4MLVA

Crystal structure of bacillus megaterium porphobilinogen deaminase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
290
Chain Sequence
SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKLLIDRVKEELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the partially oxidized dipyrromethene and dipyrromethanone forms of the cofactor of porphobilinogen deaminase: structures of the Bacillus megaterium enzyme at near-atomic resolution.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
total genus 102
structure length 290
sequence length 311
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 4mlvA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA02
3T9HB 3L6GA 4GQOA 4F19A 3S9LC 1MH4A 4JXIA 2Q2AA 1MY3A 1I69A 2RF1A 3O28A 3SEVA 2XXRA 3RQTA 2YPNA 3VVEA 3EPEA 3IOTA 4R6HA 3EHTA 2GHAA 4F1YA 1R6ZA 2HFBA 1H43A 4HW8A 1B52A 4ELRA 4ZZAA 4PP0A 4KCDA 3UK4A 5I2NA 2A5TB 1MPBA 2UYFA 3FVNA 3H03A 1JETA 3AXFA 4Q0CA 3IAZA 4R9GA 3TODA 2H5YA 3S9NC 3QAXA 1ZJLA 3S9MC 2F78A 1MDP1 3HO7A 4F3BA 2O68A 3TELA 2I4CA 3TYHA 4I1DA 1PDAA 1B5IA 1XC1A 2RC9A 2ABHA 3OEMA 4EUOA 1DPEA 5HBCA 1N3XA 2X7PA 1UTBB 5ITOA 4NWCA 5I2NB 2B3FA 3TUSA 4NF4B 1SYHA 3BFTA 3CRBA 3A09A 3Q26A 2I3VA 4X1DA 2H98A 5KDTA 1US4A 4G68B 1FQCA 2PYYA 2M8CA 3VFJA 3W9VA 5H8SA 2YLNA 4ZEBA 3S2VA 5JK4A 1IXCA 3KZGA 4R2BA 4RXLA 2D21A 1FTKA 3G7WA 4ONYA 5I59A 1B7HA 3H3GA 4EQBA 1MG1A 2DWIA 1JQFA 1Q35A 3LSLA 4LQ2A 4E0XA 1Y3QA 1IQ7A 2DWHA 1L5TA 1GV8A 1FCKA 3C36A 4EQ9A 2VOZA 3CR9A 3OMBA 3IJOB 1JVXA 1QUKA 4NF5B 3I6VA 4YKIA 1RYOA 1LGBC 4R9FA 4BDMA 2DVZA 3O66A 4TOZA 2B3BA 3O6IA 1N04A 2QSXA 3EN3A 2OJTA 2R71A 1MS7A 2PX1A 3OO6A 4PFUA 3RT8A 3VLVA 3TPAA 1FTJA 1II5A 1PC3A 4LONB 1B5HA 1LB8A 4GRKA 1NNTA 1OQHA 2RKMA 4YKPA 1Y4CA 4KQPA 4ZE8A 2FA7A 2V3QA 5EYFA 3MPLA 4G68C 4POWA 1TXFA 1OQGA 1QW0A 2F6GA 2XX8A 5K2YA 2I0BA 3K4UA 4OFLA 4PQJA 3C31A 5TU0A 4I62A 3UN6A 1A40A 1P1NA 5DEXB 3KOSA 2HAVA 1QUJA 3F11A 4M4GA 4OERA 3KGCA 1S50A 1VE4A 4YKJA 4JB7A 5BUUA 2PBWA 2Z8DA 3FGSA 3FIRA 4OVJA 3H6TA 4YMAA 1FTOA 1JVYA 1B5JA 3ILUB 4GFRA 2P2AA 4QFNA 3MAMA 4U4SA 3CFLA 3PPPA 3RY3A 2RCAA 2XXXA 3UGWA 3WAFA 4KFQA 3V8XB 1JW1A 4NF4A 4YMBA 5CM6A 2F97A 1MPCA 1SD3A 1UQWA 4HS7A 5I57A 4YAHX 1FQAA 1B2HA 2ZXTA 4ZEKA 3SERA 3FJMA 4G8HA 4ESWA 2XD2A 3V83A 4U23A 4F2QA 1YAEA 1UIVA 4POXA 1LAHE 3K02A 4OMBA 4ZEIA 4ZE9A 3PUVE 1RYXA 3SESA 3R6UA 4U4XA 4JWYA 1B4HA 2QRYA 1LBBA 3IB0A 2XXPA 1FTMA 2NXOA 3N6TA 4MLVA 4R73A 4RY1A 3G3KA 4WEDA 3LC8A 4OENA 1FQDA 3VDFA 4C1TA 1B1XA 2YJPA 4Z0IA 3TTLA 2O69A 2RINA 3FVKA 3M3FA 3OEKA 2ZYMA 4GXAA 4ISUA 4KYSA 3DP4A 3H6WA 4QHQA 3TQWA 1AOVA 4GD5A 4NE4A 5CI5A 5KDTB 3KN7A 1MQHA 1R9QA 3QYTA 2PT2A 5F7VA 3ODBA 1B0HA 5EHMA 3K00A 1TFDA 3IOUA 5DVJA 4PFWA 3H06B 4P11A 3H4ZA 1EH3A 3Q27A 1P1QA 3GBBA 1EZPA 3HSTA 5I2KB 3TTRA 1FQBA 4H1XA 4YB7A 3TTKA 2O84X 4C1UA 3QXMA 4ESXA 1J1NA 2HXWA 2QS2A 3LBSA 3LSWA 4UACA 2PMSA 3SDFA 4NMYA 5DT6A 2F36A 2F8DA 1OVBA 3MP1A 4DDDA 1SVXB 1B3HA 1DOTA 4OZ9A 1LCTA 1JNFA 1QUIA 2DE2A 4WXJA 4FATA 5CMMA 3N6UA 4IO6A 4X48A 2Y7PA 4H8JA 4EF1A 2V93A 3M8UA 5DVIA 4XXUA 1VFEA 2HQ0A 3DP8A 4Q5TA 3MVYA 4RK9A 1DTZA 4DZ1A 2ESNA 3KSJA 1LAFE 1O63A 4G68A 1B3FA 1NKXA 2H99A 1ZU0A 3C9HA 2PT1A 3OSQA 4NEDA 4UA8A 3GXAA 5B7DA 3TCGA 2NVUB 1NH7A 3H7MA 3KG2A 4RA1A 2DYXA 3VE1B 2DVCA 3E9XA 5DTBA 3TEPA 4DIGA 4JWOA 5LOMA 3TQLA 4RJZA 2UYEA 2F7AA 4FAJA 2VD3A 2XXVA 3MUQA 4LZ7A 4U22A 2LAOA 2HCAA 2OK2A 4GL0A 3TCFA 1A7LA 3QUFA 2Z8EA 3I3VA 2F35A 3E3KA 2X7QA 1IITA 3SEYA 3U72A 3C32A 3LSXA 4ELPA 4H8IA 3OD7A 5FHMA 1BKAA 5KCJB 2DQVA 2XHDA 4KR5A 1Z7NE 3R26A 3IOWA 1O64A 4PETA 4F3SA 1OVTA 5K2XA 4OESA 1H3DA 3CI8A 3HPIA 1NNKA 5I2KA 4HCWA 4OYVA 3VLUA 4R75A 1A8FA 4G8MA 4EXKA 2I3WA 3LSFB 1SBPA 3KFMA 5DYHA 3MZ1A 2DWJA 4FIMA 3OELA 4NF8B 1H45A 5IKBA 3FUZA 2OWTA 3ZSFA 2IEEA 5JEIA 3C4MA 5TPAA 1MM7A 3O6GA 3EF7A 4IGTA 2Y7WA 1P1UA 4GVOA 1MQGA 1VR5A 3CG3A 1HSJA 3RNNA 3TKDA 4TLLB 4EQ7A 2V84A 4ECFA 4N13A 2THIA 5CMCA 3IX1A 4DE8A 4GF8A 1PB8A 5L9SA 3TDJA 4QRZA 3GLBA 1M5DA 1ZBMA 4G2ZA 2I0CA 4DXBA 4DXUA 4GLIA 2A5TA 2VHAA 3FATA 4JSDA 3SEWA 2AL4A 3HN0A 4THIA 1ZMGA 3L6HA 4OXVA 1B51A 4ZEDA 1I6AA 2QMXA 1O7TA 1OLAA 3A3UA 1GR2A 5FTHA 4I8CA 2F7BA 5CMBA 4AB5A 3OOAA 3IB1A 3OO7A 2KLFA 1IXGA 3K01A 3IO4A 5L9OA 2I58A 3T93B 2UVJA 5KZTA 1T0KA 3V89B 5CC2A 3FVGA 4F39A 1KWHA 5AA4A 1WODA 3IR1A 5H8FB 3PUWE 2DOJA 4I9DA 1N3WA 5A5XA 1B3LA 4QSCA 5M2VA 3M3KA 1MY1A 2PVUA 4LVQA 4QSDA 1DMBA 3KN3A 3VXBA 3IK6B 3MC2A 4YKKA 3RUMA 3U92A 3MZ9A 1Y1ZA 3K6WA 2GHBA 4JSOA 4R72A 1ZIUA 2Z22A 1SW5A 2Q89A 4RPOA 4YICA 1AH5A 1LB9A 1B1HA 1N76A 3FZVA 4OFJA 1H76A 1R9LA 1Y9UA 4KCCA 3W15C 4G4PA 2VD2A 3O6HA 3MJNA 4LATA 2DWAA 3U8QA 5H8NA 2R9JA 2XXIA 1DSNA 3TMGA 3TTMA 2Q9TA 4YU0A 3FXQA 2Q88A 3T66A 4G77A 3T9UA 3KSXA 4ELOA 4OQOA 4XKPA 4GOTA 2Q8JA 3PPOA 3OXNA 3PD9A 4RNSA 4KHZE 4OEVA 3CSBA 4R2FA 5AA2D 1HSEA 2I4BA 1BTJA 3FJGA 2Z8FA 1CE2A 2DXRA 1JW5A 3CIJA 3ILTB 1MRPA 3PV0E 4IY5A 4LA9A 3UA8A 5I58A 1RKMA 5I56B 3IL1B 4MF3A 1NNFA 1SI0A 1MXXA 1WDNA 3IJXB 2OCUA 1ZTYA 3G3GA 1MH3A 3FJ7A 1M5BA 3UORA 4PFYA 1YPNA 4H5FA 4QSEA 4RYAA 3OO8A 2E1SA 1B3GA 2OBGA 3DM0A 4ND9A 4AQ4A 5FTIA 5H8FA 1FQFA 1MQDA 4N6PA 4R6KA 1US5A 3SETA 1URDA 2XXHA 2NWJA 3VV5A 1B46A 4Q8RA 3MP8A 5AA4B 1EZOA 2HZLA 2Z23A 3HV1A 4H67A 4FECA 2DP8A 1SI1A 1ANFA 1LFGA 2Y7KA 2VP1A 1D3KA 1Y4TA 2ANJA 1PB7A 2ONKE 3H6UA 4TLMB 2ZNUA 2W7YA 5CBRA 4IGRA 2UXAA 5I57B 2REJA 5F1QA 4F18A 2QL3A 3U94A 2XD3A 4WEPA 4BDRA 4BLAA 1MXYA 4EF2A 4ZECA 1IEJA 4XIGQ 1IXIA 4BDNA 2GH9A 3MPKA 3R7XA 2ALUA 4MH5A 3VVFA 1GGGA 2REGA 3QSLA 4KYDA 3PD8A 4YZZA 1GTKA 3PPNA 5H8HB 3SEUA 2O7UA 3B6QA 4F3PA 2V3UA 3QK6A 1FW0A 1NNPA 3RTWB 3Q25A 3PMWA 1QKAA 1MY2A 4NF8A 3PPRA 1SDXA 3PUYE 1WVJA 2HEUA 2VGQA 3IB2A 1TT1A 3MVXA 1GVCA 3TFLA 3U93A 1M5EA 5ITPA 1BP5A 2UVHA 1B05A 1N7WA 4OFOA 4MLQA 3B6WA 1ZKBA 1MXZA 3JZJA 3OO9A 3BKIB 3FVOA 1Z7ME 1B9JA 2DXYA 1EU8A 1AL3A 4WKMA 2QS1A 3VVDA 4C0RA 4F22A 3E13X 4NF6A 3RPWA 1CB6A 4F1VA 5H8HA 1DPPA 3K6XA 2RC8A 1XOCA 3DLNA 3G3FA 4IY6A 4R6YA 1B32A 1VFDA 3RN8A 3W9WA 3N5LA 5L9MA 2OWSA 2XXTA 4YB5A 5AA3A 5AA2B 1AMFA 4HCYA 3D4GA 2D3IA 2H4IA 5HPQA 3VXCA 3M3LA 4LZ5A 1UTHB 3E4RA 1N7XA 3OSRA 2H25A 3LR1A 2UVGA 4JBZA 4X1BA 3CFZA 2O1MA 1IIWA 5DEXA 2CZLA 2O6AA 2QPQA 2I48A 2D5WA 1ELJA 1Q1KA 3CVGA 2F34A 2RCBA 4G8NA 5J1DA 4E0WA 3T22A 1PEBA 4X9TA 5ICTA 3GBAA 3K1NA 3T96B 3FASA 3SKPA 4DXCA 3ZS6A 1QKBA 1XHYA 2E0SA 1VSOA 4ZZEA 4AB6A 2OZZA 1SW2A 5CRYA 4F1UA 2CMOA 1QULA 1D4NA 2NUVA 2R6GE 5CBSA 3O29A 3B6TA 3BBRA 3P7IA 3TTNA 1PBPA 2HAUA 1UTHA 3K1MA 4ZDMA 4LP2B 1LLSA 4P0IA 3GZGA 1Y3NA 2GRVA 5I56A 5AA2A 5B70A 1YTVA 1SW4A 4R74A 1EZ9A 3THIA 3N94A 3FXUA 1A99A 1PBQA 4KPTA 2F5XA 1LFIA 1DTGA 2QS3A 5TP9A 1M5CA 3LUYA 3Q28A 3TCHA 4NF6B 4N07A 5DVFA 5AE4A 3FV2A 4XKNA 1Y1MA 1UIUA 3G3IA 2AIXA 3KOTA 3UP9A 1OIBA 2IA4A 3JYRA 4U21A 3HCQA 3U1OA 4U2RA 1I6BA 3B7DA 3K1PA 1QVSA 1LAGE 1UTBA 4NTLA 3S9EA 3KBRA 4JDFA 4L17A 2HZKA 5ISUA 2XXQA 2NOOA 5H8QA 3BFUA 1Y3PA 1JW4A 2A5SA 4XTCQ 3KN8A 1USYH 3N26A 1IXHA 4O3CA 5H8QB 2ZYKA 3G3HA 1MDQA 1SYIA 1P99A 1URGA 2V25A 4FJPA 1A54A 1LBCA 2P1SA 1S9TA 5JTYB 3VLWA 4F3GA 4DCXA 3FXRA 3FV1A 4PE5B 3UIFA 4HTGA 1B6HA 1P1WA 3D4CA 3QIMA 4OWDA 1MQIA 2I49A 3ECRA 2O1LA 3FD3A 4XKQA 2XXUA 5BWJA 1OLCA 3C35A 1A55A 4EDPA 2B65A 3K6VA 4GWOA 4FEBA 1B0LA 1FQEA 1H44A 1MM6A 2P0SA 2V3TA 2ZMBA 2DSFA 3A3CA 5L8DA 3O2AA 4P0GA 4TQUQ 4RK2A 1B7UA 4PFTA 1POY1 4OEUA 3S4UA 1Y20A 2ZYOA 1LCFA 1HSLA 5CMKA 4O3AA 3KEIA 3MVWA 4KYEA 1POTA 4Q30B 5JTYA 2DE4A 2QMWA 1B7ZA 2X26A 4Z7EA 2DS9A 2AL5A 1ATGA 3EHUA 3ONMA 1B58A 5AA1A 4NWDA 3HHFA 2QJEA 5FHNA 5A5XB 3CG1A 4KD5A 4BDLA 1XVYA 4ZS9A 3IORA 1A8EA 3T9VA 1LFHA 2UVIA 4H65A 4LQ5A 2WKYA 1D9YA 4ZEFA 3WAEA 3DP6A 3ZKKA 3PMVA 3ZKLA 1XS5A 1N84A 5IAIA 1N0TA 2G93A 3MW0A 1BIYA 1LSTA 4IO4A 4O3BA 3TZAA 5ELVA 4KI0E 2Y7IA 3PUXE 2Y7RA 3CFXA 3MZBA 1R1NA 5FHOA 5H8NB 2XX7A 4DCYA 1JEUA 2QS4A 1SQYA 4JWXA 4QF9A 3K2DA 3K6UA 4F29A 3HHGA 3RTFB 3PGFA 4IO2A 1USYE 2ZNTA 4IO5A 3EQ1A 3DELB 3PU5A 3OENA 3RT6B 1MPDA 5KCJA 5I59B 4DLDA 1XT8A 4F2OA 4EXLA 3MVZA 1I6QA 3K0VA 1F9BA 2F7CA 4FE8A 1BLFA 4QFKA 2G29A 1AIVA 2BJJX 2GFEA 2O7IA 2RC7A 2ZYNA 4GIZA 1B3EA 1M5FA 2DE3A 3MWBA 1SW1A 1MY4A 3SEXA 3O9PA 4M1VA 1S7YA 1TWYA 2AYSA 4IO7A 4K3FA 4XKRA 1OMPA 4MBPA 4QFLA 1URSA 5I58B 4BDQA 1D9VA 1IZ1A 5EHSA 4ELQA 1MXVA 1XVXA 3O97A 1NH8A 3Q29A 2ONRA 4FORA 3RGYA 3TAJA 3G3JA 3PUZE 1MXWA 3IO6A 4GXSB 3PMXA 2XXYA 1P1OA 4IO3A 2FYIA 4U1OA 5HM4B 2ZNSA 1TFAA 1YCJA 2OLBA 3H6VA 3RLFE 3C34A 2ONSA 2XXWA 3I5OA 3CSGA 4OTEA 4H6DA 5ICQA 1MY0A 4BDOA 5TP9B 4NF5A 4GL8A 1NL5A 2F6PA 3USDA 4QFPA 4OHNA 2Q2CA 2Y84A 4QFOA 4MFIA 2H9BA 3T9XB 1ZLQA 3JV9A 4FEDA 4RPNA 4U1ZA 1QJMA 5I84A 1IUDA 1NMUA 2FNCA 4H5GA 4H0WA 4YB6A 1B40A 4IB2A 3KJ7A 4LZ8A 4LUBA 3EHSA 3MP6A 2O51A 1MXUA 5TPAB 3MQ9A 4OETA 1LAXA 1JEVA 1B4ZA 3QUJA 3V5AA 3KJTA 1MQJA 1PB9A 3PPQA 4F31B 3MBPA 1NFTA 2XX9A 2I6EA 3C33A 1FTLA 3IOVA
chains in the Genus database with same CATH superfamily
3RYDA 4GQOA 3IWCA 2RF1A 3O28A 3SEVA 2XXRA 3RQTA 2YPNA 3VVEA 4PP0A 5I2NA 2A5TB 1JETA 2EPMX 2QVVA 1FBGA 5A6KA 3HPSA 3TELA 4LFAE 3KWRA 2EP3A 3OEMA 2RC9A 4N8GA 1FSAA 5HBCA 4LF5E 2B3FA 4B3TE 4NF4B 1SYHA 3Q26A 3HQ1A 1YZ9A 1US4A 4HXVA 1FQCA 3VFJA 3W9VA 2EMWA 2LVHA 4RXLA 1STUA 2D21A 4Q35B 4EQBA 3BF2A 1JQFA 2DWHA 1UBDC 1FCKA 3C36A 2VOZA 4NF5B 4F9AB 2G7HA 2QSXA 3EN3A 1N33E 4PFUA 2Q8MA 1II5A 4WSPA 3VHTB 1B5HA 3MHHC 2E5LE 1NNTA 1OQHA 2DRPA 2RKMA 5DNYA 4ZE8A 2V3QA 1QW0A 2XX8A 3RPLA 4OFLA 1A40A 4PGPA 1EYIA 1X47A 2YTDA 4M4GA 4DV0E 1S50A 1VE4A 5BUUA 2DSYA 2EM8A 1JVYA 2PFZA 1FKAE 2XXXA 5CM6A 4YMBA 2EN7A 5IGAA 1B2HA 2ZXTA 3QG5C 4ESWA 2XD2A 2JPAA 1IQOA 1UIVA 4OMBA 2YZTA 3PUVE 3SESA 1ZU1A 4U4XA 4R73A 1FTMA 4MLVA 3G3KA 4NQ8A 2O69A 5CFFE 3M3FA 5A6JA 4GXAA 5CI5A 1RDYA 4N8YA 2XWOA 3QYTA 2LT7A 4PAIA 4M9VC 3K00A 3H06B 1X48A 3Q27A 2L33A 5I2KB 3TTRA 4O7IA 4DV4E 1J1NA 2QS2A 3LSWA 4PC9A 4DR6E 1I94E 1UN6B 5DT6A 4X62E 4DDDA 3LLHA 4PDDA 4WXJA 2PFYA 2Y7PA 4GWXA 2HQ0A 4Q5TA 4RK9A 3MVYA 3KSJA 1O63A 5BR8E 1NKXA 2PT1A 3TCGA 1NH7A 1ZAAC 2DYXA 5A2QC 2DVCA 3E9XA 5LOMA 2VD3A 2XXVA 1QU6A 4U22A 4HE0A 4LFCE 2OK2A 2L2NA 3I3VA 3U72A 2EOHA 4ELPA 3OD7A 2ENCA 2E1MA 2B4MA 2EOIA 2WBBA 2XHDA 3MYUA 1FBCA 3IOWA 4PFRA 2VF1A 3HPIA 2B7VA 1NNKA 4OYVA 3VLUA 4R75A 2EPUA 3LSFB 1SBPA 3KFMA 3MZ1A 3C4TA 4I8OA 5IKBA 5JEIA 5EYGA 4R9GA 2L3CA 3EF7A 4QSEA 3RNNA 2VPNA 4ECFA 4BS9A 3IX1A 4DE8A 3TDJA 4MAGA 3KC0A 2DMIA 1JP4A 4DXBA 4GLIA 2VHAA 2MKZA 2L2MA 4THIA 1WHNA 4ZEDA 2QMXA 3A3UA 3OOAA 2KLFA 1IXGA 1XMOE 4GWUA 4R03A 2HPGA 5KZTA 2EM3A 1T0KA 3PUWE 1N3WA 1BBOA 1NV5A 4QSCA 4F6NA 2PVUA 4LVQA 1DMBA 3VXBA 3IK6B 3MZ9A 1Y1ZA 3K6WA 1ZIUA 2EOQA 2Q89A 1LB9A 3FZVA 3W15C 2MDGA 4PAKA 4P78A 4LATA 2CZHA 2R9JA 2DMYA 2XXIA 4YU0A 1UHZA 3T66A 3KSXA 4OQOA 4GOTA 3PD9A 4R2FA 2I4BA 3FJGA 4K0KE 3ILTB 2K7IA 3UA8A 2EMGA 4MF3A 1NNFA 1SI0A 1VDWA 1MXXA 2WCC3 3RPLB 2MKNA 4O8MA 1MH3A 3FJ7A 3UORA 5ET6A 2EMYA 3OO8A 1T39A 4ND9A 4OVSA 4I3YA 3VV5A 2XXHA 3B8BA 3MP8A 2HZLA 3HV1A 3J7AG 1ANFA 2Y7KA 1D3KA 2ONKE 3LV0A 2UXAA 2REJA 5F1QA 1LLMC 1INPA 3U65A 4O4KA 1YSAC 1B69A 2EN8A 1JK2A 4BDNA 2PCRA 3SEUA 2REGA 5H8HB 4KYDA 1K9ZA 3PD8A 1GTKA 4YZZA 2O7UA 3QK6A 1FW0A 3AV0A 1QKAA 4JYAE 2CZKA 1BP5A 2UVHA 1N7WA 2HGHA 4NF6A 4NHRA 3JZJA 4WKMA 1Z7ME 3AUZA 4I3EA 3C6MA 4GX6A 5H8HA 3K6XA 1BB8A 4IY6A 1A1IA 3RN8A 4WXDA 4HCYA 4I40A 3D4GA 4DI3D 3M3LA 3ADIA 1UTHB 2H25A 3LR1A 3CFZA 5DEXA 2YTGA 2QPQA 4G8NA 2RPCA 4GKJE 2MC5A 2B4LA 3GBAA 1X5WA 1VSOA 1SW2A 2CMOA 5CBSA 3O29A 3J81C 4KWYA 1Y3NA 1GQEA 5I56A 2FGGA 4R74A 1NUXA 4XEQA 2F5XA 1LFIA 2K4VA 1NUZA 4N07A 3KOTA 5A6AA 1OIBA 4N17A 2QFLA 4U21A 2L92A 3U1OA 4R2CA 4B3SE 1I6BA 4U2RA 1QVSA 1UTBA 4NTLA 2EOXA 2FBPA 4JI1E 2NOOA 2OWZA 3KN8A 3N26A 1T38A 5H8QB 2ZYKA 1URGA 1A54A 1S9TA 3VLWA 3D4CA 2O1LA 2XXUA 2XXKA 2B65A 1FBHA 3A3CA 3VYYA 2LRSA 1Y20A 3E78A 1LCFA 3MVWA 1P47A 4RH8A 3HHFA 2ELYA 3L00A 2WBDA 1LFHA 2UVIA 3JU0A 2WKYA 3DP6A 4IS1C 4LF7E 1XS5A 5DW8A 5IAIA 3MW0A 1LSTA 4O3BA 4R2PA 1TF3A 5FHOA 2XX7A 2WYPA 1KZ8A 1SQYA 2YU5A 1X49A 3K6UA 5IZ3A 3HHGA 3RT6B 5KCJA 5I59B 4R2QA 4DLDA 4F2OA 3MVZA 3K0VA 2EN1A 1YYZA 2F7CA 1BLFA 2ZYNA 2BJJX 2GFEA 2O7IA 1EYJA 1M5FA 1WRJA 2ZM6E 4XKRA 1OMPA 4QFLA 5I58B 1YUIA 3J7Yp 3RGYA 3G3JA 2KR0A 3PMXA 2XXYA 1P1OA 2ONSA 1NEIA 4H6DA 4BDOA 1YFHA 4NF5A 2EN6A 4OHNA 1HR0E 2Q2CA 3BGHA 1IBKE 2N8XA 1ZLQA 3JV9A 4FEDA 4RPNA 2YSPA 2HC5A 3MP6A 5TPAB 4OETA 1LAXA 1A1KA 2B3TB 3MBPA 3ADLA 2I6EA 3T9HB 1TF6A 3L6GA 2EQ1A 4WPYA 3EPEA 2GHAA 4F1YA 1R6ZA 4HW8A 4ELRA 4ZZAA 1DQ3A 4DR7E 1MPBA 2UYFA 3FVNA 3H03A 4Q0CA 3S9NC 3TODA 3IAZA 2F3BA 4HEIA 2H5YA 1ZJLA 3HO7A 5I7IA 1B5IA 2L2KB 4EUOA 5ITOA 3TUSA 3CRBA 5KDTA 2UUAE 2I3VA 2V88A 4MNPA 4G68B 1G0HA 2UUBE 5JK4A 3KZGA 1FTKA 3G7WA 4QBAA 1B7HA 3H3GA 2DWIA 4LTYA 1Q35A 4LQ2A 1L5TA 1GV8A 4EQ9A 3CR9A 1QUKA 3I6VA 4BDMA 1LGBC 2DVZA 3O66A 1N04A 3VLVA 3RT8A 4LF8E 3TPAA 1LB8A 4GRKA 2F4VE 1FPJA 4YKPA 4KQPA 2L3JA 4G68C 4POWA 4N91A 2I0BA 3ROJA 2YRKA 1A1FA 4PQJA 2JVAA 2HAVA 1G2DC 1AAYA 1SR9A 4NG7A 3KGCA 4YMAA 4BC7A 2QVRA 3ILUB 1XNQE 2P2AA 4U4SA 3CFLA 5FLXC 4KFQA 4WXCA 1FQAA 3FJMA 1YXIA 4U23A 1YAEA 5IM2A 3BIDA 2M4IA 4JWYA 2EOEA 1B4HA 1LBBA 5I2NB 5A6BA 4RY1A 3VDFA 4ISUA 1FTAA 3TQWA 3DP4A 2PT2A 3ODBA 5EHMA 1TFDA 3IOUA 2EPZA 3H4ZA 1P1QA 3GYYA 2N3HA 3HSTA 2LE2A 2L5VA 3LBSA 3SDFA 3ISPA 5IZZA 1BBGA 2F36A 3MP1A 4DMIA 1SVXB 4N6KA 4OZ9A 1QUIA 5CMMA 4RHBB 1G2FC 3N6UA 4H8JA 4EF1A 2FIXA 4R2SA 3DJWA 1IMFA 1LAFE 1PJTA 2LJHA 3C9HA 4GZNC 1ZU0A 3OSQA 5B7DA 4M30A 3H7MA 4GX4A 2NA2A 4DIGA 3TQLA 5LDZA 2JYAA 2LAOA 3TCFA 4PTKA 1IITA 4H8IA 1FPKA 1BKAA 3OTOE 1O64A 4PETA 4F3SA 1OVTA 4HCWA 4DR4E 4G8MA 2EOJA 1NV1A 5DYHA 5KL5A 3FUZA 2OWTA 4ZYEA 2IEEA 3IFCA 4B3ME 5TPAA 2Y7WA 4GVOA 1MQGA 2EPRA 4TLLB 2V84A 1O0WA 2THIA 4GWSA 4HE1A 4QRZA 4G2ZA 4MX6A 4DXUA 3HN0A 1DGCA 4OXVA 2EM2A 1OLAA 1HNZE 4DR5E 4I8CA 5CMBA 2EMCA 3NOHA 1N36E 4N15A 2PRTA 3MHSC 2UVJA 3V89B 2UU9E 5CC2A 3FVGA 2EM9A 5H8FB 2DOJA 4P1LA 3M3KA 1MY1A 3MSTA 1J26A 4P8BA 3U92A 4JSOA 2Z22A 1WJPA 4YICA 4OFJA 3O6HA 2DWAA 2Q9TA 4G77A 3F6HA 4RNSA 3OXNA 2FVZA 3CSBA 5AA2D 1HSEA 5I58A 3H09A 4IY5A 3PV0E 4MIJA 4OVRA 1L4SA 2EPXA 1WDNA 5TSEA 3IJXB 2OCUA 3J80C 1M5BA 4ZYGA 4PFYA 1YPNA 4RYAA 2ELZA 2OBGA 1FQFA 4YY3E 4N6PA 3SETA 4XF5A 5AA4B 3SZPA 4H67A 1LEVA 1SI1A 1LFGA 2VP1A 1Y4TA 3H6UA 2EWLA 5KL7A 2ZNUA 4MNIA 2EN2A 5CBRA 4IGRA 5EQ7A 4F18A 3LMLA 5KL6A 2QL3A 4WEPA 4JV5E 4BLAA 2JXPA 3VVFA 5IT9C 3QSLA 4F3PA 3PPNA 4WYQB 4JI2E 4DR1E 4NF8A 1SDXA 5A6BD 3LUZA 3MVXA 1GVCA 3U93A 3TFLA 1N34E 5ITPA 1B05A 2V8QB 1LBVA 3B6WA 1ZKBA 1MXZA 4JVIA 1B9JA 1EU8A 1AL3A 3VVDA 4F22A 1CB6A 4F1VA 1DPPA 2EPPA 1XOCA 1B32A 3T1YE 3UK3C 3TEPA 1AMFA 2HHHE 2LV2A 2H4IA 4FBPA 2EOOA 2CZIA 3VXCA 4PFBA 3A29A 1IIWA 2O6AA 2D5WA 1ELJA 1FBDA 2RCBA 4E0WA 4X66E 4BCAA 4BHCA 4M2ZA 4KHPE 3ZS6A 1QKBA 2E0SA 3EPLA 4AB6A 2LBSB 4F1UA 2JOBA 2CT1A 3FBPA 3BBRA 3P7IA 3K1MA 4ZDMA 4L5NC 4XFEA 5AA2A 3TQMA 1SW4A 3THIA 1QGXA 3N94A 1A99A 1KYQA 4DR2E 2NUEA 2QS3A 5TP9A 3LUYA 3Q28A 4JVDA 4J8ZA 4PBQA 5AE4A 2WZOA 2EN3A 1SPIA 1UIUA 2AIXA 3JYRA 2JWOA 5ET7A 3HTXA 3HCQA 2XA5A 3K1PA 2YRHA 5J16A 2BBGA 4JDFA 4L17A 2HZKA 2J7JA 2XXQA 1Y3PA 2EMFA 1MDQA 2V25A 2P1SA 4DCXA 3FV1A 4PE5B 3QIMA 1MQIA 2I49A 3ECRA 5BWJA 1OLCA 3C35A 4EDPA 3K6VA 4P9KA 1B0LA 1FQEA 1H44A 1MM6A 2V3TA 2DSFA 4P0GA 4TQUQ 3EPKA 1B7UA 2ZYOA 5CMKA 4Q30B 5JTYA 1POTA 2JOXA 4O24A 4Z7EA 4N81A 2AL5A 1ATGA 3EHUA 3ONMA 1B58A 5I5PA 2WEFA 5FHNA 3CG1A 1NI9A 3T9VA 1A8EA 1UILA 1D9YA 3ZKLA 2G93A 4IO4A 4JI6E 3ZOQB 1A1LA 3PUXE 1FBFA 5EQAA 2Y7RA 3CFXA 1R1NA 5H8NB 4IJDA 1JEUA 4F29A 2YTNA 4JWXA 2DLQA 2EMAA 3K2DA 3RTFB 3PGFA 2ZNTA 3DELB 4GBWA 1I6QA 5AE1A 4FE8A 1A1HA 2G29A 4I9DA 2EOZA 3SEXA 2I13A 1B3EA 1SW1A 1MY4A 2RSMA 1FRPA 5AE3A 1IZ1A 1ZBQA 4DV5E 2Q74A 4ELQA 1XVXA 4FORA 4ZYHA 3TAJA 4GXSB 1TFAA 2OLBA 3C34A 3USDA 3FXBA 2Y84A 2H9BA 4M0VA 4AS4A 5I84A 1IUDA 2EMBA 1T4LB 4IB2A 3EHSA 2O51A 3V5AA 2DGCA 1B4ZA 4F31B 3PPQA 1MQJA 2EPKX 1NFTA 2XX9A 3Q29A 3IOVA 4F19A 2A25A 3S9LC 2Q2AA 4NAPA 3HXLA 1H43A 3UK4A 2EMXA 4P47A 4NN3A 4R8OA 4QXDA 3AXFA 3F6GA 4GEQB 3QAXA 3S9MC 2F78A 2V86A 4I1DA 4R2RA 1XC1A 2ABHA 4P3LA 1DPEA 1EH6A 1N3XA 2EPCA 1UTBB 3BFTA 5AC4A 3A09A 5KL4A 2H98A 1X6FA 2PYYA 1A1JA 3S2VA 1IXCA 4R2BA 1Q9DA 4ONYA 1MG1A 4OVPA 5EQ8A 1Y3QA 1IQ7A 3OMBA 3IJOB 1JVXA 4YKIA 1RYOA 4R9FA 4TOZA 1EH7A 2OJTA 2R71A 1MS7A 2WBTA 4DUYE 1FTJA 1PC3A 4LONB 3BIHA 2Q8UA 1XI6A 2VQEE 2DIXA 1Y4CA 2FA7A 5EYFA 3MPLA 3HPZA 4MEVA 4O7MA 5DEXB 4PF8A 3F11A 4OERA 4PGNA 1X6HA 4O5GA 2M9AA 5A69A 4DV7E 2Z8DA 3H6TA 4GFRA 1B5JA 3RY3A 4QFNA 3UGWA 4NX1A 2WX9A 2EMZA 2EOMA 3WAFA 4GWZA 4NF4A 1MPCA 1NUYA 2FV4B 2ENAA 4WSGA 4ZEKA 2M1SA 4F2QA 4POXA 1EKZA 3K02A 4ZEIA 2EL5A 1XNRE 4ZE9A 3DF6A 1KJKA 4JI5E 2QRYA 4C1TA 1FQDA 1B1XA 3TTLA 4KYSA 2RINA 1IMUA 4QHQA 4PFIA 2V89A 4X64E 4GD5A 4NE4A 3KN7A 5LMUE 1B0HA 4PFWA 1NUWA 2YTIA 3GBBA 3EPHA 3PTYA 1FQBA 4H1XA 2O84X 4ESXA 2PMSA 1IMDA 1PJSA 4NMYA 2F8DA 2NUGA 1OVBA 1JNFA 1FPEA 4X48A 2JP9A 1NV7A 5FBPA 2V93A 1VFEA 3DP8A 4BHBA 4DZ1A 4G68A 2H99A 4NEDA 3GXAA 2YU8A 4RA1A 3VE1B 1IMAA 5DTBA 1FPLA 4JWOA 4RJZA 2UYEA 2F7AA 4DV6E 3MUQA 1EH8A 3D1RA 4GL0A 1A7LA 2Z8EA 4KXPA 2F35A 3E3KA 4P1EA 3SEYA 3LSXA 3IFAA 4GX3A 5FHMA 2DQVA 4OANA 1KA0A 1H3DA 3M99B 1FJGE 3C6KA 4EXKA 2DWJA 3OELA 1H45A 4B3RE 4IGTA 1VR5A 2VRDA 1HSJA 3TKDA 4LFBE 4N13A 5CMCA 1NV2A 2QVUA 4GF8A 1PB8A 4F6MA 1M5DA 2I0CA 2UXCE 2A5TA 2VPOA 3FATA 4JSDA 3SEWA 4X9JA 2AL4A 1ZMGA 2LTSA 1B51A 2EPLX 1O7TA 2LCEA 1GR2A 2XWVA 4P7DA 2F7BA 4AB5A 3IO4A 5L9OA 3T93B 1KWHA 3IR1A 2EZ6A 5A5XA 5M2VA 4WFTA 3JAMC 3KN3A 4YKKA 3MC2A 3RUMA 2GHBA 4RPOA 1AH5A 1N76A 4KCCA 4DKKA 3MJNA 5H8NA 1DSNA 3TMGA 1FBEA 3T9UA 2Q88A 4DI4B 4ELOA 2GPIA 2FIEA 3PPOA 4KHZE 4OEVA 1BTJA 1CE2A 2DXRA 2FHYA 1PKPA 1HNWE 2EOSA 1LBXA 4JI8E 1JK1A 2E1SA 3DM0A 4AQ4A 2BJIA 2RS6A 1YYWA 1URDA 2NWJA 3FIGA 1B46A 4FECA 2DP8A 3B50A 4TUIA 2ANJA 1PB7A 5I57B 1IQSA 4PCDA 2R8TA 4R2DA 3U94A 2XD3A 1MXYA 2F8BA 4ZECA 4XIGQ 1YYKA 2GH9A 3R7XA 4MH5A 1GGGA 5AASA 4GKKE 1NNPA 2YTQA 4OA4A 3Q25A 5EQ9A 3PUYE 2EM4A 5L9SA 2VGQA 1TT1A 1M5EA 4OFOA 3OO9A 3BKIB 2DXYA 1IMCA 4C0RA 3E13X 3RPWA 2IHR1 3G3FA 3W9WA 1VFDA 5AA3A 2OWSA 2XXTA 1IMEA 4YB5A 5AA2B 5HPQA 4LZ5A 1N7XA 4JBZA 2YWQA 2UVGA 2I48A 1Q1KA 5J1DA 1ZR9A 3T22A 2EMHA 3VK6A 4OOGC 5ICTA 3T96B 3K1NA 3FASA 3SKPA 1XHYA 4ZZEA 2V4CA 4DV3E 4X65E 4BC9A 1QULA 1NV0A 2NUVA 2R6GE 1N32E 3BIGA 3B6TA 1J5EE 4LP2B 2CSHA 2GRVA 5B70A 1YTVA 1NV3A 3VYXA 3FXUA 4KPTA 1PBQA 1DTGA 2JJKA 1FPDA 2EQ3A 4NF6B 2EM0A 4O43A 3FV2A 4XKNA 4GBVA 4JI0E 1Y1MA 3G3IA 3UP9A 2IA4A 3B7DA 2BB8A 1LAGE 2ZZXA 2LO3A 4F9BB 5ISUA 2YRMA 5AC5A 1JW4A 1USYH 4O3CA 1IXHA 2EMKA 2R1FA 4P56A 1P99A 5JTYB 1LBCA 2UUCE 3FXRA 4PAFA 3UIFA 1SFEA 4JI7E 4XKQA 2DDKA 4FEBA 3MSWA 5IXMB 3O2AA 2YTOA 1POY1 4O3AA 3KEIA 4KYEA 4UABA 5I3SA 2DE4A 2QMWA 4F54A 1B7ZA 2DS9A 2KHXA 5AA1A 4NWDA 4MNCA 4YHHE 2LUPB 4BDLA 4KD5A 5A5XB 4BBYA 1XVYA 4ZS9A 2RS7A 3IORA 2HHMA 4NF0A 4ZEFA 3PMVA 2WYKA 4NHBA 1N0TA 3C4BA 1IBLE 1BIYA 3TZAA 5ELVA 4N4RB 2Y7IA 2V85A 5LLQA 2QS4A 4QF9A 4IO2A 2EPAA 1USYE 4IO5A 3EQ1A 4LU9A 3OENA 2MC6A 1NCSA 4EXLA 1K9YA 1FBPA 1F9BA 4QFKA 2RC7A 2UXBE 2EPOA 4LF9E 4X8WA 2YTEA 1S7YA 1TWYA 1KA1A 3KBZA 2V87A 2LMZA 1URSA 5KL2A 5KL3A 1MXVA 3O97A 1NH8A 2ONRA 1T4OA 1MXWA 3IO6A 4IO3A 2FYIA 4U1OA 2ZNSA 3H6VA 2DLKA 1YCJA 1RC7A 2B7TA 3RLFE 2XXWA 4AS5A 4OTEA 2F6PA 3T9XB 4MHFA 4U1ZA 1QJMA 1NMUA 4YB6A 4H0WA 1B40A 2EM6A 1DK4A 4LUBA 1IMBA 5H8FA 1JEVA 3QUJA 3KJTA 3C33A 1FTLA 1X3CA 1MH4A 4JXIA 3HFUA 3T1BA 2HJJA 1MY3A 1I69A 5ET5A 3IOTA 4R6HA 3EHTA 5ESYA 1CNQA 2I9IA 2HFBA 1B52A 4KCDA 2EL4A 4F3BA 1MDP1 2O68A 2I4CA 3TYHA 1PDAA 5LTCA 2X7PA 4NWCA 4X1DA 1LBZA 3T0JA 1RQ0A 2M8CA 4NZVA 5H8SA 2YLNA 4ZEBA 4LF6E 2CTDA 2RQLA 3LSLA 4E0XA 4R2EA 2FTXB 4N6DA 2CEXA 5I59A 2OX3A 1PJQA 4LF4E 2B3BA 3O6IA 3OO6A 4PBHA 2EM5A 2UXDE 2PX1A 4X8RA 1TXFA 1OQGA 2F6GA 5K2YA 3K4UA 5TU0A 3UN6A 3C31A 4I62A 1P1NA 3KOSA 1QUJA 2EM7A 4Q28A 3IWDA 4JB7A 4YKJA 2PBWA 3FGSA 3FIRA 4OVJA 1FTOA 2CEYA 4FATA 3MAMA 1FJ6A 3PPPA 2RCAA 3V8XB 2GHFA 2DB2A 1JW1A 4PE3A 2F97A 1SD3A 1UQWA 3CHGA 3K6QA 4HS7A 5I57A 3KZYA 4YAHX 3SERA 4G8HA 3V83A 2ZZWA 2XWKA 1LAHE 1RYXA 4L8NA 1FPFA 3R6UA 3N6TA 3IB0A 2XXPA 2NXOA 4WEDA 3LC8A 4OENA 2YJPA 4Z0IA 2F3DA 2EQ0A 4NXME 3FVKA 2ZYMA 3OEKA 4JVCA 3H6WA 1AOVA 5KDTB 3ADJA 1MQHA 1R9QA 5F7VA 5DVJA 4P11A 1EH3A 1EZPA 2LUQA 3TTKA 4YB7A 4C1UA 1QNTA 3QXMA 2HXWA 2B9DA 1RDZA 4UACA 2P3VA 3T1HE 1B3HA 1DOTA 1LCTA 1YYOA 2DE2A 4IO6A 4F2JC 1ZBTA 3M8UA 2EJ4A 5DVIA 4XXUA 1DTZA 4ZYDA 2ESNA 4NXNE 1B3FA 4UA8A 2EORA 2NVUB 3KG2A 1XMQE 5ET8A 1FPGA 4FAJA 4LZ7A 2HCAA 4FK5C 3QUFA 3THOB 2X7QA 3C32A 5KCJB 2WBSA 4KR5A 1Z7NE 3R26A 2YTJA 5K2XA 3ADGA 4OESA 3CI8A 5I2KA 1A8FA 4X04A 2I3WA 1DCUA 2VT5A 4FIMA 4NF8B 3ZSFA 2EOYA 3C4MA 1MM7A 3O6GA 2ODRD 1P1UA 3CG3A 2LJUA 4TUGA 4EQ7A 1YZ0A 3GLBA 4MJOA 1ZBMA 1FPIA 1G0IA 3IWBA 3L6HA 1I6AA 1RDXA 5FTHA 3IB1A 2VQFE 3OO7A 3RMPA 3K01A 2EMLA 2I58A 4BMJA 4F39A 5AA4A 1WODA 1B3LA 2XWIA 2Y5LA 4QSDA 3EPJA 2KONA 4R72A 1SW5A 1FPBA 2YTFA 2NUFA 1DBZA 1B1HA 1H76A 1R9LA 1Y9UA 2EPNA 4G4PA 2VD2A 5EYHA 4N4UA 2P3NA 3U8QA 3TTMA 2YT4A 1WHQA 3FXQA 5AE2A 2L6MA 4XKPA 2Q8JA 5ADZA 2Z8FA 1JW5A 3CIJA 1MRPA 4LA9A 1RKMA 5I56B 3IL1B 2MKDA 4R2AA 5A5LA 1ZTYA 3G3GA 4H5FA 1B3GA 5FTIA 1MQDA 4H46A 4R6KA 4OX9E 1US5A 1EZOA 4DR3E 3EKIA 4Q8RA 2KQZA 2Z23A 2EE8A 2ENHA 4AQYE 4PF6A 4TLMB 1YUJA 2W7YA 4BDRA 3THNA 4EF2A 2GLIA 1IEJA 1IXIA 2R76A 2CPNA 3MPKA 2ALUA 2ODRC 3BBGA 4GWWA 1BK4A 5T3JA 4LN5A 3B6QA 5IZ1A 2V3UA 3RTWB 3PMWA 1MY2A 2LTRA 3PPRA 5LMNE 1WVJA 2HEUA 3IB2A 4WX9A 3E79A 4MLQA 2ADRA 3FVOA 4DUZE 2EN4A 2QS1A 2HXRA 2KOUA 2RC8A 3DLNA 4JI4E 4R6YA 1Z1BA 3N5LA 5L9MA 2EMIA 4PDHA 2ZZVA 2JY9A 2D3IA 1F2IG 3E4RA 3JTZA 3OSRA 4X1BA 2O1MA 2CZLA 3CVGA 2F34A 4MMPA 1PEBA 4X9TA 2MDRA 4DXCA 4DV1E 2YSOA 4HE2A 2OZZA 5CRYA 1D4NA 2D9HA 4OVQA 3TTNA 1PBPA 2H36X 1UTHA 2HAUA 4O94A 4P0IA 1LLSA 3GZGA 2EOFA 3QMFA 1EZ9A 2RTXA 3OMLA 4GWYA 4NGUA 1M5CA 3KC1A 3TCHA 4KZSA 1IBME 5DVFA 1LBWA 2EL6A 2M7QA 5LL6R 3S9EA 3KBRA 1NV6A 5H8QA 3BFUA 2A5SA 4XTCQ 5F3WA 2Y5KA 2V83A 3G3HA 1SYIA 4FJPA 4F3GA 2GQ1A 4H45A 2N3GA 4HTGA 1B6HA 2E72A 1P1WA 4OWDA 3FD3A 1A1GA 2VE7C 1A55A 4GWOA 2P0SA 1RMDA 2ZMBA 5L8DA 4RK2A 4PFTA 4OEUA 3S4UA 1DI2A 1HSLA 4OVTA 2X26A 1X6EA 2RSIA 2JR1A 1AWBA 2QJEA 2NABA 1FJ9A 4H65A 4LQ5A 3WAEA 3ZKKA 1N84A 4MCOA 4KI0E 1HNXE 3MZBA 4DCYA 5T6JA 4F9CB 3PU5A 1MPDA 1XT8A 1MGTA 4IR8A 1AIVA 4GIZA 3MWBA 2DE3A 3O9PA 4M1VA 2AYSA 4IO7A 4K3FA 1WXRA 4MBPA 2YTPA 4DV2E 4BDQA 1D9VA 1TN9A 5EHSA 5IZ3B 5IWAE 3PUZE 3P1XA 1MEYC 5HM4B 3KZZA 1NV4A 5F24A 2L8TA 3I5OA 3CSGA 5ICQA 1MY0A 5TP9B 4JI3E 4GL8A 1NL5A 1EYKA 4QFPA 1N3GA 4QFOA 1T4NA 4MFIA 2WBUA 2FNCA 4H5GA 3KJ7A 4LZ8A 5IV8B 1MXUA 3MQ9A 1GZ6A 1PB9A 1LBYA 4G61A 1D9QA
chains in the Genus database with same CATH topology
3T9HB 3L6GA 4GQOA 4F19A 3S9LC 1MH4A 4JXIA 2Q2AA 1MY3A 1I69A 2RF1A 3O28A 3SEVA 2XXRA 3RQTA 2YPNA 3VVEA 3EPEA 3IOTA 4R6HA 3EHTA 2GHAA 4F1YA 1R6ZA 2HFBA 1H43A 4HW8A 1B52A 4ELRA 4ZZAA 4PP0A 4KCDA 3UK4A 5I2NA 2A5TB 1MPBA 2UYFA 3FVNA 3H03A 1JETA 3AXFA 4Q0CA 3IAZA 4R9GA 3TODA 2H5YA 3S9NC 3QAXA 1ZJLA 3S9MC 2F78A 1MDP1 3HO7A 4F3BA 2O68A 3TELA 2I4CA 3TYHA 4I1DA 1PDAA 1B5IA 1XC1A 2RC9A 2ABHA 3OEMA 4EUOA 1DPEA 5HBCA 1N3XA 2X7PA 1UTBB 5ITOA 4NWCA 5I2NB 2B3FA 3TUSA 4NF4B 1SYHA 3BFTA 3CRBA 3A09A 3Q26A 2I3VA 4X1DA 2H98A 5KDTA 1US4A 4G68B 1FQCA 2PYYA 2M8CA 3VFJA 3W9VA 5H8SA 2YLNA 4ZEBA 3S2VA 5JK4A 1IXCA 3KZGA 4R2BA 4RXLA 2D21A 1FTKA 3G7WA 4ONYA 5I59A 1B7HA 3H3GA 4EQBA 1MG1A 2DWIA 1JQFA 1Q35A 3LSLA 4LQ2A 4E0XA 1Y3QA 1IQ7A 2DWHA 1L5TA 1GV8A 1FCKA 3C36A 4EQ9A 2VOZA 3CR9A 3OMBA 3IJOB 1JVXA 1QUKA 4NF5B 3I6VA 4YKIA 1RYOA 1LGBC 4R9FA 4BDMA 2DVZA 3O66A 4TOZA 2B3BA 3O6IA 1N04A 2QSXA 3EN3A 2OJTA 2R71A 1MS7A 2PX1A 3OO6A 4PFUA 3RT8A 3VLVA 3TPAA 1FTJA 1II5A 1PC3A 4LONB 1B5HA 1LB8A 4GRKA 1NNTA 1OQHA 2RKMA 4YKPA 1Y4CA 4KQPA 4ZE8A 2FA7A 2V3QA 5EYFA 3MPLA 4G68C 4POWA 1TXFA 1OQGA 1QW0A 2F6GA 2XX8A 5K2YA 2I0BA 3K4UA 4OFLA 4PQJA 3C31A 5TU0A 4I62A 3UN6A 1A40A 1P1NA 5DEXB 3KOSA 2HAVA 1QUJA 3F11A 4M4GA 4OERA 3KGCA 1S50A 1VE4A 4YKJA 4JB7A 5BUUA 2PBWA 2Z8DA 3FGSA 3FIRA 4OVJA 3H6TA 4YMAA 1FTOA 1JVYA 1B5JA 3ILUB 4GFRA 2P2AA 4QFNA 3MAMA 4U4SA 3CFLA 3PPPA 3RY3A 2RCAA 2XXXA 3UGWA 3WAFA 4KFQA 3V8XB 1JW1A 4NF4A 4YMBA 5CM6A 2F97A 1MPCA 1SD3A 1UQWA 4HS7A 5I57A 4YAHX 1FQAA 1B2HA 2ZXTA 4ZEKA 3SERA 3FJMA 4G8HA 4ESWA 2XD2A 3V83A 4U23A 4F2QA 1YAEA 1UIVA 4POXA 1LAHE 3K02A 4OMBA 4ZEIA 4ZE9A 3PUVE 1RYXA 3SESA 3R6UA 4U4XA 4JWYA 1B4HA 2QRYA 1LBBA 3IB0A 2XXPA 1FTMA 2NXOA 3N6TA 4MLVA 4R73A 4RY1A 3G3KA 4WEDA 3LC8A 4OENA 1FQDA 3VDFA 4C1TA 1B1XA 2YJPA 4Z0IA 3TTLA 2O69A 2RINA 3FVKA 3M3FA 3OEKA 2ZYMA 4GXAA 4ISUA 4KYSA 3DP4A 3H6WA 4QHQA 3TQWA 1AOVA 4GD5A 4NE4A 5CI5A 5KDTB 3KN7A 1MQHA 1R9QA 3QYTA 2PT2A 5F7VA 3ODBA 1B0HA 5EHMA 3K00A 1TFDA 3IOUA 5DVJA 4PFWA 3H06B 4P11A 3H4ZA 1EH3A 3Q27A 1P1QA 3GBBA 1EZPA 3HSTA 5I2KB 3TTRA 1FQBA 4H1XA 4YB7A 3TTKA 2O84X 4C1UA 3QXMA 4ESXA 1J1NA 2HXWA 2QS2A 3LBSA 3LSWA 4UACA 2PMSA 3SDFA 4NMYA 5DT6A 2F36A 2F8DA 1OVBA 3MP1A 4DDDA 1SVXB 1B3HA 1DOTA 4OZ9A 1LCTA 1JNFA 1QUIA 2DE2A 4WXJA 4FATA 5CMMA 3N6UA 4IO6A 4X48A 2Y7PA 4H8JA 4EF1A 2V93A 3M8UA 5DVIA 4XXUA 1VFEA 2HQ0A 3DP8A 4Q5TA 3MVYA 4RK9A 1DTZA 4DZ1A 2ESNA 3KSJA 1LAFE 1O63A 4G68A 1B3FA 1NKXA 2H99A 1ZU0A 3C9HA 2PT1A 3OSQA 4NEDA 4UA8A 3GXAA 5B7DA 3TCGA 2NVUB 1NH7A 3H7MA 3KG2A 4RA1A 2DYXA 3VE1B 2DVCA 3E9XA 5DTBA 3TEPA 4DIGA 4JWOA 5LOMA 3TQLA 4RJZA 2UYEA 2F7AA 4FAJA 2VD3A 2XXVA 3MUQA 4LZ7A 4U22A 2LAOA 2HCAA 2OK2A 4GL0A 3TCFA 1A7LA 3QUFA 2Z8EA 3I3VA 2F35A 3E3KA 2X7QA 1IITA 3SEYA 3U72A 3C32A 3LSXA 4ELPA 4H8IA 3OD7A 5FHMA 1BKAA 5KCJB 2DQVA 2XHDA 4KR5A 1Z7NE 3R26A 3IOWA 1O64A 4PETA 4F3SA 1OVTA 5K2XA 4OESA 1H3DA 3CI8A 3HPIA 1NNKA 5I2KA 4HCWA 4OYVA 3VLUA 4R75A 1A8FA 4G8MA 4EXKA 2I3WA 3LSFB 1SBPA 3KFMA 5DYHA 3MZ1A 2DWJA 4FIMA 3OELA 4NF8B 1H45A 5IKBA 3FUZA 2OWTA 3ZSFA 2IEEA 5JEIA 3C4MA 5TPAA 1MM7A 3O6GA 3EF7A 4IGTA 2Y7WA 1P1UA 4GVOA 1MQGA 1VR5A 3CG3A 1HSJA 3RNNA 3TKDA 4TLLB 4EQ7A 2V84A 4ECFA 4N13A 2THIA 5CMCA 3IX1A 4DE8A 4GF8A 1PB8A 5L9SA 3TDJA 4QRZA 3GLBA 1M5DA 1ZBMA 4G2ZA 2I0CA 4DXBA 4DXUA 4GLIA 2A5TA 2VHAA 3FATA 4JSDA 3SEWA 2AL4A 3HN0A 4THIA 1ZMGA 3L6HA 4OXVA 1B51A 4ZEDA 1I6AA 2QMXA 1O7TA 1OLAA 3A3UA 1GR2A 5FTHA 4I8CA 2F7BA 5CMBA 4AB5A 3OOAA 3IB1A 3OO7A 2KLFA 1IXGA 3K01A 3IO4A 5L9OA 2I58A 3T93B 2UVJA 5KZTA 1T0KA 3V89B 5CC2A 3FVGA 4F39A 1KWHA 5AA4A 1WODA 3IR1A 5H8FB 3PUWE 2DOJA 4I9DA 1N3WA 5A5XA 1B3LA 4QSCA 5M2VA 3M3KA 1MY1A 2PVUA 4LVQA 4QSDA 1DMBA 3KN3A 3VXBA 3IK6B 3MC2A 4YKKA 3RUMA 3U92A 3MZ9A 1Y1ZA 3K6WA 2GHBA 4JSOA 4R72A 1ZIUA 2Z22A 1SW5A 2Q89A 4RPOA 4YICA 1AH5A 1LB9A 1B1HA 1N76A 3FZVA 4OFJA 1H76A 1R9LA 1Y9UA 4KCCA 3W15C 4G4PA 2VD2A 3O6HA 3MJNA 4LATA 2DWAA 3U8QA 5H8NA 2R9JA 2XXIA 1DSNA 3TMGA 3TTMA 2Q9TA 4YU0A 3FXQA 2Q88A 3T66A 4G77A 3T9UA 3KSXA 4ELOA 4OQOA 4XKPA 4GOTA 2Q8JA 3PPOA 3OXNA 3PD9A 4RNSA 4KHZE 4OEVA 3CSBA 4R2FA 5AA2D 1HSEA 2I4BA 1BTJA 3FJGA 2Z8FA 1CE2A 2DXRA 1JW5A 3CIJA 3ILTB 1MRPA 3PV0E 4IY5A 4LA9A 3UA8A 5I58A 1RKMA 5I56B 3IL1B 4MF3A 1NNFA 1SI0A 1MXXA 1WDNA 3IJXB 2OCUA 1ZTYA 3G3GA 1MH3A 3FJ7A 1M5BA 3UORA 4PFYA 1YPNA 4H5FA 4QSEA 4RYAA 3OO8A 2E1SA 1B3GA 2OBGA 3DM0A 4ND9A 4AQ4A 5FTIA 5H8FA 1FQFA 1MQDA 4N6PA 4R6KA 1US5A 3SETA 1URDA 2XXHA 2NWJA 3VV5A 1B46A 4Q8RA 3MP8A 5AA4B 1EZOA 2HZLA 2Z23A 3HV1A 4H67A 4FECA 2DP8A 1SI1A 1ANFA 1LFGA 2Y7KA 2VP1A 1D3KA 1Y4TA 2ANJA 1PB7A 2ONKE 3H6UA 4TLMB 2ZNUA 2W7YA 5CBRA 4IGRA 2UXAA 5I57B 2REJA 5F1QA 4F18A 2QL3A 3U94A 2XD3A 4WEPA 4BDRA 4BLAA 1MXYA 4EF2A 4ZECA 1IEJA 4XIGQ 1IXIA 4BDNA 2GH9A 3MPKA 3R7XA 2ALUA 4MH5A 3VVFA 1GGGA 2REGA 3QSLA 4KYDA 3PD8A 4YZZA 1GTKA 3PPNA 5H8HB 3SEUA 2O7UA 3B6QA 4F3PA 2V3UA 3QK6A 1FW0A 1NNPA 3RTWB 3Q25A 3PMWA 1QKAA 1MY2A 4NF8A 3PPRA 1SDXA 3PUYE 1WVJA 2HEUA 2VGQA 3IB2A 1TT1A 3MVXA 1GVCA 3TFLA 3U93A 1M5EA 5ITPA 1BP5A 2UVHA 1B05A 1N7WA 4OFOA 4MLQA 3B6WA 1ZKBA 1MXZA 3JZJA 3OO9A 3BKIB 3FVOA 1Z7ME 1B9JA 2DXYA 1EU8A 1AL3A 4WKMA 2QS1A 3VVDA 4C0RA 4F22A 3E13X 4NF6A 3RPWA 1CB6A 4F1VA 5H8HA 1DPPA 3K6XA 2RC8A 1XOCA 3DLNA 3G3FA 4IY6A 4R6YA 1B32A 1VFDA 3RN8A 3W9WA 3N5LA 5L9MA 2OWSA 2XXTA 4YB5A 5AA3A 5AA2B 1AMFA 4HCYA 3D4GA 2D3IA 2H4IA 5HPQA 3VXCA 3M3LA 4LZ5A 1UTHB 3E4RA 1N7XA 3OSRA 2H25A 3LR1A 2UVGA 4JBZA 4X1BA 3CFZA 2O1MA 1IIWA 5DEXA 2CZLA 2O6AA 2QPQA 2I48A 2D5WA 1ELJA 1Q1KA 3CVGA 2F34A 2RCBA 4G8NA 5J1DA 4E0WA 3T22A 1PEBA 4X9TA 5ICTA 3GBAA 3K1NA 3T96B 3FASA 3SKPA 4DXCA 3ZS6A 1QKBA 1XHYA 2E0SA 1VSOA 4ZZEA 4AB6A 2OZZA 1SW2A 5CRYA 4F1UA 2CMOA 1QULA 1D4NA 2NUVA 2R6GE 5CBSA 3O29A 3B6TA 3BBRA 3P7IA 3TTNA 1PBPA 2HAUA 1UTHA 3K1MA 4ZDMA 4LP2B 1LLSA 4P0IA 3GZGA 1Y3NA 2GRVA 5I56A 5AA2A 5B70A 1YTVA 1SW4A 4R74A 1EZ9A 3THIA 3N94A 3FXUA 1A99A 1PBQA 4KPTA 2F5XA 1LFIA 1DTGA 2QS3A 5TP9A 1M5CA 3LUYA 3Q28A 3TCHA 4NF6B 4N07A 5DVFA 5AE4A 3FV2A 4XKNA 1Y1MA 1UIUA 3G3IA 2AIXA 3KOTA 3UP9A 1OIBA 2IA4A 3JYRA 4U21A 3HCQA 3U1OA 4U2RA 1I6BA 3B7DA 3K1PA 1QVSA 1LAGE 1UTBA 4NTLA 3S9EA 3KBRA 4JDFA 4L17A 2HZKA 5ISUA 2XXQA 2NOOA 5H8QA 3BFUA 1Y3PA 1JW4A 2A5SA 4XTCQ 3KN8A 1USYH 3N26A 1IXHA 4O3CA 5H8QB 2ZYKA 3G3HA 1MDQA 1SYIA 1P99A 1URGA 2V25A 4FJPA 1A54A 1LBCA 2P1SA 1S9TA 5JTYB 3VLWA 4F3GA 4DCXA 3FXRA 3FV1A 4PE5B 3UIFA 4HTGA 1B6HA 1P1WA 3D4CA 3QIMA 4OWDA 1MQIA 2I49A 3ECRA 2O1LA 3FD3A 4XKQA 2XXUA 5BWJA 1OLCA 3C35A 1A55A 4EDPA 2B65A 3K6VA 4GWOA 4FEBA 1B0LA 1FQEA 1H44A 1MM6A 2P0SA 2V3TA 2ZMBA 2DSFA 3A3CA 5L8DA 3O2AA 4P0GA 4TQUQ 4RK2A 1B7UA 4PFTA 1POY1 4OEUA 3S4UA 1Y20A 2ZYOA 1LCFA 1HSLA 5CMKA 4O3AA 3KEIA 3MVWA 4KYEA 1POTA 4Q30B 5JTYA 2DE4A 2QMWA 1B7ZA 2X26A 4Z7EA 2DS9A 2AL5A 1ATGA 3EHUA 3ONMA 1B58A 5AA1A 4NWDA 3HHFA 2QJEA 5FHNA 5A5XB 3CG1A 4KD5A 4BDLA 1XVYA 4ZS9A 3IORA 1A8EA 3T9VA 1LFHA 2UVIA 4H65A 4LQ5A 2WKYA 1D9YA 4ZEFA 3WAEA 3DP6A 3ZKKA 3PMVA 3ZKLA 1XS5A 1N84A 5IAIA 1N0TA 2G93A 3MW0A 1BIYA 1LSTA 4IO4A 4O3BA 3TZAA 5ELVA 4KI0E 2Y7IA 3PUXE 2Y7RA 3CFXA 3MZBA 1R1NA 5FHOA 5H8NB 2XX7A 4DCYA 1JEUA 2QS4A 1SQYA 4JWXA 4QF9A 3K2DA 3K6UA 4F29A 3HHGA 3RTFB 3PGFA 4IO2A 1USYE 2ZNTA 4IO5A 3EQ1A 3DELB 3PU5A 3OENA 3RT6B 1MPDA 5KCJA 5I59B 4DLDA 1XT8A 4F2OA 4EXLA 3MVZA 1I6QA 3K0VA 1F9BA 2F7CA 4FE8A 1BLFA 4QFKA 2G29A 1AIVA 2BJJX 2GFEA 2O7IA 2RC7A 2ZYNA 4GIZA 1B3EA 1M5FA 2DE3A 3MWBA 1SW1A 1MY4A 3SEXA 3O9PA 4M1VA 1S7YA 1TWYA 2AYSA 4IO7A 4K3FA 4XKRA 1OMPA 4MBPA 4QFLA 1URSA 5I58B 4BDQA 1D9VA 1IZ1A 5EHSA 4ELQA 1MXVA 1XVXA 3O97A 1NH8A 3Q29A 2ONRA 4FORA 3RGYA 3TAJA 3G3JA 3PUZE 1MXWA 3IO6A 4GXSB 3PMXA 2XXYA 1P1OA 4IO3A 2FYIA 4U1OA 5HM4B 2ZNSA 1TFAA 1YCJA 2OLBA 3H6VA 3RLFE 3C34A 2ONSA 2XXWA 3I5OA 3CSGA 4OTEA 4H6DA 5ICQA 1MY0A 4BDOA 5TP9B 4NF5A 4GL8A 1NL5A 2F6PA 3USDA 4QFPA 4OHNA 2Q2CA 2Y84A 4QFOA 4MFIA 2H9BA 3T9XB 1ZLQA 3JV9A 4FEDA 4RPNA 4U1ZA 1QJMA 5I84A 1IUDA 1NMUA 2FNCA 4H5GA 4H0WA 4YB6A 1B40A 4IB2A 3KJ7A 4LZ8A 4LUBA 3EHSA 3MP6A 2O51A 1MXUA 5TPAB 3MQ9A 4OETA 1LAXA 1JEVA 1B4ZA 3QUJA 3V5AA 3KJTA 1MQJA 1PB9A 3PPQA 4F31B 3MBPA 1NFTA 2XX9A 2I6EA 3C33A 1FTLA 3IOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9H B;  3L6G A;  4GQO A;  4F19 A;  3S9L C;  1MH4 A;  4JXI A;  2Q2A A;  1MY3 A;  1I69 A;  2RF1 A;  3O28 A;  3SEV A;  2XXR A;  3RQT A;  2YPN A;  3VVE A;  3EPE A;  3IOT A;  4R6H A;  3EHT A;  2GHA A;  4F1Y A;  1R6Z A;  2HFB A;  1H43 A;  4HW8 A;  1B52 A;  4ELR A;  4ZZA A;  4PP0 A;  4KCD A;  3UK4 A;  5I2N A;  2A5T B;  1MPB A;  2UYF A;  3FVN A;  3H03 A;  1JET A;  3AXF A;  4Q0C A;  3IAZ A;  4R9G A;  3TOD A;  2H5Y A;  3S9N C;  3QAX A;  1ZJL A;  3S9M C;  2F78 A;  1MDP 1;  3HO7 A;  4F3B A;  2O68 A;  3TEL A;  2I4C A;  3TYH A;  4I1D A;  1PDA A;  1B5I A;  1XC1 A;  2RC9 A;  2ABH A;  3OEM A;  4EUO A;  1DPE A;  5HBC A;  1N3X A;  2X7P A;  1UTB B;  5ITO A;  4NWC A;  5I2N B;  2B3F A;  3TUS A;  4NF4 B;  1SYH A;  3BFT A;  3CRB A;  3A09 A;  3Q26 A;  2I3V A;  4X1D A;  2H98 A;  5KDT A;  1US4 A;  4G68 B;  1FQC A;  2PYY A;  2M8C A;  3VFJ A;  3W9V A;  5H8S A;  2YLN A;  4ZEB A;  3S2V A;  5JK4 A;  1IXC A;  3KZG A;  4R2B A;  4RXL A;  2D21 A;  1FTK A;  3G7W A;  4ONY A;  5I59 A;  1B7H A;  3H3G A;  4EQB A;  1MG1 A;  2DWI A;  1JQF A;  1Q35 A;  3LSL A;  4LQ2 A;  4E0X A;  1Y3Q A;  1IQ7 A;  2DWH A;  1L5T A;  1GV8 A;  1FCK A;  3C36 A;  4EQ9 A;  2VOZ A;  3CR9 A;  3OMB A;  3IJO B;  1JVX A;  1QUK A;  4NF5 B;  3I6V A;  4YKI A;  1RYO A;  1LGB C;  4R9F A;  4BDM A;  2DVZ A;  3O66 A;  4TOZ A;  2B3B A;  3O6I A;  1N04 A;  2QSX A;  3EN3 A;  2OJT A;  2R71 A;  1MS7 A;  2PX1 A;  3OO6 A;  4PFU A;  3RT8 A;  3VLV A;  3TPA A;  1FTJ A;  1II5 A;  1PC3 A;  4LON B;  1B5H A;  1LB8 A;  4GRK A;  1NNT A;  1OQH A;  2RKM A;  4YKP A;  1Y4C A;  4KQP A;  4ZE8 A;  2FA7 A;  2V3Q A;  5EYF A;  3MPL A;  4G68 C;  4POW A;  1TXF A;  1OQG A;  1QW0 A;  2F6G A;  2XX8 A;  5K2Y A;  2I0B A;  3K4U A;  4OFL A;  4PQJ A;  3C31 A;  5TU0 A;  4I62 A;  3UN6 A;  1A40 A;  1P1N A;  5DEX B;  3KOS A;  2HAV A;  1QUJ A;  3F11 A;  4M4G A;  4OER A;  3KGC A;  1S50 A;  1VE4 A;  4YKJ A;  4JB7 A;  5BUU A;  2PBW A;  2Z8D A;  3FGS A;  3FIR A;  4OVJ A;  3H6T A;  4YMA A;  1FTO A;  1JVY A;  1B5J A;  3ILU B;  4GFR A;  2P2A A;  4QFN A;  3MAM A;  4U4S A;  3CFL A;  3PPP A;  3RY3 A;  2RCA A;  2XXX A;  3UGW A;  3WAF A;  4KFQ A;  3V8X B;  1JW1 A;  4NF4 A;  4YMB A;  5CM6 A;  2F97 A;  1MPC A;  1SD3 A;  1UQW A;  4HS7 A;  5I57 A;  4YAH X;  1FQA A;  1B2H A;  2ZXT A;  4ZEK A;  3SER A;  3FJM A;  4G8H A;  4ESW A;  2XD2 A;  3V83 A;  4U23 A;  4F2Q A;  1YAE A;  1UIV A;  4POX A;  1LAH E;  3K02 A;  4OMB A;  4ZEI A;  4ZE9 A;  3PUV E;  1RYX A;  3SES A;  3R6U A;  4U4X A;  4JWY A;  1B4H A;  2QRY A;  1LBB A;  3IB0 A;  2XXP A;  1FTM A;  2NXO A;  3N6T A;  4MLV A;  4R73 A;  4RY1 A;  3G3K A;  4WED A;  3LC8 A;  4OEN A;  1FQD A;  3VDF A;  4C1T A;  1B1X A;  2YJP A;  4Z0I A;  3TTL A;  2O69 A;  2RIN A;  3FVK A;  3M3F A;  3OEK A;  2ZYM A;  4GXA A;  4ISU A;  4KYS A;  3DP4 A;  3H6W A;  4QHQ A;  3TQW A;  1AOV A;  4GD5 A;  4NE4 A;  5CI5 A;  5KDT B;  3KN7 A;  1MQH A;  1R9Q A;  3QYT A;  2PT2 A;  5F7V A;  3ODB A;  1B0H A;  5EHM A;  3K00 A;  1TFD A;  3IOU A;  5DVJ A;  4PFW A;  3H06 B;  4P11 A;  3H4Z A;  1EH3 A;  3Q27 A;  1P1Q A;  3GBB A;  1EZP A;  3HST A;  5I2K B;  3TTR A;  1FQB A;  4H1X A;  4YB7 A;  3TTK A;  2O84 X;  4C1U A;  3QXM A;  4ESX A;  1J1N A;  2HXW A;  2QS2 A;  3LBS A;  3LSW A;  4UAC A;  2PMS A;  3SDF A;  4NMY A;  5DT6 A;  2F36 A;  2F8D A;  1OVB A;  3MP1 A;  4DDD A;  1SVX B;  1B3H A;  1DOT A;  4OZ9 A;  1LCT A;  1JNF A;  1QUI A;  2DE2 A;  4WXJ A;  4FAT A;  5CMM A;  3N6U A;  4IO6 A;  4X48 A;  2Y7P A;  4H8J A;  4EF1 A;  2V93 A;  3M8U A;  5DVI A;  4XXU A;  1VFE A;  2HQ0 A;  3DP8 A;  4Q5T A;  3MVY A;  4RK9 A;  1DTZ A;  4DZ1 A;  2ESN A;  3KSJ A;  1LAF E;  1O63 A;  4G68 A;  1B3F A;  1NKX A;  2H99 A;  1ZU0 A;  3C9H A;  2PT1 A;  3OSQ A;  4NED A;  4UA8 A;  3GXA A;  5B7D A;  3TCG A;  2NVU B;  1NH7 A;  3H7M A;  3KG2 A;  4RA1 A;  2DYX A;  3VE1 B;  2DVC A;  3E9X A;  5DTB A;  3TEP A;  4DIG A;  4JWO A;  5LOM A;  3TQL A;  4RJZ A;  2UYE A;  2F7A A;  4FAJ A;  2VD3 A;  2XXV A;  3MUQ A;  4LZ7 A;  4U22 A;  2LAO A;  2HCA A;  2OK2 A;  4GL0 A;  3TCF A;  1A7L A;  3QUF A;  2Z8E A;  3I3V A;  2F35 A;  3E3K A;  2X7Q A;  1IIT A;  3SEY A;  3U72 A;  3C32 A;  3LSX A;  4ELP A;  4H8I A;  3OD7 A;  5FHM A;  1BKA A;  5KCJ B;  2DQV A;  2XHD A;  4KR5 A;  1Z7N E;  3R26 A;  3IOW A;  1O64 A;  4PET A;  4F3S A;  1OVT A;  5K2X A;  4OES A;  1H3D A;  3CI8 A;  3HPI A;  1NNK A;  5I2K A;  4HCW A;  4OYV A;  3VLU A;  4R75 A;  1A8F A;  4G8M A;  4EXK A;  2I3W A;  3LSF B;  1SBP A;  3KFM A;  5DYH A;  3MZ1 A;  2DWJ A;  4FIM A;  3OEL A;  4NF8 B;  1H45 A;  5IKB A;  3FUZ A;  2OWT A;  3ZSF A;  2IEE A;  5JEI A;  3C4M A;  5TPA A;  1MM7 A;  3O6G A;  3EF7 A;  4IGT A;  2Y7W A;  1P1U A;  4GVO A;  1MQG A;  1VR5 A;  3CG3 A;  1HSJ A;  3RNN A;  3TKD A;  4TLL B;  4EQ7 A;  2V84 A;  4ECF A;  4N13 A;  2THI A;  5CMC A;  3IX1 A;  4DE8 A;  4GF8 A;  1PB8 A;  5L9S A;  3TDJ A;  4QRZ A;  3GLB A;  1M5D A;  1ZBM A;  4G2Z A;  2I0C A;  4DXB A;  4DXU A;  4GLI A;  2A5T A;  2VHA A;  3FAT A;  4JSD A;  3SEW A;  2AL4 A;  3HN0 A;  4THI A;  1ZMG A;  3L6H A;  4OXV A;  1B51 A;  4ZED A;  1I6A A;  2QMX A;  1O7T A;  1OLA A;  3A3U A;  1GR2 A;  5FTH A;  4I8C A;  2F7B A;  5CMB A;  4AB5 A;  3OOA A;  3IB1 A;  3OO7 A;  2KLF A;  1IXG A;  3K01 A;  3IO4 A;  5L9O A;  2I58 A;  3T93 B;  2UVJ A;  5KZT A;  1T0K A;  3V89 B;  5CC2 A;  3FVG A;  4F39 A;  1KWH A;  5AA4 A;  1WOD A;  3IR1 A;  5H8F B;  3PUW E;  2DOJ A;  4I9D A;  1N3W A;  5A5X A;  1B3L A;  4QSC A;  5M2V A;  3M3K A;  1MY1 A;  2PVU A;  4LVQ A;  4QSD A;  1DMB A;  3KN3 A;  3VXB A;  3IK6 B;  3MC2 A;  4YKK A;  3RUM A;  3U92 A;  3MZ9 A;  1Y1Z A;  3K6W A;  2GHB A;  4JSO A;  4R72 A;  1ZIU A;  2Z22 A;  1SW5 A;  2Q89 A;  4RPO A;  4YIC A;  1AH5 A;  1LB9 A;  1B1H A;  1N76 A;  3FZV A;  4OFJ A;  1H76 A;  1R9L A;  1Y9U A;  4KCC A;  3W15 C;  4G4P A;  2VD2 A;  3O6H A;  3MJN A;  4LAT A;  2DWA A;  3U8Q A;  5H8N A;  2R9J A;  2XXI A;  1DSN A;  3TMG A;  3TTM A;  2Q9T A;  4YU0 A;  3FXQ A;  2Q88 A;  3T66 A;  4G77 A;  3T9U A;  3KSX A;  4ELO A;  4OQO A;  4XKP A;  4GOT A;  2Q8J A;  3PPO A;  3OXN A;  3PD9 A;  4RNS A;  4KHZ E;  4OEV A;  3CSB A;  4R2F A;  5AA2 D;  1HSE A;  2I4B A;  1BTJ A;  3FJG A;  2Z8F A;  1CE2 A;  2DXR A;  1JW5 A;  3CIJ A;  3ILT B;  1MRP A;  3PV0 E;  4IY5 A;  4LA9 A;  3UA8 A;  5I58 A;  1RKM A;  5I56 B;  3IL1 B;  4MF3 A;  1NNF A;  1SI0 A;  1MXX A;  1WDN A;  3IJX B;  2OCU A;  1ZTY A;  3G3G A;  1MH3 A;  3FJ7 A;  1M5B A;  3UOR A;  4PFY A;  1YPN A;  4H5F A;  4QSE A;  4RYA A;  3OO8 A;  2E1S A;  1B3G A;  2OBG A;  3DM0 A;  4ND9 A;  4AQ4 A;  5FTI A;  5H8F A;  1FQF A;  1MQD A;  4N6P A;  4R6K A;  1US5 A;  3SET A;  1URD A;  2XXH A;  2NWJ A;  3VV5 A;  1B46 A;  4Q8R A;  3MP8 A;  5AA4 B;  1EZO A;  2HZL A;  2Z23 A;  3HV1 A;  4H67 A;  4FEC A;  2DP8 A;  1SI1 A;  1ANF A;  1LFG A;  2Y7K A;  2VP1 A;  1D3K A;  1Y4T A;  2ANJ A;  1PB7 A;  2ONK E;  3H6U A;  4TLM B;  2ZNU A;  2W7Y A;  5CBR A;  4IGR A;  2UXA A;  5I57 B;  2REJ A;  5F1Q A;  4F18 A;  2QL3 A;  3U94 A;  2XD3 A;  4WEP A;  4BDR A;  4BLA A;  1MXY A;  4EF2 A;  4ZEC A;  1IEJ A;  4XIG Q;  1IXI A;  4BDN A;  2GH9 A;  3MPK A;  3R7X A;  2ALU A;  4MH5 A;  3VVF A;  1GGG A;  2REG A;  3QSL A;  4KYD A;  3PD8 A;  4YZZ A;  1GTK A;  3PPN A;  5H8H B;  3SEU A;  2O7U A;  3B6Q A;  4F3P A;  2V3U A;  3QK6 A;  1FW0 A;  1NNP A;  3RTW B;  3Q25 A;  3PMW A;  1QKA A;  1MY2 A;  4NF8 A;  3PPR A;  1SDX A;  3PUY E;  1WVJ A;  2HEU A;  2VGQ A;  3IB2 A;  1TT1 A;  3MVX A;  1GVC A;  3TFL A;  3U93 A;  1M5E A;  5ITP A;  1BP5 A;  2UVH A;  1B05 A;  1N7W A;  4OFO A;  4MLQ A;  3B6W A;  1ZKB A;  1MXZ A;  3JZJ A;  3OO9 A;  3BKI B;  3FVO A;  1Z7M E;  1B9J A;  2DXY A;  1EU8 A;  1AL3 A;  4WKM A;  2QS1 A;  3VVD A;  4C0R A;  4F22 A;  3E13 X;  4NF6 A;  3RPW A;  1CB6 A;  4F1V A;  5H8H A;  1DPP A;  3K6X A;  2RC8 A;  1XOC A;  3DLN A;  3G3F A;  4IY6 A;  4R6Y A;  1B32 A;  1VFD A;  3RN8 A;  3W9W A;  3N5L A;  5L9M A;  2OWS A;  2XXT A;  4YB5 A;  5AA3 A;  5AA2 B;  1AMF A;  4HCY A;  3D4G A;  2D3I A;  2H4I A;  5HPQ A;  3VXC A;  3M3L A;  4LZ5 A;  1UTH B;  3E4R A;  1N7X A;  3OSR A;  2H25 A;  3LR1 A;  2UVG A;  4JBZ A;  4X1B A;  3CFZ A;  2O1M A;  1IIW A;  5DEX A;  2CZL A;  2O6A A;  2QPQ A;  2I48 A;  2D5W A;  1ELJ A;  1Q1K A;  3CVG A;  2F34 A;  2RCB A;  4G8N A;  5J1D A;  4E0W A;  3T22 A;  1PEB A;  4X9T A;  5ICT A;  3GBA A;  3K1N A;  3T96 B;  3FAS A;  3SKP A;  4DXC A;  3ZS6 A;  1QKB A;  1XHY A;  2E0S A;  1VSO A;  4ZZE A;  4AB6 A;  2OZZ A;  1SW2 A;  5CRY A;  4F1U A;  2CMO A;  1QUL A;  1D4N A;  2NUV A;  2R6G E;  5CBS A;  3O29 A;  3B6T A;  3BBR A;  3P7I A;  3TTN A;  1PBP A;  2HAU A;  1UTH A;  3K1M A;  4ZDM A;  4LP2 B;  1LLS A;  4P0I A;  3GZG A;  1Y3N A;  2GRV A;  5I56 A;  5AA2 A;  5B70 A;  1YTV A;  1SW4 A;  4R74 A;  1EZ9 A;  3THI A;  3N94 A;  3FXU A;  1A99 A;  1PBQ A;  4KPT A;  2F5X A;  1LFI A;  1DTG A;  2QS3 A;  5TP9 A;  1M5C A;  3LUY A;  3Q28 A;  3TCH A;  4NF6 B;  4N07 A;  5DVF A;  5AE4 A;  3FV2 A;  4XKN A;  1Y1M A;  1UIU A;  3G3I A;  2AIX A;  3KOT A;  3UP9 A;  1OIB A;  2IA4 A;  3JYR A;  4U21 A;  3HCQ A;  3U1O A;  4U2R A;  1I6B A;  3B7D A;  3K1P A;  1QVS A;  1LAG E;  1UTB A;  4NTL A;  3S9E A;  3KBR A;  4JDF A;  4L17 A;  2HZK A;  5ISU A;  2XXQ A;  2NOO A;  5H8Q A;  3BFU A;  1Y3P A;  1JW4 A;  2A5S A;  4XTC Q;  3KN8 A;  1USY H;  3N26 A;  1IXH A;  4O3C A;  5H8Q B;  2ZYK A;  3G3H A;  1MDQ A;  1SYI A;  1P99 A;  1URG A;  2V25 A;  4FJP A;  1A54 A;  1LBC A;  2P1S A;  1S9T A;  5JTY B;  3VLW A;  4F3G A;  4DCX A;  3FXR A;  3FV1 A;  4PE5 B;  3UIF A;  4HTG A;  1B6H A;  1P1W A;  3D4C A;  3QIM A;  4OWD A;  1MQI A;  2I49 A;  3ECR A;  2O1L A;  3FD3 A;  4XKQ A;  2XXU A;  5BWJ A;  1OLC A;  3C35 A;  1A55 A;  4EDP A;  2B65 A;  3K6V A;  4GWO A;  4FEB A;  1B0L A;  1FQE A;  1H44 A;  1MM6 A;  2P0S A;  2V3T A;  2ZMB A;  2DSF A;  3A3C A;  5L8D A;  3O2A A;  4P0G A;  4TQU Q;  4RK2 A;  1B7U A;  4PFT A;  1POY 1;  4OEU A;  3S4U A;  1Y20 A;  2ZYO A;  1LCF A;  1HSL A;  5CMK A;  4O3A A;  3KEI A;  3MVW A;  4KYE A;  1POT A;  4Q30 B;  5JTY A;  2DE4 A;  2QMW A;  1B7Z A;  2X26 A;  4Z7E A;  2DS9 A;  2AL5 A;  1ATG A;  3EHU A;  3ONM A;  1B58 A;  5AA1 A;  4NWD A;  3HHF A;  2QJE A;  5FHN A;  5A5X B;  3CG1 A;  4KD5 A;  4BDL A;  1XVY A;  4ZS9 A;  3IOR A;  1A8E A;  3T9V A;  1LFH A;  2UVI A;  4H65 A;  4LQ5 A;  2WKY A;  1D9Y A;  4ZEF A;  3WAE A;  3DP6 A;  3ZKK A;  3PMV A;  3ZKL A;  1XS5 A;  1N84 A;  5IAI A;  1N0T A;  2G93 A;  3MW0 A;  1BIY A;  1LST A;  4IO4 A;  4O3B A;  3TZA A;  5ELV A;  4KI0 E;  2Y7I A;  3PUX E;  2Y7R A;  3CFX A;  3MZB A;  1R1N A;  5FHO A;  5H8N B;  2XX7 A;  4DCY A;  1JEU A;  2QS4 A;  1SQY A;  4JWX A;  4QF9 A;  3K2D A;  3K6U A;  4F29 A;  3HHG A;  3RTF B;  3PGF A;  4IO2 A;  1USY E;  2ZNT A;  4IO5 A;  3EQ1 A;  3DEL B;  3PU5 A;  3OEN A;  3RT6 B;  1MPD A;  5KCJ A;  5I59 B;  4DLD A;  1XT8 A;  4F2O A;  4EXL A;  3MVZ A;  1I6Q A;  3K0V A;  1F9B A;  2F7C A;  4FE8 A;  1BLF A;  4QFK A;  2G29 A;  1AIV A;  2BJJ X;  2GFE A;  2O7I A;  2RC7 A;  2ZYN A;  4GIZ A;  1B3E A;  1M5F A;  2DE3 A;  3MWB A;  1SW1 A;  1MY4 A;  3SEX A;  3O9P A;  4M1V A;  1S7Y A;  1TWY A;  2AYS A;  4IO7 A;  4K3F A;  4XKR A;  1OMP A;  4MBP A;  4QFL A;  1URS A;  5I58 B;  4BDQ A;  1D9V A;  1IZ1 A;  5EHS A;  4ELQ A;  1MXV A;  1XVX A;  3O97 A;  1NH8 A;  3Q29 A;  2ONR A;  4FOR A;  3RGY A;  3TAJ A;  3G3J A;  3PUZ E;  1MXW A;  3IO6 A;  4GXS B;  3PMX A;  2XXY A;  1P1O A;  4IO3 A;  2FYI A;  4U1O A;  5HM4 B;  2ZNS A;  1TFA A;  1YCJ A;  2OLB A;  3H6V A;  3RLF E;  3C34 A;  2ONS A;  2XXW A;  3I5O A;  3CSG A;  4OTE A;  4H6D A;  5ICQ A;  1MY0 A;  4BDO A;  5TP9 B;  4NF5 A;  4GL8 A;  1NL5 A;  2F6P A;  3USD A;  4QFP A;  4OHN A;  2Q2C A;  2Y84 A;  4QFO A;  4MFI A;  2H9B A;  3T9X B;  1ZLQ A;  3JV9 A;  4FED A;  4RPN A;  4U1Z A;  1QJM A;  5I84 A;  1IUD A;  1NMU A;  2FNC A;  4H5G A;  4H0W A;  4YB6 A;  1B40 A;  4IB2 A;  3KJ7 A;  4LZ8 A;  4LUB A;  3EHS A;  3MP6 A;  2O51 A;  1MXU A;  5TPA B;  3MQ9 A;  4OET A;  1LAX A;  1JEV A;  1B4Z A;  3QUJ A;  3V5A A;  3KJT A;  1MQJ A;  1PB9 A;  3PPQ A;  4F31 B;  3MBP A;  1NFT A;  2XX9 A;  2I6E A;  3C33 A;  1FTL A;  3IOV A; 
#chains in the Genus database with same CATH topology
 3RYD A;  4GQO A;  3IWC A;  2RF1 A;  3O28 A;  3SEV A;  2XXR A;  3RQT A;  2YPN A;  3VVE A;  4PP0 A;  5I2N A;  2A5T B;  1JET A;  2EPM X;  2QVV A;  1FBG A;  5A6K A;  3HPS A;  3TEL A;  4LFA E;  3KWR A;  2EP3 A;  3OEM A;  2RC9 A;  4N8G A;  1FSA A;  5HBC A;  4LF5 E;  2B3F A;  4B3T E;  4NF4 B;  1SYH A;  3Q26 A;  3HQ1 A;  1YZ9 A;  1US4 A;  4HXV A;  1FQC A;  3VFJ A;  3W9V A;  2EMW A;  2LVH A;  4RXL A;  1STU A;  2D21 A;  4Q35 B;  4EQB A;  3BF2 A;  1JQF A;  2DWH A;  1UBD C;  1FCK A;  3C36 A;  2VOZ A;  4NF5 B;  4F9A B;  2G7H A;  2QSX A;  3EN3 A;  1N33 E;  4PFU A;  2Q8M A;  1II5 A;  4WSP A;  3VHT B;  1B5H A;  3MHH C;  2E5L E;  1NNT A;  1OQH A;  2DRP A;  2RKM A;  5DNY A;  4ZE8 A;  2V3Q A;  1QW0 A;  2XX8 A;  3RPL A;  4OFL A;  1A40 A;  4PGP A;  1EYI A;  1X47 A;  2YTD A;  4M4G A;  4DV0 E;  1S50 A;  1VE4 A;  5BUU A;  2DSY A;  2EM8 A;  1JVY A;  2PFZ A;  1FKA E;  2XXX A;  5CM6 A;  4YMB A;  2EN7 A;  5IGA A;  1B2H A;  2ZXT A;  3QG5 C;  4ESW A;  2XD2 A;  2JPA A;  1IQO A;  1UIV A;  4OMB A;  2YZT A;  3PUV E;  3SES A;  1ZU1 A;  4U4X A;  4R73 A;  1FTM A;  4MLV A;  3G3K A;  4NQ8 A;  2O69 A;  5CFF E;  3M3F A;  5A6J A;  4GXA A;  5CI5 A;  1RDY A;  4N8Y A;  2XWO A;  3QYT A;  2LT7 A;  4PAI A;  4M9V C;  3K00 A;  3H06 B;  1X48 A;  3Q27 A;  2L33 A;  5I2K B;  3TTR A;  4O7I A;  4DV4 E;  1J1N A;  2QS2 A;  3LSW A;  4PC9 A;  4DR6 E;  1I94 E;  1UN6 B;  5DT6 A;  4X62 E;  4DDD A;  3LLH A;  4PDD A;  4WXJ A;  2PFY A;  2Y7P A;  4GWX A;  2HQ0 A;  4Q5T A;  4RK9 A;  3MVY A;  3KSJ A;  1O63 A;  5BR8 E;  1NKX A;  2PT1 A;  3TCG A;  1NH7 A;  1ZAA C;  2DYX A;  5A2Q C;  2DVC A;  3E9X A;  5LOM A;  2VD3 A;  2XXV A;  1QU6 A;  4U22 A;  4HE0 A;  4LFC E;  2OK2 A;  2L2N A;  3I3V A;  3U72 A;  2EOH A;  4ELP A;  3OD7 A;  2ENC A;  2E1M A;  2B4M A;  2EOI A;  2WBB A;  2XHD A;  3MYU A;  1FBC A;  3IOW A;  4PFR A;  2VF1 A;  3HPI A;  2B7V A;  1NNK A;  4OYV A;  3VLU A;  4R75 A;  2EPU A;  3LSF B;  1SBP A;  3KFM A;  3MZ1 A;  3C4T A;  4I8O A;  5IKB A;  5JEI A;  5EYG A;  4R9G A;  2L3C A;  3EF7 A;  4QSE A;  3RNN A;  2VPN A;  4ECF A;  4BS9 A;  3IX1 A;  4DE8 A;  3TDJ A;  4MAG A;  3KC0 A;  2DMI A;  1JP4 A;  4DXB A;  4GLI A;  2VHA A;  2MKZ A;  2L2M A;  4THI A;  1WHN A;  4ZED A;  2QMX A;  3A3U A;  3OOA A;  2KLF A;  1IXG A;  1XMO E;  4GWU A;  4R03 A;  2HPG A;  5KZT A;  2EM3 A;  1T0K A;  3PUW E;  1N3W A;  1BBO A;  1NV5 A;  4QSC A;  4F6N A;  2PVU A;  4LVQ A;  1DMB A;  3VXB A;  3IK6 B;  3MZ9 A;  1Y1Z A;  3K6W A;  1ZIU A;  2EOQ A;  2Q89 A;  1LB9 A;  3FZV A;  3W15 C;  2MDG A;  4PAK A;  4P78 A;  4LAT A;  2CZH A;  2R9J A;  2DMY A;  2XXI A;  4YU0 A;  1UHZ A;  3T66 A;  3KSX A;  4OQO A;  4GOT A;  3PD9 A;  4R2F A;  2I4B A;  3FJG A;  4K0K E;  3ILT B;  2K7I A;  3UA8 A;  2EMG A;  4MF3 A;  1NNF A;  1SI0 A;  1VDW A;  1MXX A;  2WCC 3;  3RPL B;  2MKN A;  4O8M A;  1MH3 A;  3FJ7 A;  3UOR A;  5ET6 A;  2EMY A;  3OO8 A;  1T39 A;  4ND9 A;  4OVS A;  4I3Y A;  3VV5 A;  2XXH A;  3B8B A;  3MP8 A;  2HZL A;  3HV1 A;  3J7A G;  1ANF A;  2Y7K A;  1D3K A;  2ONK E;  3LV0 A;  2UXA A;  2REJ A;  5F1Q A;  1LLM C;  1INP A;  3U65 A;  4O4K A;  1YSA C;  1B69 A;  2EN8 A;  1JK2 A;  4BDN A;  2PCR A;  3SEU A;  2REG A;  5H8H B;  4KYD A;  1K9Z A;  3PD8 A;  1GTK A;  4YZZ A;  2O7U A;  3QK6 A;  1FW0 A;  3AV0 A;  1QKA A;  4JYA E;  2CZK A;  1BP5 A;  2UVH A;  1N7W A;  2HGH A;  4NF6 A;  4NHR A;  3JZJ A;  4WKM A;  1Z7M E;  3AUZ A;  4I3E A;  3C6M A;  4GX6 A;  5H8H A;  3K6X A;  1BB8 A;  4IY6 A;  1A1I A;  3RN8 A;  4WXD A;  4HCY A;  4I40 A;  3D4G A;  4DI3 D;  3M3L A;  3ADI A;  1UTH B;  2H25 A;  3LR1 A;  3CFZ A;  5DEX A;  2YTG A;  2QPQ A;  4G8N A;  2RPC A;  4GKJ E;  2MC5 A;  2B4L A;  3GBA A;  1X5W A;  1VSO A;  1SW2 A;  2CMO A;  5CBS A;  3O29 A;  3J81 C;  4KWY A;  1Y3N A;  1GQE A;  5I56 A;  2FGG A;  4R74 A;  1NUX A;  4XEQ A;  2F5X A;  1LFI A;  2K4V A;  1NUZ A;  4N07 A;  3KOT A;  5A6A A;  1OIB A;  4N17 A;  2QFL A;  4U21 A;  2L92 A;  3U1O A;  4R2C A;  4B3S E;  1I6B A;  4U2R A;  1QVS A;  1UTB A;  4NTL A;  2EOX A;  2FBP A;  4JI1 E;  2NOO A;  2OWZ A;  3KN8 A;  3N26 A;  1T38 A;  5H8Q B;  2ZYK A;  1URG A;  1A54 A;  1S9T A;  3VLW A;  3D4C A;  2O1L A;  2XXU A;  2XXK A;  2B65 A;  1FBH A;  3A3C A;  3VYY A;  2LRS A;  1Y20 A;  3E78 A;  1LCF A;  3MVW A;  1P47 A;  4RH8 A;  3HHF A;  2ELY A;  3L00 A;  2WBD A;  1LFH A;  2UVI A;  3JU0 A;  2WKY A;  3DP6 A;  4IS1 C;  4LF7 E;  1XS5 A;  5DW8 A;  5IAI A;  3MW0 A;  1LST A;  4O3B A;  4R2P A;  1TF3 A;  5FHO A;  2XX7 A;  2WYP A;  1KZ8 A;  1SQY A;  2YU5 A;  1X49 A;  3K6U A;  5IZ3 A;  3HHG A;  3RT6 B;  5KCJ A;  5I59 B;  4R2Q A;  4DLD A;  4F2O A;  3MVZ A;  3K0V A;  2EN1 A;  1YYZ A;  2F7C A;  1BLF A;  2ZYN A;  2BJJ X;  2GFE A;  2O7I A;  1EYJ A;  1M5F A;  1WRJ A;  2ZM6 E;  4XKR A;  1OMP A;  4QFL A;  5I58 B;  1YUI A;  3J7Y p;  3RGY A;  3G3J A;  2KR0 A;  3PMX A;  2XXY A;  1P1O A;  2ONS A;  1NEI A;  4H6D A;  4BDO A;  1YFH A;  4NF5 A;  2EN6 A;  4OHN A;  1HR0 E;  2Q2C A;  3BGH A;  1IBK E;  2N8X A;  1ZLQ A;  3JV9 A;  4FED A;  4RPN A;  2YSP A;  2HC5 A;  3MP6 A;  5TPA B;  4OET A;  1LAX A;  1A1K A;  2B3T B;  3MBP A;  3ADL A;  2I6E A;  3T9H B;  1TF6 A;  3L6G A;  2EQ1 A;  4WPY A;  3EPE A;  2GHA A;  4F1Y A;  1R6Z A;  4HW8 A;  4ELR A;  4ZZA A;  1DQ3 A;  4DR7 E;  1MPB A;  2UYF A;  3FVN A;  3H03 A;  4Q0C A;  3S9N C;  3TOD A;  3IAZ A;  2F3B A;  4HEI A;  2H5Y A;  1ZJL A;  3HO7 A;  5I7I A;  1B5I A;  2L2K B;  4EUO A;  5ITO A;  3TUS A;  3CRB A;  5KDT A;  2UUA E;  2I3V A;  2V88 A;  4MNP A;  4G68 B;  1G0H A;  2UUB E;  5JK4 A;  3KZG A;  1FTK A;  3G7W A;  4QBA A;  1B7H A;  3H3G A;  2DWI A;  4LTY A;  1Q35 A;  4LQ2 A;  1L5T A;  1GV8 A;  4EQ9 A;  3CR9 A;  1QUK A;  3I6V A;  4BDM A;  1LGB C;  2DVZ A;  3O66 A;  1N04 A;  3VLV A;  3RT8 A;  4LF8 E;  3TPA A;  1LB8 A;  4GRK A;  2F4V E;  1FPJ A;  4YKP A;  4KQP A;  2L3J A;  4G68 C;  4POW A;  4N91 A;  2I0B A;  3ROJ A;  2YRK A;  1A1F A;  4PQJ A;  2JVA A;  2HAV A;  1G2D C;  1AAY A;  1SR9 A;  4NG7 A;  3KGC A;  4YMA A;  4BC7 A;  2QVR A;  3ILU B;  1XNQ E;  2P2A A;  4U4S A;  3CFL A;  5FLX C;  4KFQ A;  4WXC A;  1FQA A;  3FJM A;  1YXI A;  4U23 A;  1YAE A;  5IM2 A;  3BID A;  2M4I A;  4JWY A;  2EOE A;  1B4H A;  1LBB A;  5I2N B;  5A6B A;  4RY1 A;  3VDF A;  4ISU A;  1FTA A;  3TQW A;  3DP4 A;  2PT2 A;  3ODB A;  5EHM A;  1TFD A;  3IOU A;  2EPZ A;  3H4Z A;  1P1Q A;  3GYY A;  2N3H A;  3HST A;  2LE2 A;  2L5V A;  3LBS A;  3SDF A;  3ISP A;  5IZZ A;  1BBG A;  2F36 A;  3MP1 A;  4DMI A;  1SVX B;  4N6K A;  4OZ9 A;  1QUI A;  5CMM A;  4RHB B;  1G2F C;  3N6U A;  4H8J A;  4EF1 A;  2FIX A;  4R2S A;  3DJW A;  1IMF A;  1LAF E;  1PJT A;  2LJH A;  3C9H A;  4GZN C;  1ZU0 A;  3OSQ A;  5B7D A;  4M30 A;  3H7M A;  4GX4 A;  2NA2 A;  4DIG A;  3TQL A;  5LDZ A;  2JYA A;  2LAO A;  3TCF A;  4PTK A;  1IIT A;  4H8I A;  1FPK A;  1BKA A;  3OTO E;  1O64 A;  4PET A;  4F3S A;  1OVT A;  4HCW A;  4DR4 E;  4G8M A;  2EOJ A;  1NV1 A;  5DYH A;  5KL5 A;  3FUZ A;  2OWT A;  4ZYE A;  2IEE A;  3IFC A;  4B3M E;  5TPA A;  2Y7W A;  4GVO A;  1MQG A;  2EPR A;  4TLL B;  2V84 A;  1O0W A;  2THI A;  4GWS A;  4HE1 A;  4QRZ A;  4G2Z A;  4MX6 A;  4DXU A;  3HN0 A;  1DGC A;  4OXV A;  2EM2 A;  1OLA A;  1HNZ E;  4DR5 E;  4I8C A;  5CMB A;  2EMC A;  3NOH A;  1N36 E;  4N15 A;  2PRT A;  3MHS C;  2UVJ A;  3V89 B;  2UU9 E;  5CC2 A;  3FVG A;  2EM9 A;  5H8F B;  2DOJ A;  4P1L A;  3M3K A;  1MY1 A;  3MST A;  1J26 A;  4P8B A;  3U92 A;  4JSO A;  2Z22 A;  1WJP A;  4YIC A;  4OFJ A;  3O6H A;  2DWA A;  2Q9T A;  4G77 A;  3F6H A;  4RNS A;  3OXN A;  2FVZ A;  3CSB A;  5AA2 D;  1HSE A;  5I58 A;  3H09 A;  4IY5 A;  3PV0 E;  4MIJ A;  4OVR A;  1L4S A;  2EPX A;  1WDN A;  5TSE A;  3IJX B;  2OCU A;  3J80 C;  1M5B A;  4ZYG A;  4PFY A;  1YPN A;  4RYA A;  2ELZ A;  2OBG A;  1FQF A;  4YY3 E;  4N6P A;  3SET A;  4XF5 A;  5AA4 B;  3SZP A;  4H67 A;  1LEV A;  1SI1 A;  1LFG A;  2VP1 A;  1Y4T A;  3H6U A;  2EWL A;  5KL7 A;  2ZNU A;  4MNI A;  2EN2 A;  5CBR A;  4IGR A;  5EQ7 A;  4F18 A;  3LML A;  5KL6 A;  2QL3 A;  4WEP A;  4JV5 E;  4BLA A;  2JXP A;  3VVF A;  5IT9 C;  3QSL A;  4F3P A;  3PPN A;  4WYQ B;  4JI2 E;  4DR1 E;  4NF8 A;  1SDX A;  5A6B D;  3LUZ A;  3MVX A;  1GVC A;  3U93 A;  3TFL A;  1N34 E;  5ITP A;  1B05 A;  2V8Q B;  1LBV A;  3B6W A;  1ZKB A;  1MXZ A;  4JVI A;  1B9J A;  1EU8 A;  1AL3 A;  3VVD A;  4F22 A;  1CB6 A;  4F1V A;  1DPP A;  2EPP A;  1XOC A;  1B32 A;  3T1Y E;  3UK3 C;  3TEP A;  1AMF A;  2HHH E;  2LV2 A;  2H4I A;  4FBP A;  2EOO A;  2CZI A;  3VXC A;  4PFB A;  3A29 A;  1IIW A;  2O6A A;  2D5W A;  1ELJ A;  1FBD A;  2RCB A;  4E0W A;  4X66 E;  4BCA A;  4BHC A;  4M2Z A;  4KHP E;  3ZS6 A;  1QKB A;  2E0S A;  3EPL A;  4AB6 A;  2LBS B;  4F1U A;  2JOB A;  2CT1 A;  3FBP A;  3BBR A;  3P7I A;  3K1M A;  4ZDM A;  4L5N C;  4XFE A;  5AA2 A;  3TQM A;  1SW4 A;  3THI A;  1QGX A;  3N94 A;  1A99 A;  1KYQ A;  4DR2 E;  2NUE A;  2QS3 A;  5TP9 A;  3LUY A;  3Q28 A;  4JVD A;  4J8Z A;  4PBQ A;  5AE4 A;  2WZO A;  2EN3 A;  1SPI A;  1UIU A;  2AIX A;  3JYR A;  2JWO A;  5ET7 A;  3HTX A;  3HCQ A;  2XA5 A;  3K1P A;  2YRH A;  5J16 A;  2BBG A;  4JDF A;  4L17 A;  2HZK A;  2J7J A;  2XXQ A;  1Y3P A;  2EMF A;  1MDQ A;  2V25 A;  2P1S A;  4DCX A;  3FV1 A;  4PE5 B;  3QIM A;  1MQI A;  2I49 A;  3ECR A;  5BWJ A;  1OLC A;  3C35 A;  4EDP A;  3K6V A;  4P9K A;  1B0L A;  1FQE A;  1H44 A;  1MM6 A;  2V3T A;  2DSF A;  4P0G A;  4TQU Q;  3EPK A;  1B7U A;  2ZYO A;  5CMK A;  4Q30 B;  5JTY A;  1POT A;  2JOX A;  4O24 A;  4Z7E A;  4N81 A;  2AL5 A;  1ATG A;  3EHU A;  3ONM A;  1B58 A;  5I5P A;  2WEF A;  5FHN A;  3CG1 A;  1NI9 A;  3T9V A;  1A8E A;  1UIL A;  1D9Y A;  3ZKL A;  2G93 A;  4IO4 A;  4JI6 E;  3ZOQ B;  1A1L A;  3PUX E;  1FBF A;  5EQA A;  2Y7R A;  3CFX A;  1R1N A;  5H8N B;  4IJD A;  1JEU A;  4F29 A;  2YTN A;  4JWX A;  2DLQ A;  2EMA A;  3K2D A;  3RTF B;  3PGF A;  2ZNT A;  3DEL B;  4GBW A;  1I6Q A;  5AE1 A;  4FE8 A;  1A1H A;  2G29 A;  4I9D A;  2EOZ A;  3SEX A;  2I13 A;  1B3E A;  1SW1 A;  1MY4 A;  2RSM A;  1FRP A;  5AE3 A;  1IZ1 A;  1ZBQ A;  4DV5 E;  2Q74 A;  4ELQ A;  1XVX A;  4FOR A;  4ZYH A;  3TAJ A;  4GXS B;  1TFA A;  2OLB A;  3C34 A;  3USD A;  3FXB A;  2Y84 A;  2H9B A;  4M0V A;  4AS4 A;  5I84 A;  1IUD A;  2EMB A;  1T4L B;  4IB2 A;  3EHS A;  2O51 A;  3V5A A;  2DGC A;  1B4Z A;  4F31 B;  3PPQ A;  1MQJ A;  2EPK X;  1NFT A;  2XX9 A;  3Q29 A;  3IOV A;  4F19 A;  2A25 A;  3S9L C;  2Q2A A;  4NAP A;  3HXL A;  1H43 A;  3UK4 A;  2EMX A;  4P47 A;  4NN3 A;  4R8O A;  4QXD A;  3AXF A;  3F6G A;  4GEQ B;  3QAX A;  3S9M C;  2F78 A;  2V86 A;  4I1D A;  4R2R A;  1XC1 A;  2ABH A;  4P3L A;  1DPE A;  1EH6 A;  1N3X A;  2EPC A;  1UTB B;  3BFT A;  5AC4 A;  3A09 A;  5KL4 A;  2H98 A;  1X6F A;  2PYY A;  1A1J A;  3S2V A;  1IXC A;  4R2B A;  1Q9D A;  4ONY A;  1MG1 A;  4OVP A;  5EQ8 A;  1Y3Q A;  1IQ7 A;  3OMB A;  3IJO B;  1JVX A;  4YKI A;  1RYO A;  4R9F A;  4TOZ A;  1EH7 A;  2OJT A;  2R71 A;  1MS7 A;  2WBT A;  4DUY E;  1FTJ A;  1PC3 A;  4LON B;  3BIH A;  2Q8U A;  1XI6 A;  2VQE E;  2DIX A;  1Y4C A;  2FA7 A;  5EYF A;  3MPL A;  3HPZ A;  4MEV A;  4O7M A;  5DEX B;  4PF8 A;  3F11 A;  4OER A;  4PGN A;  1X6H A;  4O5G A;  2M9A A;  5A69 A;  4DV7 E;  2Z8D A;  3H6T A;  4GFR A;  1B5J A;  3RY3 A;  4QFN A;  3UGW A;  4NX1 A;  2WX9 A;  2EMZ A;  2EOM A;  3WAF A;  4GWZ A;  4NF4 A;  1MPC A;  1NUY A;  2FV4 B;  2ENA A;  4WSG A;  4ZEK A;  2M1S A;  4F2Q A;  4POX A;  1EKZ A;  3K02 A;  4ZEI A;  2EL5 A;  1XNR E;  4ZE9 A;  3DF6 A;  1KJK A;  4JI5 E;  2QRY A;  4C1T A;  1FQD A;  1B1X A;  3TTL A;  4KYS A;  2RIN A;  1IMU A;  4QHQ A;  4PFI A;  2V89 A;  4X64 E;  4GD5 A;  4NE4 A;  3KN7 A;  5LMU E;  1B0H A;  4PFW A;  1NUW A;  2YTI A;  3GBB A;  3EPH A;  3PTY A;  1FQB A;  4H1X A;  2O84 X;  4ESX A;  2PMS A;  1IMD A;  1PJS A;  4NMY A;  2F8D A;  2NUG A;  1OVB A;  1JNF A;  1FPE A;  4X48 A;  2JP9 A;  1NV7 A;  5FBP A;  2V93 A;  1VFE A;  3DP8 A;  4BHB A;  4DZ1 A;  4G68 A;  2H99 A;  4NED A;  3GXA A;  2YU8 A;  4RA1 A;  3VE1 B;  1IMA A;  5DTB A;  1FPL A;  4JWO A;  4RJZ A;  2UYE A;  2F7A A;  4DV6 E;  3MUQ A;  1EH8 A;  3D1R A;  4GL0 A;  1A7L A;  2Z8E A;  4KXP A;  2F35 A;  3E3K A;  4P1E A;  3SEY A;  3LSX A;  3IFA A;  4GX3 A;  5FHM A;  2DQV A;  4OAN A;  1KA0 A;  1H3D A;  3M99 B;  1FJG E;  3C6K A;  4EXK A;  2DWJ A;  3OEL A;  1H45 A;  4B3R E;  4IGT A;  1VR5 A;  2VRD A;  1HSJ A;  3TKD A;  4LFB E;  4N13 A;  5CMC A;  1NV2 A;  2QVU A;  4GF8 A;  1PB8 A;  4F6M A;  1M5D A;  2I0C A;  2UXC E;  2A5T A;  2VPO A;  3FAT A;  4JSD A;  3SEW A;  4X9J A;  2AL4 A;  1ZMG A;  2LTS A;  1B51 A;  2EPL X;  1O7T A;  2LCE A;  1GR2 A;  2XWV A;  4P7D A;  2F7B A;  4AB5 A;  3IO4 A;  5L9O A;  3T93 B;  1KWH A;  3IR1 A;  2EZ6 A;  5A5X A;  5M2V A;  4WFT A;  3JAM C;  3KN3 A;  4YKK A;  3MC2 A;  3RUM A;  2GHB A;  4RPO A;  1AH5 A;  1N76 A;  4KCC A;  4DKK A;  3MJN A;  5H8N A;  1DSN A;  3TMG A;  1FBE A;  3T9U A;  2Q88 A;  4DI4 B;  4ELO A;  2GPI A;  2FIE A;  3PPO A;  4KHZ E;  4OEV A;  1BTJ A;  1CE2 A;  2DXR A;  2FHY A;  1PKP A;  1HNW E;  2EOS A;  1LBX A;  4JI8 E;  1JK1 A;  2E1S A;  3DM0 A;  4AQ4 A;  2BJI A;  2RS6 A;  1YYW A;  1URD A;  2NWJ A;  3FIG A;  1B46 A;  4FEC A;  2DP8 A;  3B50 A;  4TUI A;  2ANJ A;  1PB7 A;  5I57 B;  1IQS A;  4PCD A;  2R8T A;  4R2D A;  3U94 A;  2XD3 A;  1MXY A;  2F8B A;  4ZEC A;  4XIG Q;  1YYK A;  2GH9 A;  3R7X A;  4MH5 A;  1GGG A;  5AAS A;  4GKK E;  1NNP A;  2YTQ A;  4OA4 A;  3Q25 A;  5EQ9 A;  3PUY E;  2EM4 A;  5L9S A;  2VGQ A;  1TT1 A;  1M5E A;  4OFO A;  3OO9 A;  3BKI B;  2DXY A;  1IMC A;  4C0R A;  3E13 X;  3RPW A;  2IHR 1;  3G3F A;  3W9W A;  1VFD A;  5AA3 A;  2OWS A;  2XXT A;  1IME A;  4YB5 A;  5AA2 B;  5HPQ A;  4LZ5 A;  1N7X A;  4JBZ A;  2YWQ A;  2UVG A;  2I48 A;  1Q1K A;  5J1D A;  1ZR9 A;  3T22 A;  2EMH A;  3VK6 A;  4OOG C;  5ICT A;  3T96 B;  3K1N A;  3FAS A;  3SKP A;  1XHY A;  4ZZE A;  2V4C A;  4DV3 E;  4X65 E;  4BC9 A;  1QUL A;  1NV0 A;  2NUV A;  2R6G E;  1N32 E;  3BIG A;  3B6T A;  1J5E E;  4LP2 B;  2CSH A;  2GRV A;  5B70 A;  1YTV A;  1NV3 A;  3VYX A;  3FXU A;  4KPT A;  1PBQ A;  1DTG A;  2JJK A;  1FPD A;  2EQ3 A;  4NF6 B;  2EM0 A;  4O43 A;  3FV2 A;  4XKN A;  4GBV A;  4JI0 E;  1Y1M A;  3G3I A;  3UP9 A;  2IA4 A;  3B7D A;  2BB8 A;  1LAG E;  2ZZX A;  2LO3 A;  4F9B B;  5ISU A;  2YRM A;  5AC5 A;  1JW4 A;  1USY H;  4O3C A;  1IXH A;  2EMK A;  2R1F A;  4P56 A;  1P99 A;  5JTY B;  1LBC A;  2UUC E;  3FXR A;  4PAF A;  3UIF A;  1SFE A;  4JI7 E;  4XKQ A;  2DDK A;  4FEB A;  3MSW A;  5IXM B;  3O2A A;  2YTO A;  1POY 1;  4O3A A;  3KEI A;  4KYE A;  4UAB A;  5I3S A;  2DE4 A;  2QMW A;  4F54 A;  1B7Z A;  2DS9 A;  2KHX A;  5AA1 A;  4NWD A;  4MNC A;  4YHH E;  2LUP B;  4BDL A;  4KD5 A;  5A5X B;  4BBY A;  1XVY A;  4ZS9 A;  2RS7 A;  3IOR A;  2HHM A;  4NF0 A;  4ZEF A;  3PMV A;  2WYK A;  4NHB A;  1N0T A;  3C4B A;  1IBL E;  1BIY A;  3TZA A;  5ELV A;  4N4R B;  2Y7I A;  2V85 A;  5LLQ A;  2QS4 A;  4QF9 A;  4IO2 A;  2EPA A;  1USY E;  4IO5 A;  3EQ1 A;  4LU9 A;  3OEN A;  2MC6 A;  1NCS A;  4EXL A;  1K9Y A;  1FBP A;  1F9B A;  4QFK A;  2RC7 A;  2UXB E;  2EPO A;  4LF9 E;  4X8W A;  2YTE A;  1S7Y A;  1TWY A;  1KA1 A;  3KBZ A;  2V87 A;  2LMZ A;  1URS A;  5KL2 A;  5KL3 A;  1MXV A;  3O97 A;  1NH8 A;  2ONR A;  1T4O A;  1MXW A;  3IO6 A;  4IO3 A;  2FYI A;  4U1O A;  2ZNS A;  3H6V A;  2DLK A;  1YCJ A;  1RC7 A;  2B7T A;  3RLF E;  2XXW A;  4AS5 A;  4OTE A;  2F6P A;  3T9X B;  4MHF A;  4U1Z A;  1QJM A;  1NMU A;  4YB6 A;  4H0W A;  1B40 A;  2EM6 A;  1DK4 A;  4LUB A;  1IMB A;  5H8F A;  1JEV A;  3QUJ A;  3KJT A;  3C33 A;  1FTL A;  1X3C A;  1MH4 A;  4JXI A;  3HFU A;  3T1B A;  2HJJ A;  1MY3 A;  1I69 A;  5ET5 A;  3IOT A;  4R6H A;  3EHT A;  5ESY A;  1CNQ A;  2I9I A;  2HFB A;  1B52 A;  4KCD A;  2EL4 A;  4F3B A;  1MDP 1;  2O68 A;  2I4C A;  3TYH A;  1PDA A;  5LTC A;  2X7P A;  4NWC A;  4X1D A;  1LBZ A;  3T0J A;  1RQ0 A;  2M8C A;  4NZV A;  5H8S A;  2YLN A;  4ZEB A;  4LF6 E;  2CTD A;  2RQL A;  3LSL A;  4E0X A;  4R2E A;  2FTX B;  4N6D A;  2CEX A;  5I59 A;  2OX3 A;  1PJQ A;  4LF4 E;  2B3B A;  3O6I A;  3OO6 A;  4PBH A;  2EM5 A;  2UXD E;  2PX1 A;  4X8R A;  1TXF A;  1OQG A;  2F6G A;  5K2Y A;  3K4U A;  5TU0 A;  3UN6 A;  3C31 A;  4I62 A;  1P1N A;  3KOS A;  1QUJ A;  2EM7 A;  4Q28 A;  3IWD A;  4JB7 A;  4YKJ A;  2PBW A;  3FGS A;  3FIR A;  4OVJ A;  1FTO A;  2CEY A;  4FAT A;  3MAM A;  1FJ6 A;  3PPP A;  2RCA A;  3V8X B;  2GHF A;  2DB2 A;  1JW1 A;  4PE3 A;  2F97 A;  1SD3 A;  1UQW A;  3CHG A;  3K6Q A;  4HS7 A;  5I57 A;  3KZY A;  4YAH X;  3SER A;  4G8H A;  3V83 A;  2ZZW A;  2XWK A;  1LAH E;  1RYX A;  4L8N A;  1FPF A;  3R6U A;  3N6T A;  3IB0 A;  2XXP A;  2NXO A;  4WED A;  3LC8 A;  4OEN A;  2YJP A;  4Z0I A;  2F3D A;  2EQ0 A;  4NXM E;  3FVK A;  2ZYM A;  3OEK A;  4JVC A;  3H6W A;  1AOV A;  5KDT B;  3ADJ A;  1MQH A;  1R9Q A;  5F7V A;  5DVJ A;  4P11 A;  1EH3 A;  1EZP A;  2LUQ A;  3TTK A;  4YB7 A;  4C1U A;  1QNT A;  3QXM A;  2HXW A;  2B9D A;  1RDZ A;  4UAC A;  2P3V A;  3T1H E;  1B3H A;  1DOT A;  1LCT A;  1YYO A;  2DE2 A;  4IO6 A;  4F2J C;  1ZBT A;  3M8U A;  2EJ4 A;  5DVI A;  4XXU A;  1DTZ A;  4ZYD A;  2ESN A;  4NXN E;  1B3F A;  4UA8 A;  2EOR A;  2NVU B;  3KG2 A;  1XMQ E;  5ET8 A;  1FPG A;  4FAJ A;  4LZ7 A;  2HCA A;  4FK5 C;  3QUF A;  3THO B;  2X7Q A;  3C32 A;  5KCJ B;  2WBS A;  4KR5 A;  1Z7N E;  3R26 A;  2YTJ A;  5K2X A;  3ADG A;  4OES A;  3CI8 A;  5I2K A;  1A8F A;  4X04 A;  2I3W A;  1DCU A;  2VT5 A;  4FIM A;  4NF8 B;  3ZSF A;  2EOY A;  3C4M A;  1MM7 A;  3O6G A;  2ODR D;  1P1U A;  3CG3 A;  2LJU A;  4TUG A;  4EQ7 A;  1YZ0 A;  3GLB A;  4MJO A;  1ZBM A;  1FPI A;  1G0I A;  3IWB A;  3L6H A;  1I6A A;  1RDX A;  5FTH A;  3IB1 A;  2VQF E;  3OO7 A;  3RMP A;  3K01 A;  2EML A;  2I58 A;  4BMJ A;  4F39 A;  5AA4 A;  1WOD A;  1B3L A;  2XWI A;  2Y5L A;  4QSD A;  3EPJ A;  2KON A;  4R72 A;  1SW5 A;  1FPB A;  2YTF A;  2NUF A;  1DBZ A;  1B1H A;  1H76 A;  1R9L A;  1Y9U A;  2EPN A;  4G4P A;  2VD2 A;  5EYH A;  4N4U A;  2P3N A;  3U8Q A;  3TTM A;  2YT4 A;  1WHQ A;  3FXQ A;  5AE2 A;  2L6M A;  4XKP A;  2Q8J A;  5ADZ A;  2Z8F A;  1JW5 A;  3CIJ A;  1MRP A;  4LA9 A;  1RKM A;  5I56 B;  3IL1 B;  2MKD A;  4R2A A;  5A5L A;  1ZTY A;  3G3G A;  4H5F A;  1B3G A;  5FTI A;  1MQD A;  4H46 A;  4R6K A;  4OX9 E;  1US5 A;  1EZO A;  4DR3 E;  3EKI A;  4Q8R A;  2KQZ A;  2Z23 A;  2EE8 A;  2ENH A;  4AQY E;  4PF6 A;  4TLM B;  1YUJ A;  2W7Y A;  4BDR A;  3THN A;  4EF2 A;  2GLI A;  1IEJ A;  1IXI A;  2R76 A;  2CPN A;  3MPK A;  2ALU A;  2ODR C;  3BBG A;  4GWW A;  1BK4 A;  5T3J A;  4LN5 A;  3B6Q A;  5IZ1 A;  2V3U A;  3RTW B;  3PMW A;  1MY2 A;  2LTR A;  3PPR A;  5LMN E;  1WVJ A;  2HEU A;  3IB2 A;  4WX9 A;  3E79 A;  4MLQ A;  2ADR A;  3FVO A;  4DUZ E;  2EN4 A;  2QS1 A;  2HXR A;  2KOU A;  2RC8 A;  3DLN A;  4JI4 E;  4R6Y A;  1Z1B A;  3N5L A;  5L9M A;  2EMI A;  4PDH A;  2ZZV A;  2JY9 A;  2D3I A;  1F2I G;  3E4R A;  3JTZ A;  3OSR A;  4X1B A;  2O1M A;  2CZL A;  3CVG A;  2F34 A;  4MMP A;  1PEB A;  4X9T A;  2MDR A;  4DXC A;  4DV1 E;  2YSO A;  4HE2 A;  2OZZ A;  5CRY A;  1D4N A;  2D9H A;  4OVQ A;  3TTN A;  1PBP A;  2H36 X;  1UTH A;  2HAU A;  4O94 A;  4P0I A;  1LLS A;  3GZG A;  2EOF A;  3QMF A;  1EZ9 A;  2RTX A;  3OML A;  4GWY A;  4NGU A;  1M5C A;  3KC1 A;  3TCH A;  4KZS A;  1IBM E;  5DVF A;  1LBW A;  2EL6 A;  2M7Q A;  5LL6 R;  3S9E A;  3KBR A;  1NV6 A;  5H8Q A;  3BFU A;  2A5S A;  4XTC Q;  5F3W A;  2Y5K A;  2V83 A;  3G3H A;  1SYI A;  4FJP A;  4F3G A;  2GQ1 A;  4H45 A;  2N3G A;  4HTG A;  1B6H A;  2E72 A;  1P1W A;  4OWD A;  3FD3 A;  1A1G A;  2VE7 C;  1A55 A;  4GWO A;  2P0S A;  1RMD A;  2ZMB A;  5L8D A;  4RK2 A;  4PFT A;  4OEU A;  3S4U A;  1DI2 A;  1HSL A;  4OVT A;  2X26 A;  1X6E A;  2RSI A;  2JR1 A;  1AWB A;  2QJE A;  2NAB A;  1FJ9 A;  4H65 A;  4LQ5 A;  3WAE A;  3ZKK A;  1N84 A;  4MCO A;  4KI0 E;  1HNX E;  3MZB A;  4DCY A;  5T6J A;  4F9C B;  3PU5 A;  1MPD A;  1XT8 A;  1MGT A;  4IR8 A;  1AIV A;  4GIZ A;  3MWB A;  2DE3 A;  3O9P A;  4M1V A;  2AYS A;  4IO7 A;  4K3F A;  1WXR A;  4MBP A;  2YTP A;  4DV2 E;  4BDQ A;  1D9V A;  1TN9 A;  5EHS A;  5IZ3 B;  5IWA E;  3PUZ E;  3P1X A;  1MEY C;  5HM4 B;  3KZZ A;  1NV4 A;  5F24 A;  2L8T A;  3I5O A;  3CSG A;  5ICQ A;  1MY0 A;  5TP9 B;  4JI3 E;  4GL8 A;  1NL5 A;  1EYK A;  4QFP A;  1N3G A;  4QFO A;  1T4N A;  4MFI A;  2WBU A;  2FNC A;  4H5G A;  3KJ7 A;  4LZ8 A;  5IV8 B;  1MXU A;  3MQ9 A;  1GZ6 A;  1PB9 A;  1LBY A;  4G61 A;  1D9Q A; 
#chains in the Genus database with same CATH homology
 3T9H B;  3L6G A;  4GQO A;  4F19 A;  3S9L C;  1MH4 A;  4JXI A;  2Q2A A;  1MY3 A;  1I69 A;  2RF1 A;  3O28 A;  3SEV A;  2XXR A;  3RQT A;  2YPN A;  3VVE A;  3EPE A;  3IOT A;  4R6H A;  3EHT A;  2GHA A;  4F1Y A;  1R6Z A;  2HFB A;  1H43 A;  4HW8 A;  1B52 A;  4ELR A;  4ZZA A;  4PP0 A;  4KCD A;  3UK4 A;  5I2N A;  2A5T B;  1MPB A;  2UYF A;  3FVN A;  3H03 A;  1JET A;  3AXF A;  4Q0C A;  3IAZ A;  4R9G A;  3TOD A;  2H5Y A;  3S9N C;  3QAX A;  1ZJL A;  3S9M C;  2F78 A;  1MDP 1;  3HO7 A;  4F3B A;  2O68 A;  3TEL A;  2I4C A;  3TYH A;  4I1D A;  1PDA A;  1B5I A;  1XC1 A;  2RC9 A;  2ABH A;  3OEM A;  4EUO A;  1DPE A;  5HBC A;  1N3X A;  2X7P A;  1UTB B;  5ITO A;  4NWC A;  5I2N B;  2B3F A;  3TUS A;  4NF4 B;  1SYH A;  3BFT A;  3CRB A;  3A09 A;  3Q26 A;  2I3V A;  4X1D A;  2H98 A;  5KDT A;  1US4 A;  4G68 B;  1FQC A;  2PYY A;  2M8C A;  3VFJ A;  3W9V A;  5H8S A;  2YLN A;  4ZEB A;  3S2V A;  5JK4 A;  1IXC A;  3KZG A;  4R2B A;  4RXL A;  2D21 A;  1FTK A;  3G7W A;  4ONY A;  5I59 A;  1B7H A;  3H3G A;  4EQB A;  1MG1 A;  2DWI A;  1JQF A;  1Q35 A;  3LSL A;  4LQ2 A;  4E0X A;  1Y3Q A;  1IQ7 A;  2DWH A;  1L5T A;  1GV8 A;  1FCK A;  3C36 A;  4EQ9 A;  2VOZ A;  3CR9 A;  3OMB A;  3IJO B;  1JVX A;  1QUK A;  4NF5 B;  3I6V A;  4YKI A;  1RYO A;  1LGB C;  4R9F A;  4BDM A;  2DVZ A;  3O66 A;  4TOZ A;  2B3B A;  3O6I A;  1N04 A;  2QSX A;  3EN3 A;  2OJT A;  2R71 A;  1MS7 A;  2PX1 A;  3OO6 A;  4PFU A;  3RT8 A;  3VLV A;  3TPA A;  1FTJ A;  1II5 A;  1PC3 A;  4LON B;  1B5H A;  1LB8 A;  4GRK A;  1NNT A;  1OQH A;  2RKM A;  4YKP A;  1Y4C A;  4KQP A;  4ZE8 A;  2FA7 A;  2V3Q A;  5EYF A;  3MPL A;  4G68 C;  4POW A;  1TXF A;  1OQG A;  1QW0 A;  2F6G A;  2XX8 A;  5K2Y A;  2I0B A;  3K4U A;  4OFL A;  4PQJ A;  3C31 A;  5TU0 A;  4I62 A;  3UN6 A;  1A40 A;  1P1N A;  5DEX B;  3KOS A;  2HAV A;  1QUJ A;  3F11 A;  4M4G A;  4OER A;  3KGC A;  1S50 A;  1VE4 A;  4YKJ A;  4JB7 A;  5BUU A;  2PBW A;  2Z8D A;  3FGS A;  3FIR A;  4OVJ A;  3H6T A;  4YMA A;  1FTO A;  1JVY A;  1B5J A;  3ILU B;  4GFR A;  2P2A A;  4QFN A;  3MAM A;  4U4S A;  3CFL A;  3PPP A;  3RY3 A;  2RCA A;  2XXX A;  3UGW A;  3WAF A;  4KFQ A;  3V8X B;  1JW1 A;  4NF4 A;  4YMB A;  5CM6 A;  2F97 A;  1MPC A;  1SD3 A;  1UQW A;  4HS7 A;  5I57 A;  4YAH X;  1FQA A;  1B2H A;  2ZXT A;  4ZEK A;  3SER A;  3FJM A;  4G8H A;  4ESW A;  2XD2 A;  3V83 A;  4U23 A;  4F2Q A;  1YAE A;  1UIV A;  4POX A;  1LAH E;  3K02 A;  4OMB A;  4ZEI A;  4ZE9 A;  3PUV E;  1RYX A;  3SES A;  3R6U A;  4U4X A;  4JWY A;  1B4H A;  2QRY A;  1LBB A;  3IB0 A;  2XXP A;  1FTM A;  2NXO A;  3N6T A;  4MLV A;  4R73 A;  4RY1 A;  3G3K A;  4WED A;  3LC8 A;  4OEN A;  1FQD A;  3VDF A;  4C1T A;  1B1X A;  2YJP A;  4Z0I A;  3TTL A;  2O69 A;  2RIN A;  3FVK A;  3M3F A;  3OEK A;  2ZYM A;  4GXA A;  4ISU A;  4KYS A;  3DP4 A;  3H6W A;  4QHQ A;  3TQW A;  1AOV A;  4GD5 A;  4NE4 A;  5CI5 A;  5KDT B;  3KN7 A;  1MQH A;  1R9Q A;  3QYT A;  2PT2 A;  5F7V A;  3ODB A;  1B0H A;  5EHM A;  3K00 A;  1TFD A;  3IOU A;  5DVJ A;  4PFW A;  3H06 B;  4P11 A;  3H4Z A;  1EH3 A;  3Q27 A;  1P1Q A;  3GBB A;  1EZP A;  3HST A;  5I2K B;  3TTR A;  1FQB A;  4H1X A;  4YB7 A;  3TTK A;  2O84 X;  4C1U A;  3QXM A;  4ESX A;  1J1N A;  2HXW A;  2QS2 A;  3LBS A;  3LSW A;  4UAC A;  2PMS A;  3SDF A;  4NMY A;  5DT6 A;  2F36 A;  2F8D A;  1OVB A;  3MP1 A;  4DDD A;  1SVX B;  1B3H A;  1DOT A;  4OZ9 A;  1LCT A;  1JNF A;  1QUI A;  2DE2 A;  4WXJ A;  4FAT A;  5CMM A;  3N6U A;  4IO6 A;  4X48 A;  2Y7P A;  4H8J A;  4EF1 A;  2V93 A;  3M8U A;  5DVI A;  4XXU A;  1VFE A;  2HQ0 A;  3DP8 A;  4Q5T A;  3MVY A;  4RK9 A;  1DTZ A;  4DZ1 A;  2ESN A;  3KSJ A;  1LAF E;  1O63 A;  4G68 A;  1B3F A;  1NKX A;  2H99 A;  1ZU0 A;  3C9H A;  2PT1 A;  3OSQ A;  4NED A;  4UA8 A;  3GXA A;  5B7D A;  3TCG A;  2NVU B;  1NH7 A;  3H7M A;  3KG2 A;  4RA1 A;  2DYX A;  3VE1 B;  2DVC A;  3E9X A;  5DTB A;  3TEP A;  4DIG A;  4JWO A;  5LOM A;  3TQL A;  4RJZ A;  2UYE A;  2F7A A;  4FAJ A;  2VD3 A;  2XXV A;  3MUQ A;  4LZ7 A;  4U22 A;  2LAO A;  2HCA A;  2OK2 A;  4GL0 A;  3TCF A;  1A7L A;  3QUF A;  2Z8E A;  3I3V A;  2F35 A;  3E3K A;  2X7Q A;  1IIT A;  3SEY A;  3U72 A;  3C32 A;  3LSX A;  4ELP A;  4H8I A;  3OD7 A;  5FHM A;  1BKA A;  5KCJ B;  2DQV A;  2XHD A;  4KR5 A;  1Z7N E;  3R26 A;  3IOW A;  1O64 A;  4PET A;  4F3S A;  1OVT A;  5K2X A;  4OES A;  1H3D A;  3CI8 A;  3HPI A;  1NNK A;  5I2K A;  4HCW A;  4OYV A;  3VLU A;  4R75 A;  1A8F A;  4G8M A;  4EXK A;  2I3W A;  3LSF B;  1SBP A;  3KFM A;  5DYH A;  3MZ1 A;  2DWJ A;  4FIM A;  3OEL A;  4NF8 B;  1H45 A;  5IKB A;  3FUZ A;  2OWT A;  3ZSF A;  2IEE A;  5JEI A;  3C4M A;  5TPA A;  1MM7 A;  3O6G A;  3EF7 A;  4IGT A;  2Y7W A;  1P1U A;  4GVO A;  1MQG A;  1VR5 A;  3CG3 A;  1HSJ A;  3RNN A;  3TKD A;  4TLL B;  4EQ7 A;  2V84 A;  4ECF A;  4N13 A;  2THI A;  5CMC A;  3IX1 A;  4DE8 A;  4GF8 A;  1PB8 A;  5L9S A;  3TDJ A;  4QRZ A;  3GLB A;  1M5D A;  1ZBM A;  4G2Z A;  2I0C A;  4DXB A;  4DXU A;  4GLI A;  2A5T A;  2VHA A;  3FAT A;  4JSD A;  3SEW A;  2AL4 A;  3HN0 A;  4THI A;  1ZMG A;  3L6H A;  4OXV A;  1B51 A;  4ZED A;  1I6A A;  2QMX A;  1O7T A;  1OLA A;  3A3U A;  1GR2 A;  5FTH A;  4I8C A;  2F7B A;  5CMB A;  4AB5 A;  3OOA A;  3IB1 A;  3OO7 A;  2KLF A;  1IXG A;  3K01 A;  3IO4 A;  5L9O A;  2I58 A;  3T93 B;  2UVJ A;  5KZT A;  1T0K A;  3V89 B;  5CC2 A;  3FVG A;  4F39 A;  1KWH A;  5AA4 A;  1WOD A;  3IR1 A;  5H8F B;  3PUW E;  2DOJ A;  4I9D A;  1N3W A;  5A5X A;  1B3L A;  4QSC A;  5M2V A;  3M3K A;  1MY1 A;  2PVU A;  4LVQ A;  4QSD A;  1DMB A;  3KN3 A;  3VXB A;  3IK6 B;  3MC2 A;  4YKK A;  3RUM A;  3U92 A;  3MZ9 A;  1Y1Z A;  3K6W A;  2GHB A;  4JSO A;  4R72 A;  1ZIU A;  2Z22 A;  1SW5 A;  2Q89 A;  4RPO A;  4YIC A;  1AH5 A;  1LB9 A;  1B1H A;  1N76 A;  3FZV A;  4OFJ A;  1H76 A;  1R9L A;  1Y9U A;  4KCC A;  3W15 C;  4G4P A;  2VD2 A;  3O6H A;  3MJN A;  4LAT A;  2DWA A;  3U8Q A;  5H8N A;  2R9J A;  2XXI A;  1DSN A;  3TMG A;  3TTM A;  2Q9T A;  4YU0 A;  3FXQ A;  2Q88 A;  3T66 A;  4G77 A;  3T9U A;  3KSX A;  4ELO A;  4OQO A;  4XKP A;  4GOT A;  2Q8J A;  3PPO A;  3OXN A;  3PD9 A;  4RNS A;  4KHZ E;  4OEV A;  3CSB A;  4R2F A;  5AA2 D;  1HSE A;  2I4B A;  1BTJ A;  3FJG A;  2Z8F A;  1CE2 A;  2DXR A;  1JW5 A;  3CIJ A;  3ILT B;  1MRP A;  3PV0 E;  4IY5 A;  4LA9 A;  3UA8 A;  5I58 A;  1RKM A;  5I56 B;  3IL1 B;  4MF3 A;  1NNF A;  1SI0 A;  1MXX A;  1WDN A;  3IJX B;  2OCU A;  1ZTY A;  3G3G A;  1MH3 A;  3FJ7 A;  1M5B A;  3UOR A;  4PFY A;  1YPN A;  4H5F A;  4QSE A;  4RYA A;  3OO8 A;  2E1S A;  1B3G A;  2OBG A;  3DM0 A;  4ND9 A;  4AQ4 A;  5FTI A;  5H8F A;  1FQF A;  1MQD A;  4N6P A;  4R6K A;  1US5 A;  3SET A;  1URD A;  2XXH A;  2NWJ A;  3VV5 A;  1B46 A;  4Q8R A;  3MP8 A;  5AA4 B;  1EZO A;  2HZL A;  2Z23 A;  3HV1 A;  4H67 A;  4FEC A;  2DP8 A;  1SI1 A;  1ANF A;  1LFG A;  2Y7K A;  2VP1 A;  1D3K A;  1Y4T A;  2ANJ A;  1PB7 A;  2ONK E;  3H6U A;  4TLM B;  2ZNU A;  2W7Y A;  5CBR A;  4IGR A;  2UXA A;  5I57 B;  2REJ A;  5F1Q A;  4F18 A;  2QL3 A;  3U94 A;  2XD3 A;  4WEP A;  4BDR A;  4BLA A;  1MXY A;  4EF2 A;  4ZEC A;  1IEJ A;  4XIG Q;  1IXI A;  4BDN A;  2GH9 A;  3MPK A;  3R7X A;  2ALU A;  4MH5 A;  3VVF A;  1GGG A;  2REG A;  3QSL A;  4KYD A;  3PD8 A;  4YZZ A;  1GTK A;  3PPN A;  5H8H B;  3SEU A;  2O7U A;  3B6Q A;  4F3P A;  2V3U A;  3QK6 A;  1FW0 A;  1NNP A;  3RTW B;  3Q25 A;  3PMW A;  1QKA A;  1MY2 A;  4NF8 A;  3PPR A;  1SDX A;  3PUY E;  1WVJ A;  2HEU A;  2VGQ A;  3IB2 A;  1TT1 A;  3MVX A;  1GVC A;  3TFL A;  3U93 A;  1M5E A;  5ITP A;  1BP5 A;  2UVH A;  1B05 A;  1N7W A;  4OFO A;  4MLQ A;  3B6W A;  1ZKB A;  1MXZ A;  3JZJ A;  3OO9 A;  3BKI B;  3FVO A;  1Z7M E;  1B9J A;  2DXY A;  1EU8 A;  1AL3 A;  4WKM A;  2QS1 A;  3VVD A;  4C0R A;  4F22 A;  3E13 X;  4NF6 A;  3RPW A;  1CB6 A;  4F1V A;  5H8H A;  1DPP A;  3K6X A;  2RC8 A;  1XOC A;  3DLN A;  3G3F A;  4IY6 A;  4R6Y A;  1B32 A;  1VFD A;  3RN8 A;  3W9W A;  3N5L A;  5L9M A;  2OWS A;  2XXT A;  4YB5 A;  5AA3 A;  5AA2 B;  1AMF A;  4HCY A;  3D4G A;  2D3I A;  2H4I A;  5HPQ A;  3VXC A;  3M3L A;  4LZ5 A;  1UTH B;  3E4R A;  1N7X A;  3OSR A;  2H25 A;  3LR1 A;  2UVG A;  4JBZ A;  4X1B A;  3CFZ A;  2O1M A;  1IIW A;  5DEX A;  2CZL A;  2O6A A;  2QPQ A;  2I48 A;  2D5W A;  1ELJ A;  1Q1K A;  3CVG A;  2F34 A;  2RCB A;  4G8N A;  5J1D A;  4E0W A;  3T22 A;  1PEB A;  4X9T A;  5ICT A;  3GBA A;  3K1N A;  3T96 B;  3FAS A;  3SKP A;  4DXC A;  3ZS6 A;  1QKB A;  1XHY A;  2E0S A;  1VSO A;  4ZZE A;  4AB6 A;  2OZZ A;  1SW2 A;  5CRY A;  4F1U A;  2CMO A;  1QUL A;  1D4N A;  2NUV A;  2R6G E;  5CBS A;  3O29 A;  3B6T A;  3BBR A;  3P7I A;  3TTN A;  1PBP A;  2HAU A;  1UTH A;  3K1M A;  4ZDM A;  4LP2 B;  1LLS A;  4P0I A;  3GZG A;  1Y3N A;  2GRV A;  5I56 A;  5AA2 A;  5B70 A;  1YTV A;  1SW4 A;  4R74 A;  1EZ9 A;  3THI A;  3N94 A;  3FXU A;  1A99 A;  1PBQ A;  4KPT A;  2F5X A;  1LFI A;  1DTG A;  2QS3 A;  5TP9 A;  1M5C A;  3LUY A;  3Q28 A;  3TCH A;  4NF6 B;  4N07 A;  5DVF A;  5AE4 A;  3FV2 A;  4XKN A;  1Y1M A;  1UIU A;  3G3I A;  2AIX A;  3KOT A;  3UP9 A;  1OIB A;  2IA4 A;  3JYR A;  4U21 A;  3HCQ A;  3U1O A;  4U2R A;  1I6B A;  3B7D A;  3K1P A;  1QVS A;  1LAG E;  1UTB A;  4NTL A;  3S9E A;  3KBR A;  4JDF A;  4L17 A;  2HZK A;  5ISU A;  2XXQ A;  2NOO A;  5H8Q A;  3BFU A;  1Y3P A;  1JW4 A;  2A5S A;  4XTC Q;  3KN8 A;  1USY H;  3N26 A;  1IXH A;  4O3C A;  5H8Q B;  2ZYK A;  3G3H A;  1MDQ A;  1SYI A;  1P99 A;  1URG A;  2V25 A;  4FJP A;  1A54 A;  1LBC A;  2P1S A;  1S9T A;  5JTY B;  3VLW A;  4F3G A;  4DCX A;  3FXR A;  3FV1 A;  4PE5 B;  3UIF A;  4HTG A;  1B6H A;  1P1W A;  3D4C A;  3QIM A;  4OWD A;  1MQI A;  2I49 A;  3ECR A;  2O1L A;  3FD3 A;  4XKQ A;  2XXU A;  5BWJ A;  1OLC A;  3C35 A;  1A55 A;  4EDP A;  2B65 A;  3K6V A;  4GWO A;  4FEB A;  1B0L A;  1FQE A;  1H44 A;  1MM6 A;  2P0S A;  2V3T A;  2ZMB A;  2DSF A;  3A3C A;  5L8D A;  3O2A A;  4P0G A;  4TQU Q;  4RK2 A;  1B7U A;  4PFT A;  1POY 1;  4OEU A;  3S4U A;  1Y20 A;  2ZYO A;  1LCF A;  1HSL A;  5CMK A;  4O3A A;  3KEI A;  3MVW A;  4KYE A;  1POT A;  4Q30 B;  5JTY A;  2DE4 A;  2QMW A;  1B7Z A;  2X26 A;  4Z7E A;  2DS9 A;  2AL5 A;  1ATG A;  3EHU A;  3ONM A;  1B58 A;  5AA1 A;  4NWD A;  3HHF A;  2QJE A;  5FHN A;  5A5X B;  3CG1 A;  4KD5 A;  4BDL A;  1XVY A;  4ZS9 A;  3IOR A;  1A8E A;  3T9V A;  1LFH A;  2UVI A;  4H65 A;  4LQ5 A;  2WKY A;  1D9Y A;  4ZEF A;  3WAE A;  3DP6 A;  3ZKK A;  3PMV A;  3ZKL A;  1XS5 A;  1N84 A;  5IAI A;  1N0T A;  2G93 A;  3MW0 A;  1BIY A;  1LST A;  4IO4 A;  4O3B A;  3TZA A;  5ELV A;  4KI0 E;  2Y7I A;  3PUX E;  2Y7R A;  3CFX A;  3MZB A;  1R1N A;  5FHO A;  5H8N B;  2XX7 A;  4DCY A;  1JEU A;  2QS4 A;  1SQY A;  4JWX A;  4QF9 A;  3K2D A;  3K6U A;  4F29 A;  3HHG A;  3RTF B;  3PGF A;  4IO2 A;  1USY E;  2ZNT A;  4IO5 A;  3EQ1 A;  3DEL B;  3PU5 A;  3OEN A;  3RT6 B;  1MPD A;  5KCJ A;  5I59 B;  4DLD A;  1XT8 A;  4F2O A;  4EXL A;  3MVZ A;  1I6Q A;  3K0V A;  1F9B A;  2F7C A;  4FE8 A;  1BLF A;  4QFK A;  2G29 A;  1AIV A;  2BJJ X;  2GFE A;  2O7I A;  2RC7 A;  2ZYN A;  4GIZ A;  1B3E A;  1M5F A;  2DE3 A;  3MWB A;  1SW1 A;  1MY4 A;  3SEX A;  3O9P A;  4M1V A;  1S7Y A;  1TWY A;  2AYS A;  4IO7 A;  4K3F A;  4XKR A;  1OMP A;  4MBP A;  4QFL A;  1URS A;  5I58 B;  4BDQ A;  1D9V A;  1IZ1 A;  5EHS A;  4ELQ A;  1MXV A;  1XVX A;  3O97 A;  1NH8 A;  3Q29 A;  2ONR A;  4FOR A;  3RGY A;  3TAJ A;  3G3J A;  3PUZ E;  1MXW A;  3IO6 A;  4GXS B;  3PMX A;  2XXY A;  1P1O A;  4IO3 A;  2FYI A;  4U1O A;  5HM4 B;  2ZNS A;  1TFA A;  1YCJ A;  2OLB A;  3H6V A;  3RLF E;  3C34 A;  2ONS A;  2XXW A;  3I5O A;  3CSG A;  4OTE A;  4H6D A;  5ICQ A;  1MY0 A;  4BDO A;  5TP9 B;  4NF5 A;  4GL8 A;  1NL5 A;  2F6P A;  3USD A;  4QFP A;  4OHN A;  2Q2C A;  2Y84 A;  4QFO A;  4MFI A;  2H9B A;  3T9X B;  1ZLQ A;  3JV9 A;  4FED A;  4RPN A;  4U1Z A;  1QJM A;  5I84 A;  1IUD A;  1NMU A;  2FNC A;  4H5G A;  4H0W A;  4YB6 A;  1B40 A;  4IB2 A;  3KJ7 A;  4LZ8 A;  4LUB A;  3EHS A;  3MP6 A;  2O51 A;  1MXU A;  5TPA B;  3MQ9 A;  4OET A;  1LAX A;  1JEV A;  1B4Z A;  3QUJ A;  3V5A A;  3KJT A;  1MQJ A;  1PB9 A;  3PPQ A;  4F31 B;  3MBP A;  1NFT A;  2XX9 A;  2I6E A;  3C33 A;  1FTL A;  3IOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...