1V A;  4KYD A;  2QL3 A;  1USY E;  4NF8 B;  4F3G A;  4RYA A;  4LA9 A;  1JNF A;  3VLU A;  2GRV A;  3FAS A;  2UYF A;  4ZEI A;  4G8N A;  3MC2 A;  1IXG A;  3CVG A;  4UA8 A;  4WEP A;  5DVI A;  1MY4 A;  3JZJ A;  3CG1 A;  3K01 A;  1HSE A;  1LGB C;  1Y1Z A;  1XC1 A;  4OEN A;  3CR9 A;  3OXN A;  2NXO A;  3SEU A;  1B5J A;  4LQ5 A;  3HPI A;  5L9M A;  1R6Z A;  1B7H A;  5DYH A;  1SD3 A;  2DXY A;  2XXQ A;  5L9S A;  2DWJ A;  4QF9 A;  3HCQ A;  5ITO A;  4OQO A;  4OVJ A;  3O29 A;  4PFW A;  4DCX A;  1ZU0 A;  3KSJ A;  1MH4 A;  1P99 A;  3UOR A;  3S2V A;  1ZKB A;  4IO6 A;  4X48 A;  1SQY A;  4GXS B;  1TXF A;  4QFK A;  1GTK A;  5I56 A;  4YB6 A;  1YTV A;  4QHQ A;  4C0R A;  2GHB A;  1A7L A;  2R71 A;  4F3P A;  3FIR A;  1OLA A;  1H3D A;  1RKM A;  3HV1 A;  5CC2 A;  3V8X B;  3UA8 A;  4RA1 A;  4NF4 B;  4FJP A;  4NF5 B;  1R9L A;  3K6X A;  3TKD A;  3OO8 A;  1MXX A;  3Q29 A;  3Q26 A;  2QRY A;  1PB9 A;  2Q9T A;  1B0H A;  2F36 A;  5KDT A;  3M8U A;  4JB7 A;  3G7W A;  1ZIU A;  1LFI A;  4IO3 A;  5AA2 D;  1D4N A;  1S50 A;  5BWJ A;  3HHG A;  4MBP A;  3C9H A;  3C36 A;  5HPQ A;  3PD8 A;  3MPL A;  3FZV A;  3RUM A;  1Y4C A;  2F7C A;  4QFN A;  1LAF E;  1CB6 A;  4JWY A;  4GXA A;  2OK2 A;  3IJX B;  1B46 A;  3BKI B;  3T22 A;  1T0K A;  3R26 A;  4QFP A;  3TFL A;  3H06 B;  3IO6 A;  3H6T A;  4F19 A;  1MDQ A;  4F1U A;  2XXH A;  2W7Y A;  4O3A A;  4RK9 A;  1BKA A;  2YLN A;  1GR2 A;  1IXC A;  3RGY A;  4KHZ E;  2XXR A;  1Z7M E;  4PE5 B;  1TFD A;  1DPP A;  1VFD A;  1P1O A;  5CBR A;  3UIF A;  1LAG E;  1R1N A;  5ISU A;  2B3B A;  2ONR A;  2ZNT A;  4U1O A;  4QSD A;  4WKM A;  4P0G A;  2VP1 A;  2ZYO A;  4JSO A;  4ECF A;  2GH9 A;  3Q27 A;  1SYI A;  5KCJ A;  1JVX A;  4KFQ A;  3EHS A;  1ELJ A;  3GZG A;  3MJN A;  1NFT A;  5FHO A;  3G3H A;  1B5H A;  1SW1 A;  2Y7I A;  1FQA A;  3QSL A;  4F2Q A;  3MVW A;  3TTK A;  1SI0 A;  4HS7 A;  1S9T A;  1A54 A;  4ISU A;  3OEM A;  1JW5 A;  3MZ9 A;  2D3I A;  2XXW A;  4U1Z A;  1IXH A;  4NF6 B;  3F11 A;  4G68 A;  3TYH A;  1JEU A;  4GFR A;  3I6V A;  4GL0 A;  4KCD A;  3HHF A;  1OLC A;  5H8N A;  4I62 A;  3FV2 A;  2Q89 A;  3A3C A;  2REJ A;  1RYO A;  3I5O A;  4DXC A;  1H76 A;  3PD9 A;  4XKP A;  2F35 A;  1OMP A;  3KN7 A;  2XXP A;  5EYF A;  5EHM A;  1HSL A;  1GV8 A;  3KZG A;  1DSN A;  2XD3 A;  1PBP A;  5TP9 A;  1FW0 A;  3CG3 A;  4Z0I A;  2I6E A;  3WAE A;  3TAJ A;  4MLQ A;  1AOV A;  3TPA A;  1KWH A;  3K00 A;  3CRB A;  1I6B A;  1TFA A;  2VOZ A;  3C34 A;  1B3L A;  1UIU A;  3OEL A;  5TPA A;  3TMG A;  2QMX A;  1NKX A;  3TTN A;  5H8H A;  2DWH A;  5CMC A;  4ZED A;  1BLF A;  1B3H A;  2DVZ A;  1N7W A;  3H4Z A;  2B65 A;  1BP5 A;  4BDR A;  3DM0 A;  2PBW A;  5I2N A;  2Y84 A;  1SW4 A;  2QJE A;  4HCY A;  2H5Y A;  3N94 A;  1VSO A;  2I0B A;  3USD A;  2VGQ A;  4O3B A;  2ABH A;  3H6U A;  1FCK A;  3HN0 A;  1B32 A;  2RF1 A;  2F7A A;  3S9E A;  4POW A;  1OIB A;  1UTB A;  4F3S A;  4DLD A;  2I58 A;  4YMA A;  1URG A;  3PV0 E;  3E3K A;  1EU8 A;  1BIY A;  1B52 A;  3DEL B;  5I2K B;  1S7Y A;  5ICQ A;  2HZL A;  3W15 C;  2THI A;  1MM6 A;  4TLL B;  5EHS A;  2R6G E;  4H67 A;  3H03 A;  2XHD A;  5IAI A;  1A99 A;  2P1S A;  3CFX A;  4RXL A;  1B7U A;  1R9Q A;  1B51 A;  2XX9 A;  3MW0 A;  5I57 B;  5AE4 A;  1I6Q A;  4FED A; 
#chains in the Genus database with same CATH topology
 1B0L A;  2Y7R A;  1K9Y A;  2EL5 A;  4G8H A;  4KHP E;  2XXK A;  4QSE A;  4LZ8 A;  2HAV A;  4R9F A;  3MBP A;  5CMK A;  4OA4 A;  2UUB E;  3OML A;  5A5X B;  1MH3 A;  4F39 A;  4JBZ A;  1EYJ A;  1LB8 A;  2ESN A;  2EMZ A;  5LOM A;  1BBG A;  3VYY A;  4WFT A;  1FSA A;  2V3T A;  3ONM A;  3D1R A;  3IO4 A;  3O66 A;  4NGU A;  3KOT A;  4I8O A;  2RTX A;  5I7I A;  4K3F A;  5DT6 A;  2ZZW A;  3BFT A;  2I48 A;  2Y7W A;  2DVC A;  4N6K A;  3LSW A;  5KL6 A;  2EOI A;  1EKZ A;  1M5F A;  2DYX A;  3C4T A;  3N5L A;  4WX9 A;  3EHT A;  4IGT A;  1SW5 A;  5A6K A;  4N91 A;  3FJ7 A;  1WDN A;  1XNR E;  2OJT A;  4IR8 A;  4IO5 A;  2Q2C A;  3EPE A;  3FVK A;  4AS5 A;  1NNP A;  3PMW A;  3W9W A;  4JXI A;  3MVY A;  3JAM C;  2AIX A;  4RPO A;  2KOU A;  1P1U A;  3QK6 A;  4YKI A;  5H8F B;  5ITP A;  1XVY A;  5IZZ A;  4N8Y A;  2YJP A;  3OEK A;  1ZJL A;  4R73 A;  1NL5 A;  2PT1 A;  4IO7 A;  5AC4 A;  2EJ4 A;  2HJJ A;  4H8J A;  1IXI A;  4O4K A;  4YKJ A;  2VRD A;  3IFC A;  1M5B A;  2CZI A;  1AAY A;  3TEP A;  2M1S A;  1ZLQ A;  3HXL A;  3FV1 A;  2EOY A;  4X1B A;  1HSJ A;  3MZB A;  2I49 A;  1DTG A;  2EOQ A;  1FPB A;  4M4G A;  1B3F A;  2DIX A;  5LLQ A;  2Z8D A;  1YYO A;  4BDM A;  3KJ7 A;  4YAH X;  5JTY B;  3J7A G;  2LTS A;  1B4Z A;  2XX8 A;  5EYG A;  2NA2 A;  1YAE A;  1T39 A;  5HM4 B;  1FPK A;  4I40 A;  1MRP A;  5I59 B;  1PC3 A;  4I3E A;  4IS1 C;  4I1D A;  2RC9 A;  3PUX E;  2REG A;  1YYZ A;  4EQ7 A;  1X3C A;  2EM3 A;  4R75 A;  3L6H A;  3C33 A;  1FPL A;  2DE2 A;  3HO7 A;  1J5E E;  2AL5 A;  3QG5 C;  2N3G A;  5FTI A;  3G3I A;  5B70 A;  4R2B A;  2WCC 3;  1YPN A;  4BDL A;  2FYI A;  1QUI A;  4PAI A;  3OD7 A;  1AIV A;  4F18 A;  4B3R E;  1TWY A;  3T1H E;  3VYX A;  2I3V A;  3CI8 A;  2HPG A;  1NH7 A;  4RPN A;  1UIL A;  1EH6 A;  2HAU A;  1JVY A;  3TCG A;  1LBV A;  4OVT A;  4F31 B;  4GF8 A;  1WVJ A;  1NUX A;  2NOO A;  3LLH A;  3VHT B;  5ADZ A;  4DI4 B;  4QRZ A;  2UVJ A;  1MS7 A;  4R2A A;  4EF1 A;  2OBG A;  3OSR A;  2MKN A;  2B7V A;  4I3Y A;  4NAP A;  2L3J A;  3C35 A;  2ALU A;  3RYD A;  1FPF A;  3IB2 A;  3EPK A;  3CSG A;  2QFL A;  4R2S A;  1FQE A;  2UYE A;  4PET A;  3ADL A;  5CFF E;  4YKK A;  2XXU A;  2O51 A;  5IWA E;  2V3Q A;  4YZZ A;  2EL4 A;  2JR1 A;  3THN A;  3KBZ A;  5CBS A;  2YT4 A;  1ZAA C;  5J16 A;  4PFU A;  2CMO A;  1N3X A;  4XKR A;  1ZBM A;  2P0S A;  3RLF E;  1URS A;  3K02 A;  4DUZ E;  3MHH C;  3KFM A;  4ONY A;  3J81 C;  1A1I A;  2AL4 A;  4OZ9 A;  3MHS C;  5EQA A;  4Q5T A;  1DOT A;  1SI1 A;  3OO7 A;  3E13 X;  1FJG E;  2Y7K A;  4BDQ A;  1X6E A;  4NF8 A;  3C4B A;  1N32 E;  3L00 A;  1BB8 A;  1B05 A;  3RQT A;  4ZZE A;  4H5F A;  2EN1 A;  3K6U A;  4OFL A;  3UK4 A;  3M3L A;  4OXV A;  5FHN A;  2ZZV A;  2QMW A;  2JOX A;  2B4M A;  1H45 A;  4G61 A;  4M30 A;  4PDD A;  4OVQ A;  3ZOQ B;  1JP4 A;  1FQF A;  1QVS A;  4OET A;  1M5D A;  2I4B A;  3B6W A;  2VT5 A;  3I3V A;  1IMC A;  5DNY A;  4HXV A;  4H5G A;  4U4S A;  4IO2 A;  4LQ2 A;  1ATG A;  3KSX A;  2MKZ A;  1MY1 A;  2O69 A;  2LJU A;  4OVS A;  4ELP A;  2CPN A;  3ODB A;  1ZBT A;  3GBB A;  3RY3 A;  1RDZ A;  1A8F A;  1KA1 A;  2XXX A;  2Z8E A;  2CZL A;  4KR5 A;  3B7D A;  4JI6 E;  1LBZ A;  2YSP A;  2DP8 A;  2ONK E;  5IZ3 A;  1N0T A;  2YU8 A;  3OSQ A;  4EXK A;  2DRP A;  2OWT A;  4X65 E;  1LCT A;  2EN3 A;  5H8Q B;  3T93 B;  1O63 A;  1MDP 1;  2EQ3 A;  2X7Q A;  3T1Y E;  2DLK A;  4JWX A;  4BHC A;  2LUP B;  1DTZ A;  1TT1 A;  5FBP A;  1F9B A;  3T9U A;  2EMG A;  3S9N C;  2NUF A;  1IIT A;  3B50 A;  4H0W A;  2B3F A;  4KI0 E;  1H44 A;  1UTH B;  1NV2 A;  1B9J A;  3KJT A;  3V83 A;  2L3C A;  4E0X A;  3KZY A;  3C31 A;  4DXB A;  5I5P A;  1DGC A;  3TDJ A;  3LBS A;  4O24 A;  4L17 A;  5AA2 B;  1T4O A;  4GWX A;  4WYQ B;  4JI8 E;  4ZEK A;  1B58 A;  2DQV A;  2X7P A;  1QW0 A;  2QVR A;  3ZKK A;  4NE4 A;  4BC7 A;  4PFY A;  3VDF A;  2O68 A;  4P7D A;  4H6D A;  1TF3 A;  3H09 A;  3TZA A;  4IY6 A;  1PDA A;  1INP A;  1VE4 A;  4KZS A;  1GZ6 A;  2LE2 A;  2XXI A;  3SEY A;  2YTG A;  4PFR A;  2NWJ A;  1GGG A;  2EMB A;  1OQG A;  1Y3Q A;  1MM7 A;  2BJJ X;  3PGF A;  2L2K B;  4EF2 A;  1FBG A;  2XWI A;  4F29 A;  4LAT A;  4DXU A;  2JYA A;  3RT8 A;  3O6I A;  4NF4 A;  2F5X A;  1FTJ A;  5FTH A;  1EZO A;  4NF5 A;  3SKP A;  1A1G A;  1D9V A;  4MF3 A;  4XTC Q;  1MQJ A;  1OVB A;  4OMB A;  1ZMG A;  2YTP A;  4NTL A;  4R2D A;  1NNF A;  3RTF B;  4P1E A;  2ANJ A;  1EYK A;  3SEV A;  2DWI A;  1YYK A;  3IOU A;  2VF1 A;  3C4M A;  2EPZ A;  2LTR A;  3PMX A;  3T9H B;  3DP6 A;  3MP1 A;  1M5E A;  3GXA A;  1FBP A;  4R2C A;  1DMB A;  1D3K A;  4MH5 A;  1B7Z A;  3VV5 A;  4YB7 A;  2NVU B;  4Q30 B;  2FA7 A;  2E72 A;  3BIH A;  2L6M A;  2F7B A;  2BBG A;  4NF0 A;  3FJM A;  4H65 A;  2IHR 1;  2A5T B;  2EOH A;  2YTO A;  2ZM6 E;  2JJK A;  1D9Y A;  4GWZ A;  4QFO A;  3D4G A;  4THI A;  2Q8U A;  4WXD A;  1X47 A;  1LLS A;  3U94 A;  3SES A;  1Z1B A;  4QFL A;  1DBZ A;  1I6A A;  4KCC A;  2I3W A;  2LCE A;  2EP3 A;  2EM6 A;  2Z23 A;  5IGA A;  4ZYE A;  3VE1 B;  4FAT A;  1KYQ A;  1QKB A;  4ZZA A;  3VVF A;  1L5T A;  4KWY A;  4Z7E A;  2YPN A;  3A3U A;  3IK6 B;  3MP8 A;  1POT A;  3P7I A;  4WXJ A;  2DDK A;  4X9T A;  5F1Q A;  2A25 A;  5I58 B;  1FBF A;  5K2Y A;  2JOB A;  3G3F A;  3B8B A;  4OVP A;  4P3L A;  1KZ8 A;  1N7X A;  1LFH A;  2DGC A;  5AE1 A;  2DWA A;  3VXC A;  1EH8 A;  2EPK X;  1B3E A;  2Y7P A;  3MZ1 A;  4R2P A;  2EMC A;  4GZN C;  2EM2 A;  1B40 A;  2EN2 A;  4LON B;  5AE2 A;  3IWC A;  1Y20 A;  2QSX A;  1GVC A;  3KBR A;  2V3U A;  3FVN A;  3VXB A;  1A1F A;  2GFE A;  4RY1 A;  3CSB A;  5HBC A;  3EPL A;  2R9J A;  1D9Q A;  4DR1 E;  1LBX A;  3C6K A;  1LLM C;  3ZS6 A;  4N13 A;  5BR8 E;  3QIM A;  3U65 A;  3IX1 A;  4XKQ A;  3O28 A;  5BUU A;  4NF6 A;  2F8B A;  1IZ1 A;  3RTW B;  2HXW A;  2EM7 A;  3J7Y p;  1FQD A;  1ZU1 A;  4UAC A;  4BLA A;  4RHB B;  3SZP A;  4IB2 A;  1CNQ A;  4G77 A;  2YTJ A;  1B6H A;  1JW4 A;  2M8C A;  4BDN A;  2YTF A;  4GBV A;  4JWO A;  3T9V A;  4JI2 E;  5CM6 A;  5TU0 A;  2F97 A;  2XXT A;  2FHY A;  1XOC A;  4GX4 A;  4LF8 E;  1IUD A;  2EPO A;  1X6H A;  5JEI A;  4G4P A;  1LFG A;  5DEX B;  5IKB A;  2PCR A;  2IEE A;  3KN3 A;  2JXP A;  4GWO A;  4N07 A;  4OFO A;  2L92 A;  4HTG A;  4B3T E;  4EQ9 A;  2GHA A;  2QS3 A;  3RT6 B;  2EOR A;  4Q8R A;  4PTK A;  2FBP A;  1Y1M A;  1DK4 A;  3IJO B;  4PAK A;  5DVJ A;  1MQH A;  5M2V A;  3S4U A;  1LAH E;  4AQ4 A;  2P3V A;  3MSW A;  1P1Q A;  4N15 A;  3U1O A;  1X49 A;  2VPN A;  3HTX A;  1VFE A;  3K6Q A;  1FTK A;  3RPL B;  4GX6 A;  4ZE8 A;  4G2Z A;  3SEW A;  4NQ8 A;  4R74 A;  4P78 A;  3GBA A;  4UAB A;  3IWB A;  4DE8 A;  1NUY A;  5AAS A;  1NNT A;  3A29 A;  3DP8 A;  3EKI A;  5AA4 B;  3TCF A;  2ZYN A;  2XXV A;  2EZ6 A;  4DV5 E;  3G3J A;  3IOW A;  4QXD A;  4PAF A;  1XNQ E;  2H9B A;  2E1M A;  3T0J A;  3N6T A;  2V25 A;  2PYY A;  1J26 A;  3MPK A;  4TOZ A;  4U22 A;  4ZE9 A;  1WHQ A;  2RPC A;  2O7U A;  1MXU A;  2EPL X;  2G7H A;  3PPO A;  3FBP A;  3KN8 A;  4GKJ E;  4FE8 A;  3MVX A;  1N76 A;  5DTB A;  4C1T A;  2UXD E;  4PGN A;  2N8X A;  2UVH A;  1MQD A;  1BBO A;  1FBD A;  2Y5L A;  1B1H A;  3OO6 A;  2UVG A;  2GHF A;  5CI5 A;  3O6H A;  3O6G A;  5IZ1 A;  1LBB A;  2YTN A;  3KEI A;  1FPI A;  1A8E A;  2EM0 A;  4R6K A;  5AE3 A;  3QUF A;  4AB5 A;  1FTL A;  3QMF A;  4P56 A;  2JWO A;  3OOA A;  4TQU Q;  1WHN A;  2ENA A;  5KL4 A;  1HNW E;  1HNX E;  4R03 A;  1DI2 A;  2O7I A;  4KYE A;  1POY 1;  5I2K A;  1STU A;  4MJO A;  1Y3N A;  4U21 A;  1B5I A;  1O64 A;  4NWD A;  4U2R A;  4LP2 B;  4PFI A;  5FHM A;  2L8T A;  2Z22 A;  1MPC A;  2EN6 A;  1WOD A;  3EHU A;  1NV6 A;  2WEF A;  4P0I A;  2UXC E;  1BTJ A;  1I94 E;  1PB8 A;  4XIG Q;  4PP0 A;  2R8T A;  4GRK A;  1YZ9 A;  3KZZ A;  3IR1 A;  2HEU A;  4GOT A;  2F34 A;  2DSF A;  5KZT A;  5I57 A;  3B6Q A;  4GQO A;  3KC1 A;  2ONS A;  3IAZ A;  1DCU A;  1JK1 A;  3CIJ A;  2YSO A;  4LN5 A;  4GIZ A;  2PVU A;  1Q1K A;  2K7I A;  2XWV A;  5A5X A;  5KL7 A;  2AYS A;  1TF6 A;  2EPA A;  3MYU A;  5LTC A;  1FJ6 A;  3D4C A;  2ELY A;  3FVO A;  4JSD A;  2JP9 A;  3C32 A;  1NV5 A;  4XXU A;  3F6H A;  4TLM B;  2EOX A;  1ANF A;  1MY0 A;  3R6U A;  1OVT A;  1GQE A;  3UP9 A;  1FBH A;  2XD2 A;  1HNZ E;  4TUI A;  2I4C A;  2KR0 A;  4GWY A;  4HE2 A;  1NEI A;  4EXL A;  2YU5 A;  1JEV A;  4YIC A;  3FVG A;  2RIN A;  4C1U A;  4DZ1 A;  1A40 A;  4IGR A;  2EPC A;  4JDF A;  3PPP A;  4X04 A;  2RCA A;  5I56 B;  2XXY A;  3BBR A;  1IMB A;  4MFI A;  1QUK A;  3V89 B;  2QS4 A;  1EYI A;  3K1N A;  4QSC A;  2G29 A;  3K4U A;  2WYP A;  5I84 A;  1DPE A;  5H8F A;  3TTM A;  3UN6 A;  1SFE A;  4O3C A;  1SBP A;  3PPQ A;  3IB1 A;  1UN6 B;  1SW2 A;  1PEB A;  1LAX A;  2FGG A;  4N4U A;  3BBG A;  4F3B A;  3GYY A;  1G2F C;  1NH8 A;  2DS9 A;  2YTD A;  2EPX A;  1XHY A;  1Q35 A;  1AH5 A;  5TSE A;  2L33 A;  3VFJ A;  4GVO A;  4MNP A;  3TEL A;  2VD2 A;  3JU0 A;  2FNC A;  5AA3 A;  2DXR A;  3PMV A;  4GLI A;  4DIG A;  4H45 A;  4ZEF A;  4ELO A;  3PTY A;  4X1D A;  4YB5 A;  2R76 A;  5F3W A;  2MDR A;  4G8M A;  3KWR A;  4LFC E;  4NWC A;  5KDT B;  3E79 A;  5JTY A;  2ZYK A;  3WAF A;  3G3K A;  4JV5 E;  5I59 A;  2EPM X;  1Z7N E;  2EOS A;  2N3H A;  1YUI A;  3CFL A;  3S9L C;  2JVA A;  3J80 C;  3FD3 A;  4MCO A;  4P11 A;  1NV1 A;  4N8G A;  4LZ7 A;  2EWL A;  4BDO A;  3LV0 A;  2EML A;  5LMU E;  1WXR A;  3T9X B;  4F2J C;  2Z8F A;  4JI3 E;  4LUB A;  1FBE A;  4EQB A;  2RSI A;  4FOR A;  4JYA E;  2H36 X;  4R2Q A;  3TQM A;  1CE2 A;  2WZO A;  2QVU A;  2H25 A;  4EDP A;  4MLV A;  1B4H A;  2MC6 A;  5LL6 R;  2F4V E;  1T38 A;  2X26 A;  2B9D A;  5CMM A;  3VLV A;  4E0W A;  1FQC A;  4FBP A;  3A09 A;  4MIJ A;  1YCJ A;  5DVF A;  2HZK A;  1EH3 A;  3S9M C;  4P47 A;  4FEB A;  4FAJ A;  1LBC A;  3LC8 A;  3QYT A;  4IJD A;  3OTO E;  2HC5 A;  3KGC A;  1LBW A;  2CEX A;  4NMY A;  3T66 A;  1N04 A;  3DLN A;  3HST A;  2WBS A;  5KCJ B;  3EN3 A;  2QPQ A;  5A5L A;  2B4L A;  2HFB A;  5A2Q C;  2IA4 A;  3PPR A;  2V93 A;  4OWD A;  2DB2 A;  5IV8 B;  3H3G A;  4X8R A;  3MP6 A;  1WRJ A;  1FTO A;  3H7M A;  2ZYM A;  1IQS A;  4H8I A;  3G3G A;  4GD5 A;  2K4V A;  5AA1 A;  4LF9 E;  2RCB A;  1J1N A;  3M3F A;  4M9V C;  2O1L A;  2EMF A;  1O7T A;  4MAG A;  4GKK E;  4JI5 E;  4O7M A;  1FJ9 A;  1ZR9 A;  3M3K A;  5CMB A;  4G68 B;  3E9X A;  1Y9U A;  3LSF B;  2D21 A;  3K1M A;  3VVD A;  3BIG A;  2D9H A;  5H8N B;  4XF5 A;  1MXZ A;  2H4I A;  4EUO A;  3U92 A;  2P3N A;  4RNS A;  5ET6 A;  4PF6 A;  5LDZ A;  5B7D A;  2A5S A;  2QS2 A;  1KA0 A;  3LR1 A;  2DMI A;  4FEC A;  1FTM A;  1URD A;  2P2A A;  3L6G A;  3PUV E;  4DV4 E;  3N6U A;  2EOE A;  2FTX B;  2FIX A;  5ELV A;  2RKM A;  2YZT A;  4XEQ A;  3IFA A;  3U93 A;  2R1F A;  3IOV A;  3EPH A;  5CRY A;  4LZ5 A;  2Q88 A;  1QKA A;  5IXM B;  4O94 A;  4NHR A;  4DR4 E;  3BFU A;  2KHX A;  3W9V A;  2EPR A;  1B1X A;  5TP9 B;  4X62 E;  2DLQ A;  1IEJ A;  3LUY A;  1FPD A;  5L8D A;  3TOD A;  2ADR A;  1RC7 A;  3FXQ A;  2DE3 A;  3TUS A;  1P1N A;  4DKK A;  1USY H;  2VPO A;  3FUZ A;  2RC7 A;  4ZDM A;  1QUJ A;  4NED A;  2LT7 A;  3TCH A;  2Y5K A;  1XVX A;  5H8Q A;  1B3G A;  3PUY E;  3ILU B;  1MY2 A;  2ZMB A;  5TPA B;  3B6T A;  5H8H B;  3RPW A;  1RYX A;  2EM4 A;  2LRS A;  1PKP A;  3FXU A;  3JV9 A;  4BMJ A;  2EOJ A;  3IOR A;  3VVE A;  4IY5 A;  1UTH A;  4GWS A;  4HW8 A;  1II5 A;  1G0I A;  4F2O A;  3Q28 A;  1NNK A;  1LB9 A;  2NUG A;  4PFB A;  1EZP A;  3VLW A;  3PUZ E;  5I2N B;  2WX9 A;  3DP4 A;  4F22 A;  2D5W A;  2LJH A;  4X66 E;  2PX1 A;  1QJM A;  2EM9 A;  3TQL A;  2VD3 A;  1MY3 A;  4YHH E;  3H6W A;  3H6V A;  3U72 A;  2V87 A;  3T96 B;  3M99 B;  4GL8 A;  5AA2 A;  5AC5 A;  1UIV A;  3E78 A;  2Q2A A;  1IMA A;  4DR6 E;  3FJG A;  4X64 E;  2WBT A;  2EPP A;  1LEV A;  5ICT A;  2GLI A;  2ZNS A;  3LSL A;  4GWW A;  4PBQ A;  2PT2 A;  1MQI A;  4U4X A;  4OEU A;  1MXW A;  1UTB B;  2VHA A;  3IOT A;  2ELZ A;  2UXB E;  3MAM A;  1N3W A;  3EF7 A;  1A55 A;  4OHN A;  4OFJ A;  4ZS9 A;  3KOS A;  1G0H A;  2XX7 A;  1NMU A;  2F3B A;  4GEQ B;  3UGW A;  5T6J A;  2HCA A;  2PMS A;  4ESX A;  1FQB A;  1SR9 A;  3MQ9 A;  4PCD A;  3MVZ A;  3T1B A;  1T4L B;  4R8O A;  1MPB A;  4ESW A;  4DUY E;  2BJI A;  2MKD A;  3R7X A;  2XWK A;  4M2Z A;  3RN8 A;  2O1M A;  3JTZ A;  1US5 A;  4F54 A;  1MEY C;  5JK4 A;  2CTD A;  4N6P A;  2EOF A;  3MWB A;  4F1V A;  4YMB A;  1ZBQ A;  4O5G A;  4PQJ A;  3PU5 A;  2EL6 A;  4KQP A;  3K6V A;  4OX9 E;  3QAX A;  4OES A;  2EPU A;  1VDW A;  2OWS A;  2WKY A;  2YRM A;  3HPZ A;  4FIM A;  2O84 X;  1Q9D A;  2DE4 A;  3BGH A;  4RH8 A;  3Q25 A;  4U23 A;  1N34 E;  2LMZ A;  3SEX A;  3IB0 A;  3ADJ A;  4LF5 E;  2A5T A;  4L8N A;  5F7V A;  2MC5 A;  3AUZ A;  3OEN A;  2F6P A;  1LCF A;  2HHH E;  1MQG A;  1LST A;  2UXA A;  3ISP A;  3V5A A;  2QS1 A;  2E0S A;  1LBY A;  2RC8 A;  4O7I A;  1EZ9 A;  4KD5 A;  1M5C A;  5K2X A;  1NCS A;  1IQ7 A;  3CFZ A;  3LML A;  5KL3 A;  2VQF E;  4AS4 A;  5ET5 A;  2FVZ A;  4F9B B;  4POX A;  3AV0 A;  2F6G A;  2LAO A;  1XT8 A;  2UVI A;  4DDD A;  4PFT A;  4R72 A;  1Y4T A;  1JW1 A;  3ILT B;  5I58 A;  3O2A A;  2MDG A;  4PC9 A;  3ECR A;  4F1Y A;  1IMU A;  2HQ0 A;  4LFA E;  1TN9 A;  4RJZ A;  4JVD A;  4WSG A;  4N4R B;  1A1J A;  4ELR A;  3NOH A;  4WED A;  4YU0 A;  4ZYG A;  4B3M E;  4B3S E;  4NG7 A;  5H8S A;  4BC9 A;  4MHF A;  1XS5 A;  5ESY A;  2Q8M A;  5A6B A;  4R9G A;  3K2D A;  1NUZ A;  3O9P A;  2LBS B;  3N26 A;  1RDY A;  3EQ1 A;  4DR2 E;  3ZSF A;  3FGS A;  3LUZ A;  2PFZ A;  1DQ3 A;  1MGT A;  2WBB A;  1MG1 A;  1US4 A;  4IO4 A;  1MPD A;  1I69 A;  2DOJ A;  4LVQ A;  4OYV A;  3KG2 A;  1Y3P A;  1X48 A;  1B2H A;  2HGH A;  1JET A;  4XKN A;  5KL2 A;  1MXV A;  4HCW A;  1RMD A;  1IIW A;  3QXM A;  1RQ0 A;  2ODR C;  1N84 A;  4OTE A;  2OLB A;  4DV3 E;  3LSX A;  2EMX A;  2E5L E;  3U8Q A;  2LUQ A;  4MNC A;  4H1X A;  3PPN A;  3JYR A;  3K1P A;  2I0C A;  5J1D A;  4F9C B;  3O97 A;  2RS7 A;  3SER A;  3DF6 A;  3THI A;  2DSY A;  2H99 A;  1PBQ A;  1B69 A;  4HEI A;  1JK2 A;  4R2F A;  1N36 E;  2CZH A;  3SDF A;  2ZXT A;  2VQE E;  4Q0C A;  4DR5 E;  4G68 C;  4NXN E;  4ZYH A;  4L5N C;  4LFB E;  5DEX A;  3PUW E;  4JI7 E;  2EN7 A;  1FPJ A;  4R6Y A;  2JPA A;  2ZNU A;  4KPT A;  3K6W A;  1PB7 A;  2EN8 A;  2E1S A;  3QUJ A;  2I13 A;  2RQL A;  4MEV A;  4OEV A;  4ZEB A;  1AL3 A;  1SPI A;  3KC0 A;  4OER A;  1IQO A;  2XWO A;  4WSP A;  1KJK A;  1FPE A;  1OQH A;  2EM8 A;  2EMW A;  1H43 A;  4AQY E;  2H98 A;  4DCY A;  1XI6 A;  2HXR A;  2YRH A;  2Q8J A;  2NUV A;  2OX3 A;  4PDH A;  3AXF A;  2V4C A;  4I8C A;  1JQF A;  3OO9 A;  2RSM A;  1SVX B;  2G93 A;  3RPL A;  3OMB A;  4BBY A;  1MXY A;  2I9I A;  3HQ1 A;  1YYW A;  4ND9 A;  4JVI A;  3MUQ A;  2EQ1 A;  5AA4 A;  3TTR A;  3GLB A;  4ZEC A;  4K0K E;  2O6A A;  4WXC A;  2OZZ A;  2OCU A;  1AWB A;  3E4R A;  2KLF A;  1VR5 A;  3FXR A;  2ENH A;  2F78 A;  4R6H A;  3TTL A;  3SET A;  1X5W A;  3RNN A;  3FAT A;  1SDX A;  1AMF A;  1ZTY A;  4KYS A;  3K0V A;  2V84 A;  4AB6 A;  5F24 A;  2F3D A;  1QUL A;  1UQW A;  2EPN A;  1F2I G;  1FTA A;  1YFH A;  4RK2 A;  2B7T A;  4LU9 A;  1P1W A;  4O43 A;  4Q35 B;  2F8D A;  2YTQ A;  3EPJ A;  3FXB A;  4BS9 A;  2KQZ A;  3TQW A;  4NZV A;  4I9D A;  4YKP A;  4ELQ A;  4BHB A;  2VE7 C;  4GBW A;  2FIE A;  3IL1 B;  2LVH A;  3BF2 A;  2EOO A;  1SYH A;  2CT1 A;  3ZKL A;  5L9O A;  4DV2 E;  2L2N A;  4M1V A;  3DJW A;  1FKA E;  4KYD A;  2QL3 A;  1USY E;  1A1K A;  1A1H A;  4NF8 B;  4M0V A;  4F3G A;  4NXM E;  4O8M A;  4RYA A;  4LA9 A;  1JNF A;  3VLU A;  4BCA A;  2GRV A;  1YUJ A;  4MNI A;  3FAS A;  2UYF A;  5ET8 A;  4G8N A;  4ZEI A;  2JY9 A;  4DV0 E;  3MC2 A;  1IXG A;  3CVG A;  4UA8 A;  4WEP A;  5DVI A;  1MY4 A;  2PFY A;  4KXP A;  1EH7 A;  2EMY A;  1UHZ A;  3JZJ A;  2RS6 A;  3CG1 A;  2ENC A;  3K01 A;  1HSE A;  1LGB C;  1Y1Z A;  1XC1 A;  4OEN A;  3CR9 A;  3OXN A;  4DMI A;  1G2D C;  2NXO A;  3ADG A;  3SEU A;  3F6G A;  4MX6 A;  5IT9 C;  5IZ3 B;  1B5J A;  4LQ5 A;  1RDX A;  3HPI A;  5L9M A;  1R6Z A;  1XMO E;  1B7H A;  1NV4 A;  1T4N A;  4HE1 A;  5DYH A;  1SD3 A;  3IWD A;  2DXY A;  2XXQ A;  4PGP A;  2DWJ A;  5L9S A;  4QF9 A;  5EQ9 A;  3HCQ A;  5ITO A;  1K9Z A;  4OQO A;  4OVJ A;  3O29 A;  3HFU A;  4PFW A;  1ZU0 A;  4DI3 D;  3KSJ A;  4DCX A;  1MH4 A;  1P99 A;  3UOR A;  4OAN A;  3S2V A;  1IBK E;  1ZKB A;  1IBM E;  4IO6 A;  4F6N A;  3UK3 C;  4X48 A;  4QBA A;  1QU6 A;  1SQY A;  2WBD A;  5EQ7 A;  4YY3 E;  4GXS B;  1TXF A;  4QFK A;  1GTK A;  5I56 A;  4YB6 A;  1YTV A;  4QHQ A;  4C0R A;  1NV0 A;  2GHB A;  1IBL E;  2YWQ A;  2XA5 A;  2M4I A;  4H46 A;  4JI1 E;  1A7L A;  4LF6 E;  3BID A;  2V8Q B;  2J7J A;  2R71 A;  4F3P A;  3FIR A;  1OLA A;  1H3D A;  3MST A;  1RKM A;  3HV1 A;  5CC2 A;  2KON A;  3V8X B;  3UA8 A;  4RA1 A;  2ODR D;  4DR3 E;  4NF4 B;  4FJP A;  4NF5 B;  4P8B A;  1R9L A;  3K6X A;  3TKD A;  4R2E A;  4LTY A;  3OO8 A;  1MXX A;  3VK6 A;  3Q29 A;  2M9A A;  3ADI A;  3Q26 A;  2YTI A;  4J8Z A;  2QRY A;  4F9A B;  1PB9 A;  2Q9T A;  1B0H A;  2F36 A;  5KDT A;  3M8U A;  4JB7 A;  1X6F A;  3G7W A;  2NUE A;  4FK5 C;  1ZIU A;  1LFI A;  4IO3 A;  5AA2 D;  1D4N A;  1A1L A;  1S50 A;  2CEY A;  5BWJ A;  3HHG A;  4MBP A;  3C9H A;  3C36 A;  5HPQ A;  3PD8 A;  2V85 A;  4OVR A;  3MPL A;  2FV4 B;  3FZV A;  3THO B;  3RUM A;  1Y4C A;  2F7C A;  2V88 A;  4QFN A;  2EQ0 A;  1LAF E;  4JI0 E;  1CB6 A;  2Q74 A;  4JWY A;  4GXA A;  2OK2 A;  4P9K A;  1P47 A;  3IJX B;  1B46 A;  3BKI B;  3T22 A;  1T0K A;  4WPY A;  3R26 A;  4QFP A;  3TFL A;  3RMP A;  3H06 B;  4Q28 A;  3IO6 A;  3H6T A;  4F19 A;  1MDQ A;  5I3S A;  4F1U A;  2XXH A;  2EMH A;  2W7Y A;  4O3A A;  4RK9 A;  1BKA A;  4GX3 A;  2YLN A;  1GR2 A;  1IXC A;  1YXI A;  3RGY A;  4KHZ E;  1QNT A;  2XXR A;  1Z7M E;  4PE5 B;  1TFD A;  2V89 A;  1DPP A;  1VFD A;  1P1O A;  5CBR A;  2V86 A;  1PJS A;  3UIF A;  5A6A A;  1LAG E;  1R1N A;  5ISU A;  1YZ0 A;  2B3B A;  2ONR A;  2ZNT A;  4QSD A;  4U1O A;  4WKM A;  4P0G A;  4X8W A;  2VP1 A;  2ZYO A;  4JSO A;  1BK4 A;  4LF7 E;  1FPG A;  4ECF A;  2EMK A;  2GH9 A;  3Q27 A;  1SYI A;  1PJQ A;  5KCJ A;  1JVX A;  4KFQ A;  1FBC A;  1WJP A;  3EHS A;  1ELJ A;  4MMP A;  3GZG A;  3MJN A;  1NFT A;  5FHO A;  3G3H A;  5KL5 A;  1B5H A;  1SW1 A;  2Y7I A;  2ZZX A;  3CHG A;  1FQA A;  3QSL A;  4F2Q A;  1NI9 A;  4GWU A;  2EM5 A;  3MVW A;  3TTK A;  1SI0 A;  2B3T B;  1S9T A;  2GQ1 A;  4HS7 A;  1A54 A;  4ISU A;  2NAB A;  3OEM A;  2PRT A;  1JW5 A;  3MZ9 A;  2D3I A;  2XXW A;  4U1Z A;  1IXH A;  4NF6 B;  3F11 A;  4X9J A;  4G68 A;  1JEU A;  3TYH A;  4GFR A;  3I6V A;  4GL0 A;  4KCD A;  3HHF A;  4PBH A;  3HPS A;  1O0W A;  4R2R A;  1OLC A;  5H8N A;  4I62 A;  1IMD A;  2EN4 A;  3FV2 A;  4NX1 A;  2Q89 A;  3A3C A;  2CSH A;  2REJ A;  2LV2 A;  2GPI A;  4HE0 A;  4NN3 A;  1RYO A;  3I5O A;  3P1X A;  4DXC A;  1H76 A;  3PD9 A;  4XKP A;  5EYH A;  2F35 A;  1OMP A;  1NUW A;  3KN7 A;  2XXP A;  5EYF A;  5EHM A;  1HSL A;  1GV8 A;  3KZG A;  1IME A;  5A6B D;  1IMF A;  1DSN A;  2XD3 A;  1PBP A;  5TP9 A;  4DV1 E;  1FW0 A;  1N3G A;  3CG3 A;  4N81 A;  1FRP A;  4Z0I A;  2I6E A;  3WAE A;  4N6D A;  5A69 A;  3TAJ A;  2HHM A;  4MLQ A;  1AOV A;  2V83 A;  3TPA A;  1KWH A;  3K00 A;  3CRB A;  1I6B A;  2EMA A;  4DR7 E;  4PF8 A;  1TFA A;  2VOZ A;  3C34 A;  4ZYD A;  1B3L A;  1UIU A;  3OEL A;  5TPA A;  3TMG A;  2QMX A;  1NKX A;  3TTN A;  5H8H A;  2CZK A;  2DWH A;  5CMC A;  2EOM A;  4ZED A;  2UUA E;  1BLF A;  5A6J A;  2DMY A;  1B3H A;  2DVZ A;  2WYK A;  1N7W A;  3H4Z A;  4PE3 A;  2B65 A;  1L4S A;  1BP5 A;  4BDR A;  3DM0 A;  2PBW A;  5I2N A;  1XMQ E;  2Y84 A;  1SW4 A;  2OWZ A;  2QJE A;  4HCY A;  4LF4 E;  2H5Y A;  3N94 A;  1VSO A;  1HR0 E;  2I0B A;  3USD A;  1UBD C;  2VGQ A;  4O3B A;  2ABH A;  3H6U A;  1FCK A;  3HN0 A;  4JVC A;  4DV7 E;  1B32 A;  4N17 A;  2RF1 A;  2F7A A;  1N33 E;  3S9E A;  4POW A;  2L2M A;  3ROJ A;  1OIB A;  1UTB A;  5DW8 A;  5LMN E;  4F3S A;  2WBU A;  4OOG C;  4DLD A;  2I58 A;  4YMA A;  1URG A;  3PV0 E;  3E3K A;  1EU8 A;  1BIY A;  1B52 A;  4P1L A;  4TUG A;  5EQ8 A;  3FIG A;  3DEL B;  2YTE A;  4DV6 E;  5I2K B;  1S7Y A;  2EE8 A;  2QVV A;  5IM2 A;  1YSA C;  5ICQ A;  2UU9 E;  2HZL A;  1NV3 A;  3W15 C;  2UUC E;  5FLX C;  2THI A;  5ET7 A;  1MM6 A;  4TLL B;  2BB8 A;  5EHS A;  2R6G E;  4NHB A;  1NV7 A;  4H67 A;  3H03 A;  2YRK A;  2LO3 A;  4F6M A;  2XHD A;  5IAI A;  1A99 A;  2M7Q A;  1PJT A;  2P1S A;  3C6M A;  4JI4 E;  5T3J A;  3CFX A;  2EMI A;  4RXL A;  1B7U A;  1R9Q A;  1B51 A;  2XX9 A;  2L5V A;  1QGX A;  2EOZ A;  3MW0 A;  5I57 B;  5AE4 A;  1I6Q A;  4XFE A;  4FED A; 
#chains in the Genus database with same CATH homology
 1B0L A;  2Y7R A;  4G8H A;  4QSE A;  4LZ8 A;  2HAV A;  4R9F A;  3MBP A;  5CMK A;  5A5X B;  1MH3 A;  4F39 A;  4JBZ A;  1LB8 A;  2ESN A;  5LOM A;  2V3T A;  3ONM A;  3IO4 A;  3O66 A;  3KOT A;  4K3F A;  5DT6 A;  3BFT A;  2I48 A;  2Y7W A;  2DVC A;  3LSW A;  1M5F A;  2DYX A;  3N5L A;  3EHT A;  4IGT A;  1SW5 A;  3FJ7 A;  1WDN A;  2OJT A;  4IO5 A;  2Q2C A;  3EPE A;  3FVK A;  1NNP A;  3PMW A;  3W9W A;  4JXI A;  3MVY A;  2AIX A;  4RPO A;  1P1U A;  3QK6 A;  4YKI A;  5H8F B;  5ITP A;  1XVY A;  2YJP A;  3OEK A;  1ZJL A;  4R73 A;  1NL5 A;  2PT1 A;  4IO7 A;  4H8J A;  1IXI A;  4YKJ A;  1M5B A;  3TEP A;  1ZLQ A;  3FV1 A;  4X1B A;  1HSJ A;  3MZB A;  2I49 A;  1DTG A;  4M4G A;  1B3F A;  2Z8D A;  4BDM A;  3KJ7 A;  4YAH X;  5JTY B;  1B4Z A;  2XX8 A;  1YAE A;  5HM4 B;  1MRP A;  5I59 B;  1PC3 A;  4I1D A;  2RC9 A;  3PUX E;  2REG A;  4EQ7 A;  4R75 A;  3L6H A;  3C33 A;  3HO7 A;  2DE2 A;  2AL5 A;  5FTI A;  3G3I A;  5B70 A;  4R2B A;  1YPN A;  4BDL A;  2FYI A;  1QUI A;  3OD7 A;  1AIV A;  4F18 A;  1TWY A;  2I3V A;  3CI8 A;  1NH7 A;  4RPN A;  2HAU A;  1JVY A;  3TCG A;  4F31 B;  4GF8 A;  1WVJ A;  2NOO A;  4QRZ A;  2UVJ A;  1MS7 A;  4EF1 A;  2OBG A;  3OSR A;  3C35 A;  2ALU A;  3IB2 A;  3CSG A;  2UYE A;  1FQE A;  4PET A;  4YKK A;  2XXU A;  2O51 A;  2V3Q A;  4YZZ A;  5CBS A;  4PFU A;  2CMO A;  1N3X A;  4XKR A;  1ZBM A;  2P0S A;  3RLF E;  1URS A;  3K02 A;  3KFM A;  4ONY A;  2AL4 A;  4OZ9 A;  4Q5T A;  1DOT A;  1SI1 A;  3OO7 A;  3E13 X;  2Y7K A;  4BDQ A;  4NF8 A;  1B05 A;  3RQT A;  4ZZE A;  4H5F A;  3K6U A;  4OFL A;  3UK4 A;  3M3L A;  4OXV A;  5FHN A;  2QMW A;  1H45 A;  1QVS A;  4OET A;  1FQF A;  1M5D A;  2I4B A;  3B6W A;  3I3V A;  4H5G A;  4U4S A;  4IO2 A;  4LQ2 A;  1ATG A;  3KSX A;  1MY1 A;  2O69 A;  4ELP A;  3ODB A;  3GBB A;  3RY3 A;  1A8F A;  2XXX A;  2Z8E A;  2CZL A;  4KR5 A;  3B7D A;  2DP8 A;  2ONK E;  1N0T A;  3OSQ A;  4EXK A;  2OWT A;  1LCT A;  5H8Q B;  3T93 B;  1O63 A;  1MDP 1;  2X7Q A;  4JWX A;  1DTZ A;  1TT1 A;  1F9B A;  3T9U A;  3S9N C;  1IIT A;  4H0W A;  2B3F A;  4KI0 E;  1H44 A;  1UTH B;  1B9J A;  3KJT A;  3V83 A;  4E0X A;  3C31 A;  4DXB A;  3TDJ A;  3LBS A;  4L17 A;  5AA2 B;  4ZEK A;  1B58 A;  2DQV A;  2X7P A;  1QW0 A;  3ZKK A;  4NE4 A;  4PFY A;  3VDF A;  2O68 A;  4H6D A;  3TZA A;  4IY6 A;  1PDA A;  1VE4 A;  3SEY A;  2XXI A;  2NWJ A;  1GGG A;  1OQG A;  1Y3Q A;  1MM7 A;  2BJJ X;  3PGF A;  4EF2 A;  4F29 A;  4LAT A;  4DXU A;  3RT8 A;  3O6I A;  4NF4 A;  5FTH A;  1FTJ A;  2F5X A;  1EZO A;  4NF5 A;  3SKP A;  1D9V A;  4MF3 A;  4XTC Q;  1MQJ A;  1OVB A;  4OMB A;  1ZMG A;  4NTL A;  1NNF A;  3RTF B;  2ANJ A;  3SEV A;  2DWI A;  3IOU A;  3C4M A;  3PMX A;  3T9H B;  3DP6 A;  3MP1 A;  1M5E A;  3GXA A;  1DMB A;  1D3K A;  4MH5 A;  1B7Z A;  3VV5 A;  4YB7 A;  2NVU B;  4Q30 B;  2FA7 A;  2F7B A;  3FJM A;  4H65 A;  2A5T B;  1D9Y A;  4QFO A;  3D4G A;  4THI A;  3U94 A;  1LLS A;  3SES A;  4QFL A;  1I6A A;  4KCC A;  2I3W A;  2Z23 A;  3VE1 B;  4FAT A;  1QKB A;  4ZZA A;  3VVF A;  1L5T A;  4Z7E A;  3IK6 B;  2YPN A;  3A3U A;  3MP8 A;  1POT A;  3P7I A;  4WXJ A;  5F1Q A;  4X9T A;  5I58 B;  5K2Y A;  3G3F A;  1N7X A;  1LFH A;  2DWA A;  3VXC A;  1B3E A;  2Y7P A;  3MZ1 A;  1B40 A;  4LON B;  1Y20 A;  2QSX A;  1GVC A;  3KBR A;  2V3U A;  3FVN A;  3VXB A;  4RY1 A;  2GFE A;  3CSB A;  5HBC A;  2R9J A;  3ZS6 A;  4N13 A;  3QIM A;  3IX1 A;  4XKQ A;  3O28 A;  5BUU A;  4NF6 A;  1IZ1 A;  3RTW B;  2HXW A;  1FQD A;  4UAC A;  4BLA A;  4IB2 A;  4G77 A;  1B6H A;  1JW4 A;  2M8C A;  4BDN A;  4JWO A;  3T9V A;  5CM6 A;  5TU0 A;  2F97 A;  2XXT A;  1XOC A;  1IUD A;  5JEI A;  4G4P A;  1LFG A;  5DEX B;  5IKB A;  2IEE A;  3KN3 A;  4GWO A;  4N07 A;  4OFO A;  4HTG A;  4EQ9 A;  2GHA A;  2QS3 A;  3RT6 B;  4Q8R A;  1Y1M A;  3IJO B;  5DVJ A;  1MQH A;  5M2V A;  3S4U A;  1LAH E;  4AQ4 A;  1P1Q A;  3U1O A;  1VFE A;  1FTK A;  4ZE8 A;  4G2Z A;  3SEW A;  4R74 A;  3GBA A;  4DE8 A;  1NNT A;  3DP8 A;  5AA4 B;  3TCF A;  2XXV A;  2ZYN A;  3G3J A;  3IOW A;  2H9B A;  3N6T A;  2V25 A;  2PYY A;  3MPK A;  4TOZ A;  4U22 A;  4ZE9 A;  2O7U A;  1MXU A;  3PPO A;  3KN8 A;  4FE8 A;  3MVX A;  1N76 A;  5DTB A;  4C1T A;  2UVH A;  1MQD A;  1B1H A;  3OO6 A;  2UVG A;  5CI5 A;  3O6H A;  3O6G A;  1LBB A;  3KEI A;  1A8E A;  4R6K A;  3QUF A;  4AB5 A;  1FTL A;  3OOA A;  4TQU Q;  4KYE A;  2O7I A;  1POY 1;  5I2K A;  1Y3N A;  4U21 A;  1B5I A;  1O64 A;  4NWD A;  4U2R A;  4LP2 B;  5FHM A;  4P0I A;  1MPC A;  2Z22 A;  1WOD A;  3EHU A;  1BTJ A;  1PB8 A;  4XIG Q;  4PP0 A;  4GRK A;  3IR1 A;  2HEU A;  4GOT A;  2F34 A;  2DSF A;  5KZT A;  5I57 A;  3B6Q A;  4GQO A;  2ONS A;  3IAZ A;  3CIJ A;  4GIZ A;  2PVU A;  1Q1K A;  5A5X A;  2AYS A;  3D4C A;  3FVO A;  4JSD A;  3C32 A;  4XXU A;  4TLM B;  1ANF A;  1MY0 A;  3R6U A;  1OVT A;  3UP9 A;  2XD2 A;  2I4C A;  4EXL A;  1JEV A;  4YIC A;  3FVG A;  2RIN A;  4C1U A;  4DZ1 A;  1A40 A;  4IGR A;  4JDF A;  3PPP A;  2RCA A;  5I56 B;  2XXY A;  3BBR A;  4MFI A;  1QUK A;  3V89 B;  2QS4 A;  3K1N A;  4QSC A;  2G29 A;  3K4U A;  5I84 A;  1DPE A;  5H8F A;  3TTM A;  3UN6 A;  4O3C A;  1SBP A;  3PPQ A;  3IB1 A;  1SW2 A;  1PEB A;  1LAX A;  4F3B A;  1NH8 A;  2DS9 A;  1XHY A;  1Q35 A;  1AH5 A;  3VFJ A;  4GVO A;  3TEL A;  2VD2 A;  5AA3 A;  2FNC A;  2DXR A;  3PMV A;  4GLI A;  4DIG A;  4ZEF A;  4ELO A;  4X1D A;  4YB5 A;  4G8M A;  5KDT B;  4NWC A;  5JTY A;  2ZYK A;  3WAF A;  3G3K A;  5I59 A;  1Z7N E;  3CFL A;  3S9L C;  3FD3 A;  4P11 A;  4LZ7 A;  4BDO A;  3T9X B;  4LUB A;  2Z8F A;  4EQB A;  4FOR A;  1CE2 A;  2H25 A;  4EDP A;  4MLV A;  1B4H A;  2X26 A;  5CMM A;  3VLV A;  4E0W A;  1FQC A;  3A09 A;  1YCJ A;  5DVF A;  2HZK A;  1EH3 A;  3S9M C;  4FEB A;  4FAJ A;  1LBC A;  3LC8 A;  3QYT A;  3KGC A;  4NMY A;  3T66 A;  1N04 A;  3DLN A;  3HST A;  5KCJ B;  3EN3 A;  2QPQ A;  2HFB A;  2IA4 A;  3PPR A;  2V93 A;  4OWD A;  3H3G A;  3MP6 A;  1FTO A;  3H7M A;  2ZYM A;  4H8I A;  3G3G A;  4GD5 A;  5AA1 A;  2RCB A;  1J1N A;  3M3F A;  2O1L A;  1O7T A;  3M3K A;  5CMB A;  4G68 B;  3E9X A;  1Y9U A;  3LSF B;  2D21 A;  3K1M A;  3VVD A;  5H8N B;  1MXZ A;  2H4I A;  4EUO A;  3U92 A;  4RNS A;  5B7D A;  2A5S A;  2QS2 A;  3LR1 A;  4FEC A;  1FTM A;  1URD A;  2P2A A;  3L6G A;  3PUV E;  3N6U A;  5ELV A;  2RKM A;  3U93 A;  3IOV A;  5CRY A;  4LZ5 A;  2Q88 A;  1QKA A;  3W9V A;  3BFU A;  1B1X A;  5TP9 B;  1IEJ A;  3LUY A;  5L8D A;  3TOD A;  3FXQ A;  2DE3 A;  3TUS A;  1P1N A;  1USY H;  3FUZ A;  2RC7 A;  4ZDM A;  1QUJ A;  4NED A;  3TCH A;  1XVX A;  5H8Q A;  1B3G A;  3PUY E;  3ILU B;  1MY2 A;  2ZMB A;  5TPA B;  3B6T A;  5H8H B;  3RPW A;  1RYX A;  3FXU A;  3JV9 A;  3IOR A;  3VVE A;  4IY5 A;  1UTH A;  4HW8 A;  1II5 A;  4F2O A;  3Q28 A;  1NNK A;  1LB9 A;  1EZP A;  3VLW A;  3PUZ E;  5I2N B;  3DP4 A;  4F22 A;  2D5W A;  2PX1 A;  1QJM A;  3TQL A;  2VD3 A;  1MY3 A;  3H6W A;  3H6V A;  3U72 A;  3T96 B;  4GL8 A;  5AA2 A;  1UIV A;  2Q2A A;  3FJG A;  5ICT A;  2ZNS A;  3LSL A;  2PT2 A;  1MQI A;  4U4X A;  4OEU A;  1MXW A;  1UTB B;  2VHA A;  3IOT A;  3MAM A;  1N3W A;  3EF7 A;  1A55 A;  4OHN A;  4OFJ A;  4ZS9 A;  3KOS A;  2XX7 A;  1NMU A;  3UGW A;  2HCA A;  2PMS A;  4ESX A;  1FQB A;  3MQ9 A;  3MVZ A;  1MPB A;  4ESW A;  3R7X A;  3RN8 A;  2O1M A;  1US5 A;  5JK4 A;  4N6P A;  3MWB A;  4F1V A;  4YMB A;  4PQJ A;  3PU5 A;  4KQP A;  3K6V A;  3QAX A;  4OES A;  2OWS A;  2WKY A;  4FIM A;  2O84 X;  2DE4 A;  3Q25 A;  4U23 A;  3SEX A;  3IB0 A;  2A5T A;  5F7V A;  3OEN A;  2F6P A;  1LCF A;  1MQG A;  1LST A;  2UXA A;  3V5A A;  2QS1 A;  2E0S A;  2RC8 A;  1EZ9 A;  4KD5 A;  1M5C A;  5K2X A;  1IQ7 A;  3CFZ A;  4POX A;  2F6G A;  2LAO A;  1XT8 A;  2UVI A;  4DDD A;  4PFT A;  4R72 A;  1Y4T A;  1JW1 A;  3ILT B;  5I58 A;  3O2A A;  3ECR A;  4F1Y A;  2HQ0 A;  4RJZ A;  4ELR A;  4WED A;  4YU0 A;  5H8S A;  1XS5 A;  4R9G A;  3K2D A;  3O9P A;  3N26 A;  3EQ1 A;  3ZSF A;  3FGS A;  1US4 A;  1MG1 A;  4IO4 A;  1MPD A;  1I69 A;  4LVQ A;  4OYV A;  2DOJ A;  3KG2 A;  1Y3P A;  1B2H A;  1JET A;  4XKN A;  1MXV A;  4HCW A;  1IIW A;  3QXM A;  4OTE A;  1N84 A;  2OLB A;  3LSX A;  3U8Q A;  4H1X A;  3PPN A;  3JYR A;  3K1P A;  2I0C A;  5J1D A;  3O97 A;  3SER A;  3THI A;  2H99 A;  1PBQ A;  4R2F A;  3SDF A;  2ZXT A;  4Q0C A;  4G68 C;  5DEX A;  3PUW E;  4R6Y A;  2ZNU A;  4KPT A;  3K6W A;  1PB7 A;  2E1S A;  3QUJ A;  4OEV A;  4ZEB A;  1AL3 A;  4OER A;  1OQH A;  1H43 A;  2H98 A;  4DCY A;  2Q8J A;  2NUV A;  3AXF A;  4I8C A;  1JQF A;  3OO9 A;  1SVX B;  2G93 A;  3OMB A;  1MXY A;  4ND9 A;  3MUQ A;  5AA4 A;  3TTR A;  3GLB A;  4ZEC A;  2O6A A;  2OZZ A;  2OCU A;  3E4R A;  2KLF A;  1VR5 A;  3FXR A;  2F78 A;  4R6H A;  3TTL A;  3SET A;  3RNN A;  3FAT A;  1SDX A;  1AMF A;  1ZTY A;  4KYS A;  3K0V A;  4AB6 A;  2V84 A;  1QUL A;  1UQW A;  4RK2 A;  1P1W A;  2F8D A;  3TQW A;  4I9D A;  4YKP A;  4ELQ A;  3IL1 B;  1SYH A;  3ZKL A;  5L9O A;  4M1V A;  4KYD A;  2QL3 A;  1USY E;  4NF8 B;  4F3G A;  4RYA A;  4LA9 A;  1JNF A;  3VLU A;  2GRV A;  3FAS A;  2UYF A;  4ZEI A;  4G8N A;  3MC2 A;  1IXG A;  3CVG A;  4UA8 A;  4WEP A;  5DVI A;  1MY4 A;  3JZJ A;  3CG1 A;  3K01 A;  1HSE A;  1LGB C;  1Y1Z A;  1XC1 A;  4OEN A;  3CR9 A;  3OXN A;  2NXO A;  3SEU A;  1B5J A;  4LQ5 A;  3HPI A;  5L9M A;  1R6Z A;  1B7H A;  5DYH A;  1SD3 A;  2DXY A;  2XXQ A;  5L9S A;  2DWJ A;  4QF9 A;  3HCQ A;  5ITO A;  4OQO A;  4OVJ A;  3O29 A;  4PFW A;  4DCX A;  1ZU0 A;  3KSJ A;  1MH4 A;  1P99 A;  3UOR A;  3S2V A;  1ZKB A;  4IO6 A;  4X48 A;  1SQY A;  4GXS B;  1TXF A;  4QFK A;  1GTK A;  5I56 A;  4YB6 A;  1YTV A;  4QHQ A;  4C0R A;  2GHB A;  1A7L A;  2R71 A;  4F3P A;  3FIR A;  1OLA A;  1H3D A;  1RKM A;  3HV1 A;  5CC2 A;  3V8X B;  3UA8 A;  4RA1 A;  4NF4 B;  4FJP A;  4NF5 B;  1R9L A;  3K6X A;  3TKD A;  3OO8 A;  1MXX A;  3Q29 A;  3Q26 A;  2QRY A;  1PB9 A;  2Q9T A;  1B0H A;  2F36 A;  5KDT A;  3M8U A;  4JB7 A;  3G7W A;  1ZIU A;  1LFI A;  4IO3 A;  5AA2 D;  1D4N A;  1S50 A;  5BWJ A;  3HHG A;  4MBP A;  3C9H A;  3C36 A;  5HPQ A;  3PD8 A;  3MPL A;  3FZV A;  3RUM A;  1Y4C A;  2F7C A;  4QFN A;  1LAF E;  1CB6 A;  4JWY A;  4GXA A;  2OK2 A;  3IJX B;  1B46 A;  3BKI B;  3T22 A;  1T0K A;  3R26 A;  4QFP A;  3TFL A;  3H06 B;  3IO6 A;  3H6T A;  4F19 A;  1MDQ A;  4F1U A;  2XXH A;  2W7Y A;  4O3A A;  4RK9 A;  1BKA A;  2YLN A;  1GR2 A;  1IXC A;  3RGY A;  4KHZ E;  2XXR A;  1Z7M E;  4PE5 B;  1TFD A;  1DPP A;  1VFD A;  1P1O A;  5CBR A;  3UIF A;  1LAG E;  1R1N A;  5ISU A;  2B3B A;  2ONR A;  2ZNT A;  4U1O A;  4QSD A;  4WKM A;  4P0G A;  2VP1 A;  2ZYO A;  4JSO A;  4ECF A;  2GH9 A;  3Q27 A;  1SYI A;  5KCJ A;  1JVX A;  4KFQ A;  3EHS A;  1ELJ A;  3GZG A;  3MJN A;  1NFT A;  5FHO A;  3G3H A;  1B5H A;  1SW1 A;  2Y7I A;  1FQA A;  3QSL A;  4F2Q A;  3MVW A;  3TTK A;  1SI0 A;  4HS7 A;  1S9T A;  1A54 A;  4ISU A;  3OEM A;  1JW5 A;  3MZ9 A;  2D3I A;  2XXW A;  4U1Z A;  1IXH A;  4NF6 B;  3F11 A;  4G68 A;  3TYH A;  1JEU A;  4GFR A;  3I6V A;  4GL0 A;  4KCD A;  3HHF A;  1OLC A;  5H8N A;  4I62 A;  3FV2 A;  2Q89 A;  3A3C A;  2REJ A;  1RYO A;  3I5O A;  4DXC A;  1H76 A;  3PD9 A;  4XKP A;  2F35 A;  1OMP A;  3KN7 A;  2XXP A;  5EYF A;  5EHM A;  1HSL A;  1GV8 A;  3KZG A;  1DSN A;  2XD3 A;  1PBP A;  5TP9 A;  1FW0 A;  3CG3 A;  4Z0I A;  2I6E A;  3WAE A;  3TAJ A;  4MLQ A;  1AOV A;  3TPA A;  1KWH A;  3K00 A;  3CRB A;  1I6B A;  1TFA A;  2VOZ A;  3C34 A;  1B3L A;  1UIU A;  3OEL A;  5TPA A;  3TMG A;  2QMX A;  1NKX A;  3TTN A;  5H8H A;  2DWH A;  5CMC A;  4ZED A;  1BLF A;  1B3H A;  2DVZ A;  1N7W A;  3H4Z A;  2B65 A;  1BP5 A;  4BDR A;  3DM0 A;  2PBW A;  5I2N A;  2Y84 A;  1SW4 A;  2QJE A;  4HCY A;  2H5Y A;  3N94 A;  1VSO A;  2I0B A;  3USD A;  2VGQ A;  4O3B A;  2ABH A;  3H6U A;  1FCK A;  3HN0 A;  1B32 A;  2RF1 A;  2F7A A;  3S9E A;  4POW A;  1OIB A;  1UTB A;  4F3S A;  4DLD A;  2I58 A;  4YMA A;  1URG A;  3PV0 E;  3E3K A;  1EU8 A;  1BIY A;  1B52 A;  3DEL B;  5I2K B;  1S7Y A;  5ICQ A;  2HZL A;  3W15 C;  2THI A;  1MM6 A;  4TLL B;  5EHS A;  2R6G E;  4H67 A;  3H03 A;  2XHD A;  5IAI A;  1A99 A;  2P1S A;  3CFX A;  4RXL A;  1B7U A;  1R9Q A;  1B51 A;  2XX9 A;  3MW0 A;  5I57 B;  5AE4 A;  1I6Q A;  4FED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...