4MLVA

Crystal structure of bacillus megaterium porphobilinogen deaminase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
290
Chain Sequence
b'SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKLLIDRVKEELD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porphobilinogen deaminase
publication title Structural evidence for the partially oxidized dipyrromethene and dipyrromethanone forms of the cofactor of porphobilinogen deaminase: structures of the Bacillus megaterium enzyme at near-atomic resolution.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transferase
total genus 102
structure length 290
sequence length 311
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 4mlvA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA02
1A8FA 4IGTA 1JEVA 3DP4A 1MM7A 1ZU0A 1TXFA 3PPNA 3PUXE 2ZYOA 1B9JA 1BP5A 5I59A 3LSXA 3Q25A 4JWOA 4RPOA 1MQGA 3Q28A 1JW5A 1MQDA 1H76A 4R72A 3HO7A 4QFKA 4ISUA 3U8QA 2GHAA 3PGFA 3G3HA 5L9MA 3RPWA 3RTWB 1A99A 3W9VA 3VV5A 1EZPA 1NMUA 4LONB 5A5XA 4N13A 3H4ZA 3D4CA 2Q8JA 4YKIA 1DTGA 4MBPA 4QRZA 3K6UA 3BFTA 4QF9A 1T0KA 2PX1A 1IXGA 3OENA 4X1DA 4ZE8A 3SETA 2DVCA 3H7MA 3FXRA 5HBCA 3C34A 1MXYA 3MZ1A 4O3BA 4OFJA 4KHZE 2DE4A 1B51A 5I2NA 1MXVA 1O7TA 2THIA 4IY5A 4BLAA 1I6BA 4YKPA 3DLNA 5JTYA 3CI8A 2OZZA 2RINA 5I59B 4YMBA 2XXYA 4O3AA 2VGQA 3RT8A 2QJEA 1UTHA 3TCGA 4KYEA 4XTCQ 2H4IA 4OFLA 4JDFA 4H8JA 3IOUA 3CRBA 3KBRA 3VLVA 1N04A 1IXIA 2R71A 3H6UA 2ZXTA 3H03A 3KJTA 2V25A 2ZYMA 2R6GE 5IKBA 3VLUA 1M5DA 4ZDMA 2NWJA 4IB2A 1UQWA 3N6TA 3SERA 3KFMA 1P1QA 3IOWA 3CG3A 1N0TA 2ANJA 3RTFB 5EHMA 1DPPA 4KCCA 3OD7A 5A5XB 2P0SA 2QPQA 4LVQA 1Y1MA 1ELJA 1ZTYA 4EUOA 1TFAA 2Z8EA 4EQBA 1A55A 5M2VA 1LSTA 2D5WA 1I6QA 1PBQA 2AL4A 5IAIA 1MM6A 2NVUB 4GD5A 1LBCA 3CFZA 1AIVA 4RK9A 1JQFA 4IO4A 1IITA 2O84X 5I2NB 4F3GA 5I56A 4WEPA 1UTBA 5ICTA 3FV1A 1LCTA 3H6TA 4LP2B 3IOTA 5DYHA 1UTHB 3TELA 3V5AA 5H8QA 3M3KA 5H8SA 1QW0A 3E4RA 2G93A 1N3XA 2RC8A 1A7LA 4H0WA 1D4NA 3O97A 4G2ZA 4HW8A 3C33A 4AB5A 2VOZA 2VHAA 2OK2A 3UA8A 1D9YA 1FTJA 2B3BA 2P2AA 1R1NA 4PQJA 3KSXA 3FGSA 3CVGA 3CSGA 2H5YA 4Q0CA 3RNNA 2ZMBA 4RY1A 4JSOA 1MXUA 3PMWA 4I62A 4BDMA 4H5GA 1HSLA 2HQ0A 2O7IA 4NWDA 2QS1A 5F7VA 3OO6A 2GH9A 3A09A 1CB6A 3CFLA 4JSDA 4BDLA 3RN8A 2Q89A 1MRPA 5JK4A 4KQPA 3K02A 2FNCA 1SQYA 2ZYNA 3L6GA 4IO3A 4YICA 3U1OA 2BJJX 4ZZAA 1RYXA 4ELOA 3KGCA 5DTBA 5KZTA 2F36A 4R2FA 1O63A 5I56B 3H3GA 4KCDA 4P0GA 5KDTA 1Y4TA 1UTBB 1QUIA 1NL5A 3ILUB 3RUMA 3OSRA 1KWHA 3FVGA 2PVUA 3BFUA 2UVIA 5I2KA 3OELA 3QK6A 3DM0A 3AXFA 3H6VA 2DOJA 1N3WA 4QSDA 1MXXA 5KCJB 1VR5A 2HEUA 2QSXA 3QYTA 2Q88A 3VXCA 2UXAA 1B3HA 1URDA 4ECFA 1B1HA 2QS4A 3RY3A 2XD3A 2HZKA 1SW2A 1L5TA 4U4SA 2XXUA 3TDJA 3EN3A 4C1TA 4DCXA 1Z7NE 1LAFE 1SI0A 3PUWE 4U1ZA 4M1VA 3K6XA 1EZ9A 3Q29A 3V8XB 3SEWA 3R7XA 1M5EA 3PV0E 4F2OA 1WODA 4U22A 2HAVA 4YB7A 4XXUA 4OERA 2UVHA 5DVIA 1B0HA 5CMCA 4R6KA 1WVJA 1MXWA 4GRKA 1MY3A 4PE5B 4ZEKA 1B52A 1NNTA 2G29A 1Y9UA 2DP8A 3MBPA 2F97A 3B6QA 2FYIA 4H8IA 5ITPA 5I2KB 3M8UA 3PUZE 2UYEA 5FHOA 3RGYA 2YJPA 4RJZA 5DT6A 3JV9A 2RCBA 5DVJA 4OEUA 1OIBA 3MPKA 2X26A 2A5TA 3S9LC 3U94A 1LCFA 2PT1A 3G3KA 2I48A 4OVJA 5H8HB 3KJ7A 1PB7A 1OVTA 2I4CA 1MXZA 1YCJA 1HSJA 3S9EA 5CMMA 3G3FA 4JWYA 3C35A 4OFOA 1LBBA 3KEIA 3EPEA 4U23A 3O6HA 1MPBA 3T66A 3IB2A 3V89B 4ESXA 2O69A 3H06B 5FTHA 4IGRA 2I58A 1Q1KA 3TCHA 4FJPA 1P1NA 3LSWA 3KG2A 2AYSA 3PMXA 1VE4A 4PFUA 1H45A 3PUVE 2Y7PA 3MVZA 2QS3A 1Y3NA 4OQOA 4DZ1A 4OEVA 2Y7WA 4QFOA 3N26A 4TLLB 3B6TA 2XXRA 1FQCA 3IB0A 2Y7KA 1YTVA 1PDAA 2F6PA 2DWAA 4ZEBA 2REGA 4MLQA 1P99A 1J1NA 1XT8A 4LZ7A 1Y4CA 1M5FA 4G4PA 1B3EA 3OMBA 4I9DA 5ICQA 1USYH 4I1DA 1B46A 4DXCA 1N84A 1B32A 4DXBA 3R26A 4ZECA 2REJA 2CMOA 1UIUA 3ILTB 4Z0IA 2DVZA 3A3UA 1IQ7A 3PD9A 3HHGA 2DYXA 4ELRA 3OOAA 3MWBA 3SEYA 5AA2A 4ZEIA 2O7UA 4F18A 2Y84A 1EH3A 4F1YA 2F8DA 3ONMA 1FQBA 2OLBA 4NF5A 5CBRA 2V3UA 3TZAA 2ONSA 2HZLA 4F19A 3S2VA 1OLCA 1H44A 2CZLA 5F1QA 4GQOA 3B7DA 4ELPA 2PYYA 1VFDA 4ND9A 4EDPA 4HTGA 4QSCA 1FQDA 5L9SA 4ESWA 4DLDA 1F9BA 4R75A 2E0SA 3QAXA 1MQIA 3TCFA 2IA4A 1USYE 3C32A 2QRYA 4HCYA 3DP8A 3UGWA 1DPEA 1VSOA 4RK2A 3P7IA 2GFEA 5FHMA 5LOMA 4DDDA 4KFQA 5H8NA 1NNFA 3FJ7A 4DCYA 3USDA 4NTLA 1A8EA 3ODBA 2Q2AA 1TFDA 3K6VA 2UYFA 4GFRA 3O28A 3N5LA 1B5JA 4LATA 1AL3A 2QS2A 3WAEA 4R9FA 1PC3A 3UN6A 1S50A 2NUVA 4YZZA 2O68A 3BBRA 3TODA 3MVWA 5JEIA 4OETA 1QUJA 5H8FA 4OWDA 1US5A 2Z23A 4F29A 2RKMA 4H5FA 3TTLA 4TOZA 1GV8A 1P1UA 1MY1A 4KYSA 5B70A 1BLFA 4U21A 4FECA 2Q9TA 3K00A 4Q30B 3RQTA 3TAJA 4BDNA 4TLMB 4MH5A 3VVDA 3KSJA 4LA9A 2I3WA 4E0WA 3TFLA 1NNPA 5JTYB 2O1LA 4H67A 4BDOA 4F3SA 1B58A 4R74A 3IL1B 5HPQA 4NF8A 4FEBA 5AE4A 1QVSA 3C4MA 3GBBA 3E9XA 4RXLA 2O1MA 2E1SA 3KN8A 2PT2A 3T22A 1DMBA 1LAGE 2ABHA 5H8NB 4N07A 5HM4B 1US4A 1BTJA 4KI0E 3B6WA 2KLFA 4U4XA 4K3FA 4NF6A 1B7UA 4NWCA 4FAJA 1JEUA 1SDXA 3TTKA 3T9XB 5AA2D 4NF4A 4GL0A 2Z8DA 4TQUQ 1MPDA 3UP9A 2NXOA 1AMFA 1MPCA 3KZGA 1LFHA 3TUSA 5H8FB 3U92A 3TEPA 4G68A 3UK4A 1MQHA 3VFJA 4E0XA 3THIA 3T9UA 2QL3A 2R9JA 3QUJA 1GVCA 3VDFA 1IXHA 4QFNA 1ZLQA 4YMAA 3G3IA 3MUQA 3ECRA 5L8DA 5I57A 3GBAA 1JNFA 3C31A 1IEJA 1IZ1A 1LB9A 3RLFE 4XKNA 3CR9A 1JVYA 1ANFA 1N7XA 2RF1A 3G7WA 3C36A 2F35A 1IIWA 5H8QB 2Y7RA 2V3QA 2YLNA 2PBWA 4G68C 2Z8FA 1IXCA 1SI1A 3ZKKA 4EF1A 3UIFA 1NH7A 5DEXA 3M3LA 4IY6A 3K0VA 3FXQA 1B40A 5BWJA 1SD3A 3O66A 1H43A 2XHDA 4F2QA 4POWA 1S7YA 1A40A 4NF6B 1DSNA 4C1UA 3K2DA 3C9HA 1Q35A 1QJMA 4NF4B 2XXXA 4HS7A 3S4UA 1LAHE 1R9LA 3FJMA 1JETA 1JW1A 1B05A 1Y3QA 5B7DA 3E3KA 3VVFA 2I0BA 3G3JA 2I0CA 1Z7ME 2QMWA 4BDQA 2Z22A 5EYFA 3K4UA 5TP9A 3TQLA 2F34A 4KYDA 2X7QA 1I6AA 5I84A 1P1OA 1OQHA 4P0IA 1POY1 3OO9A 1II5A 1NFTA 4F3PA 1CE2A 2F6GA 4R9GA 1ZIUA 1D9VA 3TMGA 4EQ9A 1XOCA 5KDTB 3I3VA 2FA7A 3MVYA 2HCAA 5AA1A 4THIA 1H3DA 2A5SA 2H99A 2F7BA 3U72A 3LR1A 1JVXA 3KN7A 4HCWA 2M8CA 3CFXA 3GXAA 3SDFA 4FE8A 3Q26A 2VD2A 1N76A 4OZ9A 5ISUA 3BKIB 2UVJA 4XKRA 3EHSA 1OMPA 1FQAA 1P1WA 3KN3A 1FTMA 3MZ9A 2RCAA 3JZJA 4F22A 3JYRA 3EQ1A 2F5XA 2I49A 4O3CA 1GGGA 1R6ZA 3PPQA 2F7AA 3IO4A 1AOVA 3W9WA 1Y20A 3I6VA 1QULA 5DVFA 1MG1A 3D4GA 5L9OA 4X1BA 3OXNA 4OESA 5ELVA 3SEUA 1O64A 1WDNA 5TP9B 3HSTA 4FATA 1EU8A 4IO2A 1URGA 4ZE9A 1B1XA 3T93B 4LZ8A 5CMKA 3FJGA 3T9HB 2XXVA 2H25A 2V3TA 5CRYA 4JBZA 4PP0A 2I4BA 5CM6A 1R9QA 1ZBMA 3OO7A 1NH8A 3S9NC 3VE1B 4JWXA 4P11A 3M3FA 1XVXA 5EHSA 4PFTA 3FIRA 2DE2A 3MVXA 2Y7IA 1OQGA 3SEXA 1FQEA 3FASA 4PETA 3PPRA 1B3LA 4IO6A 1EZOA 2A5TB 4H65A 5CI5A 1TT1A 1AH5A 2XX7A 4EXLA 3HPIA 1SYIA 3MP8A 1UIVA 1MH4A 4WKMA 4ELQA 3ZSFA 5I58A 3GZGA 1QUKA 4POXA 2B65A 1LB8A 5CMBA 2RC9A 3KOSA 3I5OA 1FTLA 3OSQA 3LSFB 4BDRA 3MAMA 1ZMGA 4XKPA 1Y1ZA 4I8CA 2HXWA 1ATGA 5TPAA 1DOTA 1FTKA 2DXRA 4OTEA 4MFIA 1B0LA 2DXYA 4LUBA 1D3KA 2DWJA 2XXIA 4QSEA 4DXUA 3V83A 4QFPA 2XXQA 2ONKE 4ZEDA 3CIJA 3LC8A 2VP1A 4OMBA 3PD8A 4DE8A 3O6GA 1N7WA 3IO6A 4QFLA 4WEDA 4WXJA 1IUDA 3UORA 4JB7A 3A3CA 4G8NA 4ZEFA 1POTA 3MC2A 4XKQA 3VVEA 3CG1A 5I58B 4GL8A 2OBGA 3TTRA 2ZNUA 4OYVA 3TPAA 3W15C 5FTIA 3E13X 5AA2B 3R6UA 2OJTA 1YAEA 1RYOA 1VFEA 2GRVA 2OCUA 3PUYE 3ZS6A 3TYHA 1MDP1 4LZ5A 3CSBA 1B4ZA 4NF5B 1GTKA 2DE3A 4FEDA 2H98A 4XIGQ 2ZNTA 5TPAB 4YAHX 4PFWA 4G8HA 3N6UA 3FVKA 2AL5A 3O6IA 1MS7A 3MPLA 4NE4A 3T96B 1SYHA 4KR5A 2XD2A 2I6EA 3SESA 2D3IA 3DP6A 4YB6A 3OEMA 4FIMA 2DQVA 1M5BA 3LBSA 4F1VA 2XXTA 1MH3A 3EF7A 2GHBA 3IAZA 1NKXA 3IK6B 3RT6B 5AA4A 1DTZA 4IO5A 3IJXB 1MY4A 3IOVA 4OHNA 5K2XA 2HFBA 4H1XA 3FVOA 5KCJA 2ALUA 4AQ4A 3PMVA 1M5CA 3MP6A 3SEVA 2V93A 4EF2A 4MLVA 1PB9A 1B7ZA 2LAOA 1YPNA 1SW5A 5ITOA 2YPNA 3MZBA 2O6AA 4GXSB 3N94A 4R73A 4KD5A 1FCKA 4G77A 2I3VA 1SW4A 4X48A 4PFYA 2ONRA 2AIXA 2NOOA 4GWOA 1LGBC 3IR1A 3PPPA 3MW0A 4L17A 1PBPA 1SW1A 1A54A 1FW0A 2ESNA 4RA1A 4IO7A 3FZVA 4ZS9A 3FUZA 4EQ7A 3PPOA 4U1OA 1LFIA 4F3BA 2IEEA 5K2YA 3EHUA 4EXKA 1B5HA 3HHFA 4YKKA 1B7HA 1PEBA 4NF8B 3G3GA 2PMSA 4F1UA 4QHQA 4YU0A 3K1NA 3H6WA 1B5IA 1B6HA 4LQ5A 4GOTA 3HN0A 5BUUA 1MY0A 2Q2CA 4GIZA 4MF3A 3FVNA 3F11A 3MQ9A 5AA4B 2ZNSA 1GR2A 2F7CA 1B3GA 4G8MA 3HV1A 5AA3A 3OEKA 1XC1A 4C0RA 3TQWA 1MY2A 2OWSA 4NMYA 4F31B 1B3FA 2P1SA 3EHTA 4GLIA 1NNKA 4R6YA 4ZZEA 3WAFA 3FXUA 2XX9A 5H8HA 4ONYA 3SKPA 4H6DA 3U93A 2HAUA 4G68B 3LSLA 1B2HA 4Q8RA 4FORA 2F78A 3KOTA 3T9VA 4X9TA 5TU0A 1RKMA 4Z7EA 3QXMA 4R6HA 1MDQA 5J1DA 3IORA 1FTOA 4M4GA 1ZKBA 5I57B 1LAXA 3GLBA 1HSEA 2H9BA 1XVYA 2XXHA 3FATA 1JW4A 3VLWA 2W7YA 3S9MC 3TKDA 3O9PA 3TTNA 3HCQA 4RNSA 3L6HA 1LFGA 2DWIA 3QUFA 2DSFA 3VXBA 4NEDA 1OVBA 3IJOB 2O51A 3ZKLA 4DIGA 4OXVA 4R2BA 4JXIA 4RPNA 1BKAA 2B3FA 5DEXB 3LUYA 4YKJA 1I69A 5CBSA 2RC7A 2UVGA 4KPTA 1MQJA 5FHNA 3K6WA 3QIMA 1ZJLA 1LLSA 1QKAA 2V84A 2OWTA 2QMXA 3MJNA 3K01A 2D21A 2X7PA 1Y3PA 1TWYA 3O2AA 3IX1A 3FD3A 3OO8A 1XS5A 1URSA 1B4HA 4GF8A 4UACA 1OLAA 2XXPA 1S9TA 1FQFA 3Q27A 1SVXB 4GXAA 3TTMA 3O29A 3FV2A 2DS9A 3MP1A 2XXWA 4U2RA 2ZYKA 4GVOA 4AB6A 4F39A 4OENA 5CC2A 4RYAA 3IB1A 3K1PA 1PB8A 1SBPA 4YB5A 3QSLA 4UA8A 2XX8A 1XHYA 3PU5A 4N6PA 4LQ2A 2WKYA 3K1MA 1BIYA 4Q5TA 1QKBA 2VD3A 2DWHA 3DELB
chains in the Genus database with same CATH superfamily
1A8FA 4IGTA 2LTRA 1JEVA 3DP4A 2DLQA 2EM8A 1MM7A 1ZU0A 4NXME 1TXFA 3PPNA 3PUXE 1YUIA 2ZYOA 4DV4E 1B9JA 2ZM6E 1BP5A 5I59A 4GKKE 2QVUA 5AE1A 3LSXA 3Q25A 4JWOA 4RPOA 1MQGA 4NF0A 3Q28A 1JW5A 1MQDA 4PDDA 1H76A 4GWSA 3DF6A 3RPLA 4R72A 3HO7A 3H09A 4QFKA 2EMZA 4WPYA 4ISUA 4GWXA 3U8QA 2B9DA 2GHAA 4P78A 2EPMX 3PGFA 3G3HA 2YRMA 1IQSA 5L9MA 2A25A 2DRPA 1YYKA 2HGHA 3RPWA 3RTWB 3EKIA 1A99A 3W9VA 5ET6A 3VV5A 4N6KA 1FPIA 1NV4A 1EZPA 1NMUA 5AC4A 1LBYA 5F24A 4LONB 5A5XA 2V86A 4N13A 3H4ZA 1DK4A 3D4CA 2EM6A 1J5EE 2VQEE 2DB2A 5I7IA 2Q8JA 4PFIA 4YKIA 1DTGA 4MBPA 4X62E 4B3SE 4DR7E 4QRZA 5IWAE 3K6UA 3BFTA 4MNIA 4QF9A 1T0KA 2WBSA 2PX1A 3JAMC 1IXGA 3OENA 4X1DA 4ZE8A 3SETA 2DVCA 3H7MA 1FBFA 3FXRA 2FIXA 5HBCA 4JYAE 2YTGA 3C34A 1MXYA 3MZ1A 4O3BA 4OFJA 4L8NA 3QMFA 4KHZE 2DE4A 5ESYA 1B51A 5I2NA 1MXVA 5ET7A 1O7TA 1UN6B 5KL3A 2EP3A 4FK5C 2THIA 4IY5A 4BLAA 4JV5E 1I6BA 4YKPA 3DLNA 5JTYA 3CI8A 2WYPA 2OZZA 2RINA 5I59B 4YMBA 1FSAA 2XXYA 5EQ8A 4O3AA 2VGQA 3RT8A 2QJEA 3HXLA 1UTHA 4BC9A 2VRDA 5KL2A 3TCGA 4DV7E 4KYEA 4XTCQ 2H4IA 5FLXC 2JJKA 2ZZWA 2UUAE 4OFLA 2YTPA 5KL6A 4I3EA 4JDFA 4MCOA 4H8JA 3IOUA 4PCDA 3CRBA 3KBRA 3VLVA 1N04A 4N4UA 2EMKA 1IXIA 2R71A 3H6UA 2ZXTA 4OVRA 2EOYA 3H03A 2EMCA 3KJTA 2V25A 2YWQA 3C4TA 2ZYMA 5TSEA 2R6GE 1KA1A 5IKBA 3VLUA 1M5DA 4ZDMA 2NWJA 4IB2A 1UQWA 3N6TA 3SERA 2NABA 4XF5A 3KFMA 1P1QA 3IOWA 2LO3A 3CG3A 1N0TA 2ANJA 3RTFB 2L2MA 5EHMA 2JP9A 4GBWA 1DPPA 2EN4A 4KCCA 1IMFA 3OD7A 5A5XB 2P0SA 2QPQA 4LVQA 1EH7A 1ELJA 1Y1MA 1ZTYA 5F3WA 1A1GA 4EUOA 1X47A 3FBPA 1TFAA 2HJJA 2Z8EA 1WHNA 2YTJA 1YSAC 2EPCA 1XNRE 4EQBA 2EQ0A 1A55A 5M2VA 2CSHA 1LSTA 2D5WA 4HXVA 2LT7A 1I6QA 2L2NA 1D9QA 1PBQA 2AL4A 3KWRA 5IAIA 3BF2A 3T1HE 1IMCA 1MM6A 2NVUB 2EE8A 3BIHA 4GD5A 4AS5A 2XWKA 1EYJA 2EM4A 1LBCA 1NEIA 2EOIA 3CFZA 1AIVA 4RK9A 1JQFA 4IO4A 1DCUA 1IITA 2O84X 5LLQA 1DQ3A 5I2NB 4F3GA 5I56A 4GZNC 4WEPA 3OMLA 1UTBA 4DR1E 4AS4A 1STUA 4R8OA 5ICTA 2JVAA 1YXIA 1SPIA 3FV1A 1LCTA 3H6TA 4LP2B 3IOTA 5DYHA 2RSMA 1UTHB 2CPNA 3TELA 3V5AA 1QGXA 5H8QA 3M3KA 5H8SA 1QW0A 2EOJA 3E4RA 2L6MA 2BJIA 4PAFA 4JI1E 2G93A 1N3XA 2WCC3 2RC8A 1A7LA 4H0WA 1D4NA 3O97A 4G2ZA 4HW8A 3C33A 4NAPA 4O24A 3J80C 4AB5A 2VOZA 1FBGA 2VHAA 4F9CB 2OK2A 1LBZA 3UA8A 1D9YA 1X5WA 1FTJA 2EOSA 4JI0E 1NUXA 2B3BA 1IBME 2P2AA 1R1NA 4PQJA 4GEQB 2PRTA 2M7QA 4N6DA 4PBHA 3KSXA 2CT1A 2E72A 2EOXA 2K4VA 3FGSA 3CVGA 3CSGA 2H5YA 4Q0CA 2R1FA 3RNNA 2RS7A 2ZMBA 2LJHA 1KZ8A 4RY1A 4JSOA 4OX9E 4JVCA 1MXUA 4DR4E 3HPZA 3PMWA 1JK2A 4I62A 3EPLA 4BDMA 4X65E 4H5GA 1HSLA 2HQ0A 2O7IA 4GWWA 4NWDA 2QS1A 5F7VA 4WXCA 1NV5A 3OO6A 1X3CA 2GH9A 3A09A 1CB6A 4P7DA 2V8QB 1FBDA 3CFLA 4JSDA 4BDLA 3RN8A 2Q89A 1MRPA 4KXPA 2LTSA 1QU6A 2HXRA 2DMIA 5JK4A 4KQPA 3K02A 1LBXA 2FNCA 3VYYA 2EL4A 1SQYA 2ZYNA 3QG5C 5A5LA 4MHFA 1MGTA 2KHXA 3L6GA 4IO3A 4YICA 3U1OA 2BJJX 4ZZAA 4PAKA 2EM2A 1RYXA 4ELOA 3KGCA 1JP4A 5DTBA 5KZTA 3J81C 2F36A 4R2FA 1O63A 5I56B 4LF8E 3H3GA 4OOGC 4KCDA 4OVQA 1IMEA 4P0GA 1X6FA 5KDTA 3C4BA 1Y4TA 1FBEA 3J7AG 1UTBB 2EOEA 1QUIA 1NL5A 3ILUB 3RUMA 3OSRA 1KWHA 1HNXE 2WBDA 3IWBA 1HNWE 3FVGA 2GQ1A 4I3YA 2PVUA 5AE3A 1L4SA 1FPJA 3BFUA 2UVIA 5I2KA 3OELA 3QK6A 3DM0A 4LFBE 3AXFA 3H6VA 2DOJA 1N3WA 5BR8E 4QSDA 1MXXA 5KCJB 1VR5A 2HEUA 2JY9A 2QSXA 3QYTA 1FJGE 2L33A 2Q88A 3VXCA 2UXAA 1B3HA 2EMYA 1XNQE 1URDA 4PC9A 5ET5A 4ZYHA 1T4LB 4ECFA 4M30A 1B1HA 2QS4A 3RY3A 4DV2E 2XD3A 2HZKA 4DKKA 2EMGA 4O4KA 1SW2A 4DUYE 4X66E 1NV0A 1UILA 4U4SA 1L5TA 2XXUA 1BB8A 3MYUA 3TDJA 5J16A 3EN3A 1FPEA 4C1TA 5A6KA 2ELZA 2NA2A 5I5PA 4DCXA 1PJTA 1Z7NE 1LAFE 1SI0A 3PUWE 4U1ZA 4M1VA 3K6XA 4PGPA 1EZ9A 1YZ9A 3Q29A 1HR0E 2R8TA 1J26A 3V8XB 2JWOA 3SEWA 3R7XA 1M5EA 2JOBA 3PV0E 4H45A 4F2OA 1WODA 4O7MA 4F2JC 4U22A 5LMNE 2F8BA 2HAVA 4XXUA 4OERA 4YB7A 1CNQA 3P1XA 2UXDE 2UVHA 4MJOA 4PAIA 2M1SA 5DVIA 1B0HA 5IV8B 2MKNA 5CMCA 4DV3E 4R6KA 1WVJA 1MXWA 2KQZA 4GWYA 4GRKA 1MY3A 4PE5B 4ZEKA 1B52A 1NNTA 2G29A 1Y9UA 2DP8A 3MBPA 2EM3A 5EYHA 2F97A 3B6QA 4DV6E 2FYIA 2EMAA 2RTXA 3HQ1A 4DR6E 4H8IA 5ITPA 2UUCE 4JI6E 2WEFA 5I2KB 3M8UA 4QXDA 4P8BA 3PUZE 2UYEA 4PFBA 2JOXA 5FHOA 1T38A 1INPA 4NN3A 3RGYA 2YJPA 4RJZA 5DT6A 1IQOA 1BK4A 3JV9A 2RCBA 2N3GA 5DVJA 4OEUA 1OIBA 3MPKA 2DLKA 2X26A 2A5TA 1NV2A 3S9LC 3U94A 1LCFA 2PT1A 3G3KA 2I48A 4OVJA 4F54A 1NCSA 1G0IA 5H8HB 4OANA 3KJ7A 1FJ6A 4NHRA 1PB7A 1OVTA 2I4CA 1MXZA 1YCJA 4YHHE 1HSJA 3S9EA 4JI5E 4OVPA 5CMMA 3G3FA 4JWYA 3C35A 2LUPB 4N8GA 4OFOA 1LBBA 3KEIA 4PE3A 3EPEA 4U23A 3O6HA 4LTYA 1MPBA 5EQAA 3T66A 3IB2A 4BHBA 3V89B 4ESXA 2O69A 3H06B 4BHCA 5FTHA 4IGRA 2I58A 1Q1KA 3TCHA 2EPLX 2RPCA 1N3GA 4FJPA 1P1NA 1DI2A 4O5GA 3LSWA 3MHSC 3KG2A 2LBSB 2AYSA 1WRJA 3PMXA 1VE4A 2QFLA 2Y5KA 4HE1A 1H45A 3PUVE 4PFUA 4R03A 2Y7PA 3MVZA 2QS3A 3F6HA 1Y3NA 4OQOA 4DZ1A 4OEVA 1RC7A 2Y7WA 2EPXA 4QFOA 3N26A 4TLLB 3B6TA 2XXRA 1FQCA 3IB0A 4MIJA 2Y7KA 1YTVA 4XEQA 1PDAA 2F6PA 4N4RB 5A2QC 2OWZA 2EOQA 1DGCA 2DWAA 4ZEBA 2REGA 4MLQA 1SFEA 1P99A 1J1NA 1XT8A 4LZ7A 2UU9E 1Y4CA 1M5FA 3EPJA 2B3TB 4R2EA 4G4PA 1B3EA 4NQ8A 2EZ6A 3OMBA 3J7Yp 2WZOA 4I9DA 4JI8E 2LJUA 5ICQA 1USYH 4I1DA 2E5LE 2L8TA 1B46A 4DXCA 1N84A 1B32A 4DXBA 4BC7A 2XWVA 4DR3E 3R26A 2ADRA 4FBPA 4ZECA 2NUFA 2REJA 2CMOA 1X49A 1UIUA 3ILTB 4Z0IA 2DVZA 2LUQA 3A3UA 4N91A 2WYKA 2EMHA 1IQ7A 3PD9A 2DSYA 5IM2A 3HHGA 3ZOQB 2DYXA 3F6GA 4P47A 1G2DC 4ELRA 3OOAA 3E79A 4M9VC 3MWBA 3SEYA 5AA2A 4ZEIA 2O7UA 2MDGA 4F18A 2Y84A 4X8RA 1EH3A 1A1KA 4F1YA 1PJSA 2DMYA 2F8DA 3ONMA 2OLBA 1FQBA 1ZBTA 4NF5A 5CBRA 2V3UA 3TZAA 5IZ3A 2ONSA 2HZLA 2XA5A 3B50A 4F19A 3S2VA 4PF6A 2YTIA 3JU0A 1H44A 1OLCA 5AC5A 4WSGA 2CZLA 5F1QA 4GQOA 3B7DA 4ELPA 1ZBQA 3PTYA 2PYYA 2V88A 4DR2E 1VFDA 4ND9A 4EDPA 5A6BD 4HTGA 4QSCA 1FPFA 1FQDA 4WX9A 5L9SA 4ZYGA 3IWCA 4ESWA 1Z1BA 2V4CA 4DLDA 2P3VA 1F9BA 2L3JA 4R75A 2E0SA 2Q74A 3QAXA 1MQIA 1F2IG 2E1MA 4X9JA 3TCFA 3FIGA 2IA4A 1USYE 1FKAE 3C32A 2QRYA 4HCYA 3RPLB 1XMOE 2QVVA 3DP8A 1ZU1A 2EPAA 3UGWA 1DPEA 1VSOA 4RK2A 3P7IA 2GFEA 5FHMA 4OA4A 5LOMA 4DDDA 4KFQA 5H8NA 1NNFA 3FJ7A 4IJDA 4DCYA 3USDA 4NTLA 2ELYA 1A8EA 3ODBA 2Q2AA 1TFDA 3K6VA 2PFZA 2UYFA 2PCRA 4GFRA 3O28A 1N32E 3N5LA 2BBGA 1B5JA 5LTCA 2YRKA 4LATA 1AL3A 3BIDA 2QS2A 3WAEA 1TF6A 4R9FA 1PC3A 2YTNA 3UN6A 1S50A 2NUVA 4YZZA 2O68A 2RQLA 3BBRA 2ENHA 3MVWA 3TODA 4OVSA 5I3SA 1UBDC 5JEIA 4OETA 5A69A 1QUJA 1A1LA 1NV1A 5H8FA 4PBQA 4R2RA 4OWDA 5A6JA 1US5A 2FVZA 2Z23A 4K0KE 3FXBA 4F29A 5IZ3B 2RKMA 2YSOA 4H5FA 2I9IA 2M9AA 3TTLA 4TOZA 1GV8A 2GLIA 1WXRA 1P1UA 2EN3A 1MY1A 4KYSA 5B70A 1BLFA 4U21A 4FECA 2Q9TA 3K00A 4Q30B 5LMUE 3RQTA 3TAJA 4BDNA 1A1JA 2EMXA 2YU8A 1LEVA 4MH5A 4TLMB 3VVDA 3KSJA 4LA9A 2I3WA 4IR8A 2DGCA 4E0WA 3TFLA 1NNPA 4DV0E 5JTYB 2O1LA 2Q8UA 4H67A 4BDOA 2V83A 5LL6R 3MSTA 1B58A 4R74A 4F3SA 1PJQA 2V87A 3IL1B 4F9AB 5HPQA 3ADGA 4NF8A 5IT9C 4FEBA 5AE4A 1QVSA 3HFUA 3C4MA 3IFCA 3GBBA 3E9XA 2B7TA 4RXLA 2O1MA 2E1SA 3KN8A 1EYKA 2ODRC 4HE0A 5T6JA 1X6HA 3HPSA 1K9YA 2EPUA 2PT2A 4KHPE 2YSPA 3T22A 1DMBA 1LAGE 2ABHA 5H8NB 4N07A 4NXNE 1ZR9A 5HM4B 1LLMC 1US4A 4NZVA 1BTJA 3RMPA 4KI0E 3B6WA 2KLFA 4U4XA 4K3FA 1YFHA 4NF6A 4GX4A 1B7UA 4NWCA 2EPZA 2EN8A 4FAJA 1JEUA 1SDXA 3TTKA 2EM7A 3T9XB 5AA2D 1LBWA 4GL0A 4NF4A 2Z8DA 2EN2A 4G61A 2B4MA 4PDHA 4TQUQ 1MPDA 3C6MA 3UP9A 2JPAA 2NXOA 3ISPA 4JVIA 1AMFA 2Q8MA 1MPCA 2EJ4A 3KZGA 2MDRA 2FBPA 3ADJA 1LFHA 3TUSA 4BS9A 1IMUA 5H8FB 3U92A 3TEPA 4G68A 2LCEA 1X48A 3UK4A 1MQHA 3VFJA 2L2KB 4E0XA 3THIA 3T9UA 2QL3A 2R9JA 3QUJA 1GVCA 3VDFA 1IXHA 4HE2A 4QFNA 1ZLQA 4GX6A 4YMAA 2CEXA 3G3IA 3MUQA 3ECRA 5L8DA 5I57A 5AASA 3GBAA 1JNFA 1LBVA 3C31A 2EL6A 1IEJA 2VPNA 1IZ1A 1LB9A 3RLFE 4XKNA 4P9KA 3CR9A 1O0WA 2EM9A 1FPLA 1JVYA 2JR1A 1ANFA 1N7XA 2RF1A 3G7WA 2FIEA 1MEYC 3C36A 2F35A 1IIWA 5H8QB 1TF3A 2Y7RA 2V3QA 2YLNA 4QBAA 3ADIA 2PBWA 4G68C 2LE2A 3IFAA 2Z8FA 1IXCA 1SI1A 3ZKKA 4EF1A 3UIFA 2EOMA 1NH7A 5DEXA 1FJ9A 3M3LA 4IY6A 2LMZA 3K0VA 1FPBA 2BB8A 3FXQA 1B40A 5KL7A 5BWJA 1SD3A 2YTOA 4P1LA 3O66A 1H43A 4YY3E 2XHDA 4F2QA 4POWA 1S7YA 1A40A 4NF6B 1DSNA 3VK6A 4KZSA 4C1UA 3K2DA 3DJWA 1FRPA 3C9HA 1Q35A 1QJMA 4NF4B 2XXXA 4HS7A 1LAHE 3S4UA 1R9LA 3FJMA 1JETA 1JW1A 1B05A 1Y3QA 5T3JA 5B7DA 3E3KA 4H46A 2ODRD 2HPGA 3VVFA 2I0BA 2MC6A 3G3JA 2I0CA 3ADLA 1UHZA 1Z7ME 1RMDA 2QMWA 2Z22A 4BDQA 3UK3C 3LV0A 5EYFA 3K4UA 5TP9A 3TQLA 2F34A 4KYDA 2YTDA 1VDWA 4JI2E 2X7QA 1I6AA 5I84A 1P1OA 3EPHA 1OQHA 4P0IA 1POY1 3OO9A 1II5A 1NFTA 4DI4B 2FHYA 4F3PA 1FTAA 1CE2A 2F6GA 1WHQA 4R9GA 1ZIUA 2F4VE 5A6BA 1D9VA 3TMGA 4LF9E 2EN1A 4EQ9A 1XOCA 5KDTB 2VE7C 2HHMA 3I3VA 1T4NA 2FA7A 3MVYA 2HCAA 5AA1A 1FBCA 4THIA 1EH6A 1AWBA 5FBPA 4MMPA 1H3DA 2A5SA 2H99A 2F7BA 2L92A 2G7HA 3AV0A 3U72A 3LR1A 1JVXA 2I13A 4I40A 3K6QA 3KN7A 4J8ZA 2Y5LA 2MKZA 4NGUA 4HCWA 1SR9A 2M8CA 3CFXA 3GXAA 4DR5E 3SDFA 2ZZXA 4FE8A 3Q26A 3LLHA 2ENCA 2VD2A 2EMWA 1N76A 2WX9A 4OZ9A 2R76A 2F3DA 4F6MA 5ISUA 3KZYA 3BKIB 3HTXA 2UVJA 4XKRA 3EHSA 1FPGA 1OMPA 1FQAA 1P1WA 3KN3A 4RHBB 1FTMA 1JK1A 3MZ9A 2RCAA 3JZJA 4F22A 2EN7A 2OX3A 3JYRA 3EQ1A 2F5XA 2I49A 4O3CA 1GGGA 1R6ZA 3PPQA 2F7AA 3IO4A 1AOVA 4PF8A 1HNZE 3W9WA 1Y20A 3I6VA 1QULA 2DDKA 5DVFA 4B3RE 1MG1A 4MEVA 3D4GA 5L9OA 4X1BA 3OXNA 4GWUA 4OESA 5ELVA 1FPKA 3SEUA 1O64A 2ENAA 1NI9A 1WDNA 5IZZA 5TP9B 3HSTA 4FATA 1EU8A 2WBUA 4IO2A 4X04A 1URGA 4ZE9A 1B1XA 3T93B 4LZ8A 2N8XA 3AUZA 1K9ZA 5CMKA 3T0JA 4R2SA 3FJGA 3T9HB 2XXVA 2CZKA 2QVRA 3SZPA 2H25A 2V3TA 2L3CA 3VYXA 5CRYA 4JBZA 4PP0A 1P47A 2I4BA 5CM6A 2NUEA 3IWDA 1R9QA 1ZBMA 2EPKX 3OO7A 1NH8A 3S9NC 4TUGA 3VE1B 4JWXA 4GX3A 2WBBA 2WBTA 4P11A 4N17A 3M3FA 1XVXA 5EHSA 4PFTA 3FIRA 1EYIA 2DE2A 3MVXA 2Y7IA 2B7VA 1OQGA 4MAGA 3SEXA 4R2AA 2UXCE 1FQEA 3FASA 4PETA 3PPRA 1B3LA 4IO6A 1EZOA 2A5TB 3EPKA 4H65A 5CI5A 2EWLA 1TT1A 4JI4E 1AH5A 2XX7A 4EXLA 3HPIA 1SYIA 3MP8A 1UIVA 1MH4A 4B3ME 4WKMA 4ELQA 1RDYA 3ZSFA 3GZGA 5I58A 2YU5A 4IS1C 1QUKA 4POXA 2B65A 1LB8A 5CMBA 2RC9A 2YZTA 3KOSA 3I5OA 1FTLA 3GYYA 3OSQA 2LV2A 3LSFB 4BDRA 3MAMA 1ZMGA 2P3NA 3KC1A 4XKPA 1Y1ZA 4I8CA 2RS6A 4DV1E 2HXWA 1ATGA 5TPAA 5AE2A 1DOTA 1FTKA 2DXRA 5IZ1A 4OTEA 1WJPA 4MFIA 1B0LA 4P3LA 2DXYA 4LUBA 1Q9DA 2EOZA 2EQ3A 1KJKA 2L5VA 1D3KA 2MC5A 2DWJA 4ZYEA 2XXIA 1DBZA 4QSEA 1YZ0A 2N3HA 2RSIA 4DXUA 1A1HA 2EMIA 3V83A 4QFPA 2XXQA 5IXMB 3THOB 2ONKE 4ZEDA 3CIJA 1A1FA 1N34E 3LC8A 2VP1A 4OMBA 4BBYA 3PD8A 1NV7A 2YRHA 3LMLA 1T39A 1N7WA 3O6GA 4WYQB 2EPRA 4DE8A 3M99B 3IO6A 5EYGA 4QFLA 4WEDA 2XXKA 4GBVA 1IUDA 4WXJA 3UORA 4O43A 4JB7A 3A3CA 4G8NA 4ZEFA 1POTA 2IHR1 2YTQA 3CHGA 3MC2A 4XKQA 4O7IA 3VVEA 3CG1A 3B8BA 4Q35B 5LDZA 2EOHA 5I58B 4GL8A 2OBGA 3TTRA 4X8WA 1PKPA 2ZNUA 4OYVA 3TPAA 3W15C 3C6KA 5FTIA 2V85A 3E13X 4TUIA 1B69A 5AA2B 3R6UA 2OJTA 2B4LA 2EN6A 1YAEA 1RYOA 1VFEA 2GRVA 2OCUA 3PUYE 3ZS6A 3BIGA 3TYHA 2HC5A 2XWOA 1MDP1 4LZ5A 2H36X 3CSBA 1B4ZA 4NF5B 1GTKA 2DE3A 4FEDA 4UABA 2H98A 4XIGQ 2ZNTA 5CFFE 5TPAB 4YAHX 4PFWA 3MSWA 4G8HA 4LN5A 3N6UA 3FVKA 2AL5A 3O6IA 4LU9A 1MS7A 4AQYE 3MPLA 4NE4A 2LVHA 4BCAA 1SYHA 3T96B 3E78A 4HEIA 4KR5A 4RH8A 3T1BA 4O8MA 2EOOA 5A6AA 3MHHC 1YYOA 2XD2A 2I6EA 3SESA 2D3IA 3DP6A 4YB6A 4WXDA 3A29A 3OEMA 4FIMA 1T4OA 2DQVA 2NUGA 3NOHA 4MNCA 1M5BA 3LBSA 4F1VA 1IMBA 1A1IA 1YUJA 2XXTA 4O94A 1MH3A 5DNYA 2CEYA 3EF7A 2GHBA 3IAZA 1KA0A 1NKXA 2KONA 3IK6B 3RT6B 5AA4A 1TN9A 1DTZA 4P56A 4IO5A 2VF1A 3IJXB 1MY4A 3IOVA 2EORA 4LF4E 4OHNA 5K2XA 2HFBA 4H1XA 1BBGA 3RYDA 4DUZE 3FVOA 5KCJA 2ALUA 4AQ4A 5ADZA 3PMVA 2D9HA 1M5CA 3MP6A 3SEVA 2V93A 4EF2A 4MLVA 1PB9A 1B7ZA 2LAOA 1FPDA 1YPNA 1SW5A 5ET8A 5ITOA 3TQMA 4OVTA 1KYQA 4P1EA 2YPNA 3MZBA 2O6AA 4GXSB 5KL5A 1ZAAC 2HHHE 3N94A 4F6NA 2EMLA 4R73A 1YYWA 1NV6A 4PFRA 4KD5A 1FCKA 4G77A 1BBOA 2I3VA 1SW4A 4WFTA 4X48A 1IMAA 4PFYA 1RDXA 2ONRA 2AIXA 2NOOA 4GKJE 4GWOA 1LGBC 2KR0A 3IR1A 3PPPA 3MW0A 4L17A 1PBPA 1SW1A 1QNTA 1A54A 4NX1A 1FW0A 2ESNA 4RA1A 4IO7A 3FZVA 4LFAE 4ZS9A 3FUZA 4EQ7A 2YT4A 2ZZVA 3LUZA 3PPOA 4U1OA 4R2DA 1LFIA 3T1YE 4F3BA 2IEEA 5K2YA 5EQ9A 3EHUA 4EXKA 1B5HA 3HHFA 2VQFE 4YKKA 1B7HA 1PEBA 4MX6A 4NF8B 1EKZA 3G3GA 2PMSA 3KBZA 4F1UA 4QHQA 4YU0A 3K1NA 3H6WA 1B5IA 1B6HA 4LQ5A 4X64E 4GOTA 3U65A 3HN0A 5BUUA 1MY0A 4MNPA 2LRSA 2Q2CA 4GIZA 2EM5A 1XMQE 4MF3A 2JXPA 5EQ7A 1NV3A 3L00A 2EMFA 1NUWA 2GPIA 3FVNA 2EPNA 3F11A 3D1RA 2J7JA 3MQ9A 5AA4B 2ZNSA 3BGHA 1GR2A 2F7CA 4Q28A 1B3GA 1RQ0A 1I94E 4G8MA 3JTZA 1GZ6A 3HV1A 5AA3A 3OEKA 1XC1A 4C0RA 4LF5E 3TQWA 2FV4B 2KOUA 3ROJA 4DMIA 1MY2A 2OWSA 4NMYA 4F31B 1B3FA 2P1SA 3EHTA 1FBHA 1YYZA 1AAYA 4GLIA 4R2PA 1NNKA 4BMJA 4R6YA 3BBGA 4ZZEA 3WAFA 3FXUA 2PFYA 4M2ZA 2YTFA 3KZZA 1N36E 2XX9A 4ONYA 5H8HA 4DI3D 3SKPA 4H6DA 4KWYA 1XI6A 3U93A 2HAUA 1IBKE 4PTKA 4G68B 3LSLA 1B2HA 1N33E 4Q8RA 4FORA 2F78A 3KOTA 2EPPA 3T9VA 3KC0A 4X9TA 4JI3E 1IMDA 5TU0A 2FGGA 4L5NC 1RKMA 4Z7EA 2EPOA 2UUBE 1NUZA 2CTDA 3QXMA 4R6HA 2EQ1A 1MDQA 5J1DA 4DV5E 4JVDA 1GQEA 3IORA 1FTOA 4B3TE 4M4GA 1ZKBA 1G0HA 5I57B 2CZHA 1LAXA 3GLBA 4NHBA 2K7IA 1HSEA 2EMBA 2H9BA 1XVYA 2XXHA 3FATA 1JW4A 3VLWA 2W7YA 3S9MC 2FTXB 4I8OA 3TKDA 3VHTB 3O9PA 3TTNA 1RDZA 3HCQA 4RNSA 3L6HA 1LFGA 2DWIA 4M0VA 1G2FC 2XWIA 3QUFA 2DSFA 2YTEA 3VXBA 1FBPA 4NEDA 4PGNA 1OVBA 3IJOB 4XFEA 2O51A 3ZKLA 4DIGA 2VT5A 4LFCE 4OXVA 2EL5A 4R2BA 4JXIA 4RPNA 1BKAA 2B3FA 5DEXB 3LUYA 4YKJA 1I69A 5CBSA 5DW8A 2RC7A 4GWZA 2UVGA 2EOFA 4KPTA 1MQJA 5FHNA 3K6WA 3QIMA 1ZJLA 1LLSA 1QKAA 2GHFA 2V84A 2OWTA 4NG7A 1X6EA 1NUYA 2QMXA 3MJNA 3K01A 2D21A 2UXBE 4LF7E 1Y3PA 2X7PA 1TWYA 5KL4A 3O2AA 3IX1A 2DIXA 4WSPA 3FD3A 3OO8A 1XS5A 1URSA 1B4HA 4GF8A 4UACA 1OLAA 4N81A 2XXPA 1S9TA 1FQFA 2F3BA 4R2CA 3Q27A 1SVXB 4GXAA 3TTMA 1EH8A 2MKDA 3O29A 3FV2A 2DS9A 4N15A 3MP1A 2XXWA 4R2QA 2CZIA 4U2RA 2ZYKA 4JI7E 4GVOA 4AB6A 4N8YA 4OENA 4F39A 5CC2A 3OTOE 4RYAA 3IB1A 3K1PA 4ZYDA 1PB8A 2VPOA 1SBPA 4YB5A 3QSLA 2V89A 4UA8A 1IBLE 2XX8A 1XHYA 3PU5A 4N6PA 2M4IA 4LQ2A 2WKYA 3THNA 4LF6E 3K1MA 4F9BB 2JYAA 1BIYA 4Q5TA 1QKBA 2EM0A 2VD3A 2DWHA 5IGAA 3DELB
chains in the Genus database with same CATH topology
1A8FA 4IGTA 1JEVA 3DP4A 1MM7A 1ZU0A 1TXFA 3PPNA 3PUXE 2ZYOA 1B9JA 1BP5A 5I59A 3LSXA 3Q25A 4JWOA 4RPOA 1MQGA 3Q28A 1JW5A 1MQDA 1H76A 4R72A 3HO7A 4QFKA 4ISUA 3U8QA 2GHAA 3PGFA 3G3HA 5L9MA 3RPWA 3RTWB 1A99A 3W9VA 3VV5A 1EZPA 1NMUA 4LONB 5A5XA 4N13A 3H4ZA 3D4CA 2Q8JA 4YKIA 1DTGA 4MBPA 4QRZA 3K6UA 3BFTA 4QF9A 1T0KA 2PX1A 1IXGA 3OENA 4X1DA 4ZE8A 3SETA 2DVCA 3H7MA 3FXRA 5HBCA 3C34A 1MXYA 3MZ1A 4O3BA 4OFJA 4KHZE 2DE4A 1B51A 5I2NA 1MXVA 1O7TA 2THIA 4IY5A 4BLAA 1I6BA 4YKPA 3DLNA 5JTYA 3CI8A 2OZZA 2RINA 5I59B 4YMBA 2XXYA 4O3AA 2VGQA 3RT8A 2QJEA 1UTHA 3TCGA 4KYEA 4XTCQ 2H4IA 4OFLA 4JDFA 4H8JA 3IOUA 3CRBA 3KBRA 3VLVA 1N04A 1IXIA 2R71A 3H6UA 2ZXTA 3H03A 3KJTA 2V25A 2ZYMA 2R6GE 5IKBA 3VLUA 1M5DA 4ZDMA 2NWJA 4IB2A 1UQWA 3N6TA 3SERA 3KFMA 1P1QA 3IOWA 3CG3A 1N0TA 2ANJA 3RTFB 5EHMA 1DPPA 4KCCA 3OD7A 5A5XB 2P0SA 2QPQA 4LVQA 1Y1MA 1ELJA 1ZTYA 4EUOA 1TFAA 2Z8EA 4EQBA 1A55A 5M2VA 1LSTA 2D5WA 1I6QA 1PBQA 2AL4A 5IAIA 1MM6A 2NVUB 4GD5A 1LBCA 3CFZA 1AIVA 4RK9A 1JQFA 4IO4A 1IITA 2O84X 5I2NB 4F3GA 5I56A 4WEPA 1UTBA 5ICTA 3FV1A 1LCTA 3H6TA 4LP2B 3IOTA 5DYHA 1UTHB 3TELA 3V5AA 5H8QA 3M3KA 5H8SA 1QW0A 3E4RA 2G93A 1N3XA 2RC8A 1A7LA 4H0WA 1D4NA 3O97A 4G2ZA 4HW8A 3C33A 4AB5A 2VOZA 2VHAA 2OK2A 3UA8A 1D9YA 1FTJA 2B3BA 2P2AA 1R1NA 4PQJA 3KSXA 3FGSA 3CVGA 3CSGA 2H5YA 4Q0CA 3RNNA 2ZMBA 4RY1A 4JSOA 1MXUA 3PMWA 4I62A 4BDMA 4H5GA 1HSLA 2HQ0A 2O7IA 4NWDA 2QS1A 5F7VA 3OO6A 2GH9A 3A09A 1CB6A 3CFLA 4JSDA 4BDLA 3RN8A 2Q89A 1MRPA 5JK4A 4KQPA 3K02A 2FNCA 1SQYA 2ZYNA 3L6GA 4IO3A 4YICA 3U1OA 2BJJX 4ZZAA 1RYXA 4ELOA 3KGCA 5DTBA 5KZTA 2F36A 4R2FA 1O63A 5I56B 3H3GA 4KCDA 4P0GA 5KDTA 1Y4TA 1UTBB 1QUIA 1NL5A 3ILUB 3RUMA 3OSRA 1KWHA 3FVGA 2PVUA 3BFUA 2UVIA 5I2KA 3OELA 3QK6A 3DM0A 3AXFA 3H6VA 2DOJA 1N3WA 4QSDA 1MXXA 5KCJB 1VR5A 2HEUA 2QSXA 3QYTA 2Q88A 3VXCA 2UXAA 1B3HA 1URDA 4ECFA 1B1HA 2QS4A 3RY3A 2XD3A 2HZKA 1SW2A 1L5TA 4U4SA 2XXUA 3TDJA 3EN3A 4C1TA 4DCXA 1Z7NE 1LAFE 1SI0A 3PUWE 4U1ZA 4M1VA 3K6XA 1EZ9A 3Q29A 3V8XB 3SEWA 3R7XA 1M5EA 3PV0E 4F2OA 1WODA 4U22A 2HAVA 4YB7A 4XXUA 4OERA 2UVHA 5DVIA 1B0HA 5CMCA 4R6KA 1WVJA 1MXWA 4GRKA 1MY3A 4PE5B 4ZEKA 1B52A 1NNTA 2G29A 1Y9UA 2DP8A 3MBPA 2F97A 3B6QA 2FYIA 4H8IA 5ITPA 5I2KB 3M8UA 3PUZE 2UYEA 5FHOA 3RGYA 2YJPA 4RJZA 5DT6A 3JV9A 2RCBA 5DVJA 4OEUA 1OIBA 3MPKA 2X26A 2A5TA 3S9LC 3U94A 1LCFA 2PT1A 3G3KA 2I48A 4OVJA 5H8HB 3KJ7A 1PB7A 1OVTA 2I4CA 1MXZA 1YCJA 1HSJA 3S9EA 5CMMA 3G3FA 4JWYA 3C35A 4OFOA 1LBBA 3KEIA 3EPEA 4U23A 3O6HA 1MPBA 3T66A 3IB2A 3V89B 4ESXA 2O69A 3H06B 5FTHA 4IGRA 2I58A 1Q1KA 3TCHA 4FJPA 1P1NA 3LSWA 3KG2A 2AYSA 3PMXA 1VE4A 4PFUA 1H45A 3PUVE 2Y7PA 3MVZA 2QS3A 1Y3NA 4OQOA 4DZ1A 4OEVA 2Y7WA 4QFOA 3N26A 4TLLB 3B6TA 2XXRA 1FQCA 3IB0A 2Y7KA 1YTVA 1PDAA 2F6PA 2DWAA 4ZEBA 2REGA 4MLQA 1P99A 1J1NA 1XT8A 4LZ7A 1Y4CA 1M5FA 4G4PA 1B3EA 3OMBA 4I9DA 5ICQA 1USYH 4I1DA 1B46A 4DXCA 1N84A 1B32A 4DXBA 3R26A 4ZECA 2REJA 2CMOA 1UIUA 3ILTB 4Z0IA 2DVZA 3A3UA 1IQ7A 3PD9A 3HHGA 2DYXA 4ELRA 3OOAA 3MWBA 3SEYA 5AA2A 4ZEIA 2O7UA 4F18A 2Y84A 1EH3A 4F1YA 2F8DA 3ONMA 1FQBA 2OLBA 4NF5A 5CBRA 2V3UA 3TZAA 2ONSA 2HZLA 4F19A 3S2VA 1OLCA 1H44A 2CZLA 5F1QA 4GQOA 3B7DA 4ELPA 2PYYA 1VFDA 4ND9A 4EDPA 4HTGA 4QSCA 1FQDA 5L9SA 4ESWA 4DLDA 1F9BA 4R75A 2E0SA 3QAXA 1MQIA 3TCFA 2IA4A 1USYE 3C32A 2QRYA 4HCYA 3DP8A 3UGWA 1DPEA 1VSOA 4RK2A 3P7IA 2GFEA 5FHMA 5LOMA 4DDDA 4KFQA 5H8NA 1NNFA 3FJ7A 4DCYA 3USDA 4NTLA 1A8EA 3ODBA 2Q2AA 1TFDA 3K6VA 2UYFA 4GFRA 3O28A 3N5LA 1B5JA 4LATA 1AL3A 2QS2A 3WAEA 4R9FA 1PC3A 3UN6A 1S50A 2NUVA 4YZZA 2O68A 3BBRA 3TODA 3MVWA 5JEIA 4OETA 1QUJA 5H8FA 4OWDA 1US5A 2Z23A 4F29A 2RKMA 4H5FA 3TTLA 4TOZA 1GV8A 1P1UA 1MY1A 4KYSA 5B70A 1BLFA 4U21A 4FECA 2Q9TA 3K00A 4Q30B 3RQTA 3TAJA 4BDNA 4TLMB 4MH5A 3VVDA 3KSJA 4LA9A 2I3WA 4E0WA 3TFLA 1NNPA 5JTYB 2O1LA 4H67A 4BDOA 4F3SA 1B58A 4R74A 3IL1B 5HPQA 4NF8A 4FEBA 5AE4A 1QVSA 3C4MA 3GBBA 3E9XA 4RXLA 2O1MA 2E1SA 3KN8A 2PT2A 3T22A 1DMBA 1LAGE 2ABHA 5H8NB 4N07A 5HM4B 1US4A 1BTJA 4KI0E 3B6WA 2KLFA 4U4XA 4K3FA 4NF6A 1B7UA 4NWCA 4FAJA 1JEUA 1SDXA 3TTKA 3T9XB 5AA2D 4NF4A 4GL0A 2Z8DA 4TQUQ 1MPDA 3UP9A 2NXOA 1AMFA 1MPCA 3KZGA 1LFHA 3TUSA 5H8FB 3U92A 3TEPA 4G68A 3UK4A 1MQHA 3VFJA 4E0XA 3THIA 3T9UA 2QL3A 2R9JA 3QUJA 1GVCA 3VDFA 1IXHA 4QFNA 1ZLQA 4YMAA 3G3IA 3MUQA 3ECRA 5L8DA 5I57A 3GBAA 1JNFA 3C31A 1IEJA 1IZ1A 1LB9A 3RLFE 4XKNA 3CR9A 1JVYA 1ANFA 1N7XA 2RF1A 3G7WA 3C36A 2F35A 1IIWA 5H8QB 2Y7RA 2V3QA 2YLNA 2PBWA 4G68C 2Z8FA 1IXCA 1SI1A 3ZKKA 4EF1A 3UIFA 1NH7A 5DEXA 3M3LA 4IY6A 3K0VA 3FXQA 1B40A 5BWJA 1SD3A 3O66A 1H43A 2XHDA 4F2QA 4POWA 1S7YA 1A40A 4NF6B 1DSNA 4C1UA 3K2DA 3C9HA 1Q35A 1QJMA 4NF4B 2XXXA 4HS7A 3S4UA 1LAHE 1R9LA 3FJMA 1JETA 1JW1A 1B05A 1Y3QA 5B7DA 3E3KA 3VVFA 2I0BA 3G3JA 2I0CA 1Z7ME 2QMWA 4BDQA 2Z22A 5EYFA 3K4UA 5TP9A 3TQLA 2F34A 4KYDA 2X7QA 1I6AA 5I84A 1P1OA 1OQHA 4P0IA 1POY1 3OO9A 1II5A 1NFTA 4F3PA 1CE2A 2F6GA 4R9GA 1ZIUA 1D9VA 3TMGA 4EQ9A 1XOCA 5KDTB 3I3VA 2FA7A 3MVYA 2HCAA 5AA1A 4THIA 1H3DA 2A5SA 2H99A 2F7BA 3U72A 3LR1A 1JVXA 3KN7A 4HCWA 2M8CA 3CFXA 3GXAA 3SDFA 4FE8A 3Q26A 2VD2A 1N76A 4OZ9A 5ISUA 3BKIB 2UVJA 4XKRA 3EHSA 1OMPA 1FQAA 1P1WA 3KN3A 1FTMA 3MZ9A 2RCAA 3JZJA 4F22A 3JYRA 3EQ1A 2F5XA 2I49A 4O3CA 1GGGA 1R6ZA 3PPQA 2F7AA 3IO4A 1AOVA 3W9WA 1Y20A 3I6VA 1QULA 5DVFA 1MG1A 3D4GA 5L9OA 4X1BA 3OXNA 4OESA 5ELVA 3SEUA 1O64A 1WDNA 5TP9B 3HSTA 4FATA 1EU8A 4IO2A 1URGA 4ZE9A 1B1XA 3T93B 4LZ8A 5CMKA 3FJGA 3T9HB 2XXVA 2H25A 2V3TA 5CRYA 4JBZA 4PP0A 2I4BA 5CM6A 1R9QA 1ZBMA 3OO7A 1NH8A 3S9NC 3VE1B 4JWXA 4P11A 3M3FA 1XVXA 5EHSA 4PFTA 3FIRA 2DE2A 3MVXA 2Y7IA 1OQGA 3SEXA 1FQEA 3FASA 4PETA 3PPRA 1B3LA 4IO6A 1EZOA 2A5TB 4H65A 5CI5A 1TT1A 1AH5A 2XX7A 4EXLA 3HPIA 1SYIA 3MP8A 1UIVA 1MH4A 4WKMA 4ELQA 3ZSFA 5I58A 3GZGA 1QUKA 4POXA 2B65A 1LB8A 5CMBA 2RC9A 3KOSA 3I5OA 1FTLA 3OSQA 3LSFB 4BDRA 3MAMA 1ZMGA 4XKPA 1Y1ZA 4I8CA 2HXWA 1ATGA 5TPAA 1DOTA 1FTKA 2DXRA 4OTEA 4MFIA 1B0LA 2DXYA 4LUBA 1D3KA 2DWJA 2XXIA 4QSEA 4DXUA 3V83A 4QFPA 2XXQA 2ONKE 4ZEDA 3CIJA 3LC8A 2VP1A 4OMBA 3PD8A 4DE8A 3O6GA 1N7WA 3IO6A 4QFLA 4WEDA 4WXJA 1IUDA 3UORA 4JB7A 3A3CA 4G8NA 4ZEFA 1POTA 3MC2A 4XKQA 3VVEA 3CG1A 5I58B 4GL8A 2OBGA 3TTRA 2ZNUA 4OYVA 3TPAA 3W15C 5FTIA 3E13X 5AA2B 3R6UA 2OJTA 1YAEA 1RYOA 1VFEA 2GRVA 2OCUA 3PUYE 3ZS6A 3TYHA 1MDP1 4LZ5A 3CSBA 1B4ZA 4NF5B 1GTKA 2DE3A 4FEDA 2H98A 4XIGQ 2ZNTA 5TPAB 4YAHX 4PFWA 4G8HA 3N6UA 3FVKA 2AL5A 3O6IA 1MS7A 3MPLA 4NE4A 3T96B 1SYHA 4KR5A 2XD2A 2I6EA 3SESA 2D3IA 3DP6A 4YB6A 3OEMA 4FIMA 2DQVA 1M5BA 3LBSA 4F1VA 2XXTA 1MH3A 3EF7A 2GHBA 3IAZA 1NKXA 3IK6B 3RT6B 5AA4A 1DTZA 4IO5A 3IJXB 1MY4A 3IOVA 4OHNA 5K2XA 2HFBA 4H1XA 3FVOA 5KCJA 2ALUA 4AQ4A 3PMVA 1M5CA 3MP6A 3SEVA 2V93A 4EF2A 4MLVA 1PB9A 1B7ZA 2LAOA 1YPNA 1SW5A 5ITOA 2YPNA 3MZBA 2O6AA 4GXSB 3N94A 4R73A 4KD5A 1FCKA 4G77A 2I3VA 1SW4A 4X48A 4PFYA 2ONRA 2AIXA 2NOOA 4GWOA 1LGBC 3IR1A 3PPPA 3MW0A 4L17A 1PBPA 1SW1A 1A54A 1FW0A 2ESNA 4RA1A 4IO7A 3FZVA 4ZS9A 3FUZA 4EQ7A 3PPOA 4U1OA 1LFIA 4F3BA 2IEEA 5K2YA 3EHUA 4EXKA 1B5HA 3HHFA 4YKKA 1B7HA 1PEBA 4NF8B 3G3GA 2PMSA 4F1UA 4QHQA 4YU0A 3K1NA 3H6WA 1B5IA 1B6HA 4LQ5A 4GOTA 3HN0A 5BUUA 1MY0A 2Q2CA 4GIZA 4MF3A 3FVNA 3F11A 3MQ9A 5AA4B 2ZNSA 1GR2A 2F7CA 1B3GA 4G8MA 3HV1A 5AA3A 3OEKA 1XC1A 4C0RA 3TQWA 1MY2A 2OWSA 4NMYA 4F31B 1B3FA 2P1SA 3EHTA 4GLIA 1NNKA 4R6YA 4ZZEA 3WAFA 3FXUA 2XX9A 5H8HA 4ONYA 3SKPA 4H6DA 3U93A 2HAUA 4G68B 3LSLA 1B2HA 4Q8RA 4FORA 2F78A 3KOTA 3T9VA 4X9TA 5TU0A 1RKMA 4Z7EA 3QXMA 4R6HA 1MDQA 5J1DA 3IORA 1FTOA 4M4GA 1ZKBA 5I57B 1LAXA 3GLBA 1HSEA 2H9BA 1XVYA 2XXHA 3FATA 1JW4A 3VLWA 2W7YA 3S9MC 3TKDA 3O9PA 3TTNA 3HCQA 4RNSA 3L6HA 1LFGA 2DWIA 3QUFA 2DSFA 3VXBA 4NEDA 1OVBA 3IJOB 2O51A 3ZKLA 4DIGA 4OXVA 4R2BA 4JXIA 4RPNA 1BKAA 2B3FA 5DEXB 3LUYA 4YKJA 1I69A 5CBSA 2RC7A 2UVGA 4KPTA 1MQJA 5FHNA 3K6WA 3QIMA 1ZJLA 1LLSA 1QKAA 2V84A 2OWTA 2QMXA 3MJNA 3K01A 2D21A 2X7PA 1Y3PA 1TWYA 3O2AA 3IX1A 3FD3A 3OO8A 1XS5A 1URSA 1B4HA 4GF8A 4UACA 1OLAA 2XXPA 1S9TA 1FQFA 3Q27A 1SVXB 4GXAA 3TTMA 3O29A 3FV2A 2DS9A 3MP1A 2XXWA 4U2RA 2ZYKA 4GVOA 4AB6A 4F39A 4OENA 5CC2A 4RYAA 3IB1A 3K1PA 1PB8A 1SBPA 4YB5A 3QSLA 4UA8A 2XX8A 1XHYA 3PU5A 4N6PA 4LQ2A 2WKYA 3K1MA 1BIYA 4Q5TA 1QKBA 2VD3A 2DWHA 3DELB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8F A;  4IGT A;  1JEV A;  3DP4 A;  1MM7 A;  1ZU0 A;  1TXF A;  3PPN A;  3PUX E;  2ZYO A;  1B9J A;  1BP5 A;  5I59 A;  3LSX A;  3Q25 A;  4JWO A;  4RPO A;  1MQG A;  3Q28 A;  1JW5 A;  1MQD A;  1H76 A;  4R72 A;  3HO7 A;  4QFK A;  4ISU A;  3U8Q A;  2GHA A;  3PGF A;  3G3H A;  5L9M A;  3RPW A;  3RTW B;  1A99 A;  3W9V A;  3VV5 A;  1EZP A;  1NMU A;  4LON B;  5A5X A;  4N13 A;  3H4Z A;  3D4C A;  2Q8J A;  4YKI A;  1DTG A;  4MBP A;  4QRZ A;  3K6U A;  3BFT A;  4QF9 A;  1T0K A;  2PX1 A;  1IXG A;  3OEN A;  4X1D A;  4ZE8 A;  3SET A;  2DVC A;  3H7M A;  3FXR A;  5HBC A;  3C34 A;  1MXY A;  3MZ1 A;  4O3B A;  4OFJ A;  4KHZ E;  2DE4 A;  1B51 A;  5I2N A;  1MXV A;  1O7T A;  2THI A;  4IY5 A;  4BLA A;  1I6B A;  4YKP A;  3DLN A;  5JTY A;  3CI8 A;  2OZZ A;  2RIN A;  5I59 B;  4YMB A;  2XXY A;  4O3A A;  2VGQ A;  3RT8 A;  2QJE A;  1UTH A;  3TCG A;  4KYE A;  4XTC Q;  2H4I A;  4OFL A;  4JDF A;  4H8J A;  3IOU A;  3CRB A;  3KBR A;  3VLV A;  1N04 A;  1IXI A;  2R71 A;  3H6U A;  2ZXT A;  3H03 A;  3KJT A;  2V25 A;  2ZYM A;  2R6G E;  5IKB A;  3VLU A;  1M5D A;  4ZDM A;  2NWJ A;  4IB2 A;  1UQW A;  3N6T A;  3SER A;  3KFM A;  1P1Q A;  3IOW A;  3CG3 A;  1N0T A;  2ANJ A;  3RTF B;  5EHM A;  1DPP A;  4KCC A;  3OD7 A;  5A5X B;  2P0S A;  2QPQ A;  4LVQ A;  1Y1M A;  1ELJ A;  1ZTY A;  4EUO A;  1TFA A;  2Z8E A;  4EQB A;  1A55 A;  5M2V A;  1LST A;  2D5W A;  1I6Q A;  1PBQ A;  2AL4 A;  5IAI A;  1MM6 A;  2NVU B;  4GD5 A;  1LBC A;  3CFZ A;  1AIV A;  4RK9 A;  1JQF A;  4IO4 A;  1IIT A;  2O84 X;  5I2N B;  4F3G A;  5I56 A;  4WEP A;  1UTB A;  5ICT A;  3FV1 A;  1LCT A;  3H6T A;  4LP2 B;  3IOT A;  5DYH A;  1UTH B;  3TEL A;  3V5A A;  5H8Q A;  3M3K A;  5H8S A;  1QW0 A;  3E4R A;  2G93 A;  1N3X A;  2RC8 A;  1A7L A;  4H0W A;  1D4N A;  3O97 A;  4G2Z A;  4HW8 A;  3C33 A;  4AB5 A;  2VOZ A;  2VHA A;  2OK2 A;  3UA8 A;  1D9Y A;  1FTJ A;  2B3B A;  2P2A A;  1R1N A;  4PQJ A;  3KSX A;  3FGS A;  3CVG A;  3CSG A;  2H5Y A;  4Q0C A;  3RNN A;  2ZMB A;  4RY1 A;  4JSO A;  1MXU A;  3PMW A;  4I62 A;  4BDM A;  4H5G A;  1HSL A;  2HQ0 A;  2O7I A;  4NWD A;  2QS1 A;  5F7V A;  3OO6 A;  2GH9 A;  3A09 A;  1CB6 A;  3CFL A;  4JSD A;  4BDL A;  3RN8 A;  2Q89 A;  1MRP A;  5JK4 A;  4KQP A;  3K02 A;  2FNC A;  1SQY A;  2ZYN A;  3L6G A;  4IO3 A;  4YIC A;  3U1O A;  2BJJ X;  4ZZA A;  1RYX A;  4ELO A;  3KGC A;  5DTB A;  5KZT A;  2F36 A;  4R2F A;  1O63 A;  5I56 B;  3H3G A;  4KCD A;  4P0G A;  5KDT A;  1Y4T A;  1UTB B;  1QUI A;  1NL5 A;  3ILU B;  3RUM A;  3OSR A;  1KWH A;  3FVG A;  2PVU A;  3BFU A;  2UVI A;  5I2K A;  3OEL A;  3QK6 A;  3DM0 A;  3AXF A;  3H6V A;  2DOJ A;  1N3W A;  4QSD A;  1MXX A;  5KCJ B;  1VR5 A;  2HEU A;  2QSX A;  3QYT A;  2Q88 A;  3VXC A;  2UXA A;  1B3H A;  1URD A;  4ECF A;  1B1H A;  2QS4 A;  3RY3 A;  2XD3 A;  2HZK A;  1SW2 A;  1L5T A;  4U4S A;  2XXU A;  3TDJ A;  3EN3 A;  4C1T A;  4DCX A;  1Z7N E;  1LAF E;  1SI0 A;  3PUW E;  4U1Z A;  4M1V A;  3K6X A;  1EZ9 A;  3Q29 A;  3V8X B;  3SEW A;  3R7X A;  1M5E A;  3PV0 E;  4F2O A;  1WOD A;  4U22 A;  2HAV A;  4YB7 A;  4XXU A;  4OER A;  2UVH A;  5DVI A;  1B0H A;  5CMC A;  4R6K A;  1WVJ A;  1MXW A;  4GRK A;  1MY3 A;  4PE5 B;  4ZEK A;  1B52 A;  1NNT A;  2G29 A;  1Y9U A;  2DP8 A;  3MBP A;  2F97 A;  3B6Q A;  2FYI A;  4H8I A;  5ITP A;  5I2K B;  3M8U A;  3PUZ E;  2UYE A;  5FHO A;  3RGY A;  2YJP A;  4RJZ A;  5DT6 A;  3JV9 A;  2RCB A;  5DVJ A;  4OEU A;  1OIB A;  3MPK A;  2X26 A;  2A5T A;  3S9L C;  3U94 A;  1LCF A;  2PT1 A;  3G3K A;  2I48 A;  4OVJ A;  5H8H B;  3KJ7 A;  1PB7 A;  1OVT A;  2I4C A;  1MXZ A;  1YCJ A;  1HSJ A;  3S9E A;  5CMM A;  3G3F A;  4JWY A;  3C35 A;  4OFO A;  1LBB A;  3KEI A;  3EPE A;  4U23 A;  3O6H A;  1MPB A;  3T66 A;  3IB2 A;  3V89 B;  4ESX A;  2O69 A;  3H06 B;  5FTH A;  4IGR A;  2I58 A;  1Q1K A;  3TCH A;  4FJP A;  1P1N A;  3LSW A;  3KG2 A;  2AYS A;  3PMX A;  1VE4 A;  4PFU A;  1H45 A;  3PUV E;  2Y7P A;  3MVZ A;  2QS3 A;  1Y3N A;  4OQO A;  4DZ1 A;  4OEV A;  2Y7W A;  4QFO A;  3N26 A;  4TLL B;  3B6T A;  2XXR A;  1FQC A;  3IB0 A;  2Y7K A;  1YTV A;  1PDA A;  2F6P A;  2DWA A;  4ZEB A;  2REG A;  4MLQ A;  1P99 A;  1J1N A;  1XT8 A;  4LZ7 A;  1Y4C A;  1M5F A;  4G4P A;  1B3E A;  3OMB A;  4I9D A;  5ICQ A;  1USY H;  4I1D A;  1B46 A;  4DXC A;  1N84 A;  1B32 A;  4DXB A;  3R26 A;  4ZEC A;  2REJ A;  2CMO A;  1UIU A;  3ILT B;  4Z0I A;  2DVZ A;  3A3U A;  1IQ7 A;  3PD9 A;  3HHG A;  2DYX A;  4ELR A;  3OOA A;  3MWB A;  3SEY A;  5AA2 A;  4ZEI A;  2O7U A;  4F18 A;  2Y84 A;  1EH3 A;  4F1Y A;  2F8D A;  3ONM A;  1FQB A;  2OLB A;  4NF5 A;  5CBR A;  2V3U A;  3TZA A;  2ONS A;  2HZL A;  4F19 A;  3S2V A;  1OLC A;  1H44 A;  2CZL A;  5F1Q A;  4GQO A;  3B7D A;  4ELP A;  2PYY A;  1VFD A;  4ND9 A;  4EDP A;  4HTG A;  4QSC A;  1FQD A;  5L9S A;  4ESW A;  4DLD A;  1F9B A;  4R75 A;  2E0S A;  3QAX A;  1MQI A;  3TCF A;  2IA4 A;  1USY E;  3C32 A;  2QRY A;  4HCY A;  3DP8 A;  3UGW A;  1DPE A;  1VSO A;  4RK2 A;  3P7I A;  2GFE A;  5FHM A;  5LOM A;  4DDD A;  4KFQ A;  5H8N A;  1NNF A;  3FJ7 A;  4DCY A;  3USD A;  4NTL A;  1A8E A;  3ODB A;  2Q2A A;  1TFD A;  3K6V A;  2UYF A;  4GFR A;  3O28 A;  3N5L A;  1B5J A;  4LAT A;  1AL3 A;  2QS2 A;  3WAE A;  4R9F A;  1PC3 A;  3UN6 A;  1S50 A;  2NUV A;  4YZZ A;  2O68 A;  3BBR A;  3TOD A;  3MVW A;  5JEI A;  4OET A;  1QUJ A;  5H8F A;  4OWD A;  1US5 A;  2Z23 A;  4F29 A;  2RKM A;  4H5F A;  3TTL A;  4TOZ A;  1GV8 A;  1P1U A;  1MY1 A;  4KYS A;  5B70 A;  1BLF A;  4U21 A;  4FEC A;  2Q9T A;  3K00 A;  4Q30 B;  3RQT A;  3TAJ A;  4BDN A;  4TLM B;  4MH5 A;  3VVD A;  3KSJ A;  4LA9 A;  2I3W A;  4E0W A;  3TFL A;  1NNP A;  5JTY B;  2O1L A;  4H67 A;  4BDO A;  4F3S A;  1B58 A;  4R74 A;  3IL1 B;  5HPQ A;  4NF8 A;  4FEB A;  5AE4 A;  1QVS A;  3C4M A;  3GBB A;  3E9X A;  4RXL A;  2O1M A;  2E1S A;  3KN8 A;  2PT2 A;  3T22 A;  1DMB A;  1LAG E;  2ABH A;  5H8N B;  4N07 A;  5HM4 B;  1US4 A;  1BTJ A;  4KI0 E;  3B6W A;  2KLF A;  4U4X A;  4K3F A;  4NF6 A;  1B7U A;  4NWC A;  4FAJ A;  1JEU A;  1SDX A;  3TTK A;  3T9X B;  5AA2 D;  4NF4 A;  4GL0 A;  2Z8D A;  4TQU Q;  1MPD A;  3UP9 A;  2NXO A;  1AMF A;  1MPC A;  3KZG A;  1LFH A;  3TUS A;  5H8F B;  3U92 A;  3TEP A;  4G68 A;  3UK4 A;  1MQH A;  3VFJ A;  4E0X A;  3THI A;  3T9U A;  2QL3 A;  2R9J A;  3QUJ A;  1GVC A;  3VDF A;  1IXH A;  4QFN A;  1ZLQ A;  4YMA A;  3G3I A;  3MUQ A;  3ECR A;  5L8D A;  5I57 A;  3GBA A;  1JNF A;  3C31 A;  1IEJ A;  1IZ1 A;  1LB9 A;  3RLF E;  4XKN A;  3CR9 A;  1JVY A;  1ANF A;  1N7X A;  2RF1 A;  3G7W A;  3C36 A;  2F35 A;  1IIW A;  5H8Q B;  2Y7R A;  2V3Q A;  2YLN A;  2PBW A;  4G68 C;  2Z8F A;  1IXC A;  1SI1 A;  3ZKK A;  4EF1 A;  3UIF A;  1NH7 A;  5DEX A;  3M3L A;  4IY6 A;  3K0V A;  3FXQ A;  1B40 A;  5BWJ A;  1SD3 A;  3O66 A;  1H43 A;  2XHD A;  4F2Q A;  4POW A;  1S7Y A;  1A40 A;  4NF6 B;  1DSN A;  4C1U A;  3K2D A;  3C9H A;  1Q35 A;  1QJM A;  4NF4 B;  2XXX A;  4HS7 A;  3S4U A;  1LAH E;  1R9L A;  3FJM A;  1JET A;  1JW1 A;  1B05 A;  1Y3Q A;  5B7D A;  3E3K A;  3VVF A;  2I0B A;  3G3J A;  2I0C A;  1Z7M E;  2QMW A;  4BDQ A;  2Z22 A;  5EYF A;  3K4U A;  5TP9 A;  3TQL A;  2F34 A;  4KYD A;  2X7Q A;  1I6A A;  5I84 A;  1P1O A;  1OQH A;  4P0I A;  1POY 1;  3OO9 A;  1II5 A;  1NFT A;  4F3P A;  1CE2 A;  2F6G A;  4R9G A;  1ZIU A;  1D9V A;  3TMG A;  4EQ9 A;  1XOC A;  5KDT B;  3I3V A;  2FA7 A;  3MVY A;  2HCA A;  5AA1 A;  4THI A;  1H3D A;  2A5S A;  2H99 A;  2F7B A;  3U72 A;  3LR1 A;  1JVX A;  3KN7 A;  4HCW A;  2M8C A;  3CFX A;  3GXA A;  3SDF A;  4FE8 A;  3Q26 A;  2VD2 A;  1N76 A;  4OZ9 A;  5ISU A;  3BKI B;  2UVJ A;  4XKR A;  3EHS A;  1OMP A;  1FQA A;  1P1W A;  3KN3 A;  1FTM A;  3MZ9 A;  2RCA A;  3JZJ A;  4F22 A;  3JYR A;  3EQ1 A;  2F5X A;  2I49 A;  4O3C A;  1GGG A;  1R6Z A;  3PPQ A;  2F7A A;  3IO4 A;  1AOV A;  3W9W A;  1Y20 A;  3I6V A;  1QUL A;  5DVF A;  1MG1 A;  3D4G A;  5L9O A;  4X1B A;  3OXN A;  4OES A;  5ELV A;  3SEU A;  1O64 A;  1WDN A;  5TP9 B;  3HST A;  4FAT A;  1EU8 A;  4IO2 A;  1URG A;  4ZE9 A;  1B1X A;  3T93 B;  4LZ8 A;  5CMK A;  3FJG A;  3T9H B;  2XXV A;  2H25 A;  2V3T A;  5CRY A;  4JBZ A;  4PP0 A;  2I4B A;  5CM6 A;  1R9Q A;  1ZBM A;  3OO7 A;  1NH8 A;  3S9N C;  3VE1 B;  4JWX A;  4P11 A;  3M3F A;  1XVX A;  5EHS A;  4PFT A;  3FIR A;  2DE2 A;  3MVX A;  2Y7I A;  1OQG A;  3SEX A;  1FQE A;  3FAS A;  4PET A;  3PPR A;  1B3L A;  4IO6 A;  1EZO A;  2A5T B;  4H65 A;  5CI5 A;  1TT1 A;  1AH5 A;  2XX7 A;  4EXL A;  3HPI A;  1SYI A;  3MP8 A;  1UIV A;  1MH4 A;  4WKM A;  4ELQ A;  3ZSF A;  5I58 A;  3GZG A;  1QUK A;  4POX A;  2B65 A;  1LB8 A;  5CMB A;  2RC9 A;  3KOS A;  3I5O A;  1FTL A;  3OSQ A;  3LSF B;  4BDR A;  3MAM A;  1ZMG A;  4XKP A;  1Y1Z A;  4I8C A;  2HXW A;  1ATG A;  5TPA A;  1DOT A;  1FTK A;  2DXR A;  4OTE A;  4MFI A;  1B0L A;  2DXY A;  4LUB A;  1D3K A;  2DWJ A;  2XXI A;  4QSE A;  4DXU A;  3V83 A;  4QFP A;  2XXQ A;  2ONK E;  4ZED A;  3CIJ A;  3LC8 A;  2VP1 A;  4OMB A;  3PD8 A;  4DE8 A;  3O6G A;  1N7W A;  3IO6 A;  4QFL A;  4WED A;  4WXJ A;  1IUD A;  3UOR A;  4JB7 A;  3A3C A;  4G8N A;  4ZEF A;  1POT A;  3MC2 A;  4XKQ A;  3VVE A;  3CG1 A;  5I58 B;  4GL8 A;  2OBG A;  3TTR A;  2ZNU A;  4OYV A;  3TPA A;  3W15 C;  5FTI A;  3E13 X;  5AA2 B;  3R6U A;  2OJT A;  1YAE A;  1RYO A;  1VFE A;  2GRV A;  2OCU A;  3PUY E;  3ZS6 A;  3TYH A;  1MDP 1;  4LZ5 A;  3CSB A;  1B4Z A;  4NF5 B;  1GTK A;  2DE3 A;  4FED A;  2H98 A;  4XIG Q;  2ZNT A;  5TPA B;  4YAH X;  4PFW A;  4G8H A;  3N6U A;  3FVK A;  2AL5 A;  3O6I A;  1MS7 A;  3MPL A;  4NE4 A;  3T96 B;  1SYH A;  4KR5 A;  2XD2 A;  2I6E A;  3SES A;  2D3I A;  3DP6 A;  4YB6 A;  3OEM A;  4FIM A;  2DQV A;  1M5B A;  3LBS A;  4F1V A;  2XXT A;  1MH3 A;  3EF7 A;  2GHB A;  3IAZ A;  1NKX A;  3IK6 B;  3RT6 B;  5AA4 A;  1DTZ A;  4IO5 A;  3IJX B;  1MY4 A;  3IOV A;  4OHN A;  5K2X A;  2HFB A;  4H1X A;  3FVO A;  5KCJ A;  2ALU A;  4AQ4 A;  3PMV A;  1M5C A;  3MP6 A;  3SEV A;  2V93 A;  4EF2 A;  4MLV A;  1PB9 A;  1B7Z A;  2LAO A;  1YPN A;  1SW5 A;  5ITO A;  2YPN A;  3MZB A;  2O6A A;  4GXS B;  3N94 A;  4R73 A;  4KD5 A;  1FCK A;  4G77 A;  2I3V A;  1SW4 A;  4X48 A;  4PFY A;  2ONR A;  2AIX A;  2NOO A;  4GWO A;  1LGB C;  3IR1 A;  3PPP A;  3MW0 A;  4L17 A;  1PBP A;  1SW1 A;  1A54 A;  1FW0 A;  2ESN A;  4RA1 A;  4IO7 A;  3FZV A;  4ZS9 A;  3FUZ A;  4EQ7 A;  3PPO A;  4U1O A;  1LFI A;  4F3B A;  2IEE A;  5K2Y A;  3EHU A;  4EXK A;  1B5H A;  3HHF A;  4YKK A;  1B7H A;  1PEB A;  4NF8 B;  3G3G A;  2PMS A;  4F1U A;  4QHQ A;  4YU0 A;  3K1N A;  3H6W A;  1B5I A;  1B6H A;  4LQ5 A;  4GOT A;  3HN0 A;  5BUU A;  1MY0 A;  2Q2C A;  4GIZ A;  4MF3 A;  3FVN A;  3F11 A;  3MQ9 A;  5AA4 B;  2ZNS A;  1GR2 A;  2F7C A;  1B3G A;  4G8M A;  3HV1 A;  5AA3 A;  3OEK A;  1XC1 A;  4C0R A;  3TQW A;  1MY2 A;  2OWS A;  4NMY A;  4F31 B;  1B3F A;  2P1S A;  3EHT A;  4GLI A;  1NNK A;  4R6Y A;  4ZZE A;  3WAF A;  3FXU A;  2XX9 A;  5H8H A;  4ONY A;  3SKP A;  4H6D A;  3U93 A;  2HAU A;  4G68 B;  3LSL A;  1B2H A;  4Q8R A;  4FOR A;  2F78 A;  3KOT A;  3T9V A;  4X9T A;  5TU0 A;  1RKM A;  4Z7E A;  3QXM A;  4R6H A;  1MDQ A;  5J1D A;  3IOR A;  1FTO A;  4M4G A;  1ZKB A;  5I57 B;  1LAX A;  3GLB A;  1HSE A;  2H9B A;  1XVY A;  2XXH A;  3FAT A;  1JW4 A;  3VLW A;  2W7Y A;  3S9M C;  3TKD A;  3O9P A;  3TTN A;  3HCQ A;  4RNS A;  3L6H A;  1LFG A;  2DWI A;  3QUF A;  2DSF A;  3VXB A;  4NED A;  1OVB A;  3IJO B;  2O51 A;  3ZKL A;  4DIG A;  4OXV A;  4R2B A;  4JXI A;  4RPN A;  1BKA A;  2B3F A;  5DEX B;  3LUY A;  4YKJ A;  1I69 A;  5CBS A;  2RC7 A;  2UVG A;  4KPT A;  1MQJ A;  5FHN A;  3K6W A;  3QIM A;  1ZJL A;  1LLS A;  1QKA A;  2V84 A;  2OWT A;  2QMX A;  3MJN A;  3K01 A;  2D21 A;  2X7P A;  1Y3P A;  1TWY A;  3O2A A;  3IX1 A;  3FD3 A;  3OO8 A;  1XS5 A;  1URS A;  1B4H A;  4GF8 A;  4UAC A;  1OLA A;  2XXP A;  1S9T A;  1FQF A;  3Q27 A;  1SVX B;  4GXA A;  3TTM A;  3O29 A;  3FV2 A;  2DS9 A;  3MP1 A;  2XXW A;  4U2R A;  2ZYK A;  4GVO A;  4AB6 A;  4F39 A;  4OEN A;  5CC2 A;  4RYA A;  3IB1 A;  3K1P A;  1PB8 A;  1SBP A;  4YB5 A;  3QSL A;  4UA8 A;  2XX8 A;  1XHY A;  3PU5 A;  4N6P A;  4LQ2 A;  2WKY A;  3K1M A;  1BIY A;  4Q5T A;  1QKB A;  2VD3 A;  2DWH A;  3DEL B; 
#chains in the Genus database with same CATH topology
 1A8F A;  4IGT A;  2LTR A;  1JEV A;  3DP4 A;  2DLQ A;  2EM8 A;  1MM7 A;  1ZU0 A;  4NXM E;  1TXF A;  3PPN A;  3PUX E;  1YUI A;  2ZYO A;  4DV4 E;  1B9J A;  2ZM6 E;  1BP5 A;  5I59 A;  4GKK E;  2QVU A;  5AE1 A;  3LSX A;  3Q25 A;  4JWO A;  4RPO A;  1MQG A;  4NF0 A;  3Q28 A;  1JW5 A;  1MQD A;  4PDD A;  1H76 A;  4GWS A;  3DF6 A;  3RPL A;  4R72 A;  3HO7 A;  3H09 A;  4QFK A;  2EMZ A;  4WPY A;  4ISU A;  4GWX A;  3U8Q A;  2B9D A;  2GHA A;  4P78 A;  2EPM X;  3PGF A;  3G3H A;  2YRM A;  1IQS A;  5L9M A;  2A25 A;  2DRP A;  1YYK A;  2HGH A;  3RPW A;  3RTW B;  3EKI A;  1A99 A;  3W9V A;  5ET6 A;  3VV5 A;  4N6K A;  1FPI A;  1NV4 A;  1EZP A;  1NMU A;  5AC4 A;  1LBY A;  5F24 A;  4LON B;  5A5X A;  2V86 A;  4N13 A;  3H4Z A;  1DK4 A;  3D4C A;  2EM6 A;  1J5E E;  2VQE E;  2DB2 A;  5I7I A;  2Q8J A;  4PFI A;  4YKI A;  1DTG A;  4MBP A;  4X62 E;  4B3S E;  4DR7 E;  4QRZ A;  5IWA E;  3K6U A;  3BFT A;  4MNI A;  4QF9 A;  1T0K A;  2WBS A;  2PX1 A;  3JAM C;  1IXG A;  3OEN A;  4X1D A;  4ZE8 A;  3SET A;  2DVC A;  3H7M A;  1FBF A;  3FXR A;  2FIX A;  5HBC A;  4JYA E;  2YTG A;  3C34 A;  1MXY A;  3MZ1 A;  4O3B A;  4OFJ A;  4L8N A;  3QMF A;  4KHZ E;  2DE4 A;  5ESY A;  1B51 A;  5I2N A;  1MXV A;  5ET7 A;  1O7T A;  1UN6 B;  5KL3 A;  2EP3 A;  4FK5 C;  2THI A;  4IY5 A;  4BLA A;  4JV5 E;  1I6B A;  4YKP A;  3DLN A;  5JTY A;  3CI8 A;  2WYP A;  2OZZ A;  2RIN A;  5I59 B;  4YMB A;  1FSA A;  2XXY A;  5EQ8 A;  4O3A A;  2VGQ A;  3RT8 A;  2QJE A;  3HXL A;  1UTH A;  4BC9 A;  2VRD A;  5KL2 A;  3TCG A;  4DV7 E;  4KYE A;  4XTC Q;  2H4I A;  5FLX C;  2JJK A;  2ZZW A;  2UUA E;  4OFL A;  2YTP A;  5KL6 A;  4I3E A;  4JDF A;  4MCO A;  4H8J A;  3IOU A;  4PCD A;  3CRB A;  3KBR A;  3VLV A;  1N04 A;  4N4U A;  2EMK A;  1IXI A;  2R71 A;  3H6U A;  2ZXT A;  4OVR A;  2EOY A;  3H03 A;  2EMC A;  3KJT A;  2V25 A;  2YWQ A;  3C4T A;  2ZYM A;  5TSE A;  2R6G E;  1KA1 A;  5IKB A;  3VLU A;  1M5D A;  4ZDM A;  2NWJ A;  4IB2 A;  1UQW A;  3N6T A;  3SER A;  2NAB A;  4XF5 A;  3KFM A;  1P1Q A;  3IOW A;  2LO3 A;  3CG3 A;  1N0T A;  2ANJ A;  3RTF B;  2L2M A;  5EHM A;  2JP9 A;  4GBW A;  1DPP A;  2EN4 A;  4KCC A;  1IMF A;  3OD7 A;  5A5X B;  2P0S A;  2QPQ A;  4LVQ A;  1EH7 A;  1ELJ A;  1Y1M A;  1ZTY A;  5F3W A;  1A1G A;  4EUO A;  1X47 A;  3FBP A;  1TFA A;  2HJJ A;  2Z8E A;  1WHN A;  2YTJ A;  1YSA C;  2EPC A;  1XNR E;  4EQB A;  2EQ0 A;  1A55 A;  5M2V A;  2CSH A;  1LST A;  2D5W A;  4HXV A;  2LT7 A;  1I6Q A;  2L2N A;  1D9Q A;  1PBQ A;  2AL4 A;  3KWR A;  5IAI A;  3BF2 A;  3T1H E;  1IMC A;  1MM6 A;  2NVU B;  2EE8 A;  3BIH A;  4GD5 A;  4AS5 A;  2XWK A;  1EYJ A;  2EM4 A;  1LBC A;  1NEI A;  2EOI A;  3CFZ A;  1AIV A;  4RK9 A;  1JQF A;  4IO4 A;  1DCU A;  1IIT A;  2O84 X;  5LLQ A;  1DQ3 A;  5I2N B;  4F3G A;  5I56 A;  4GZN C;  4WEP A;  3OML A;  1UTB A;  4DR1 E;  4AS4 A;  1STU A;  4R8O A;  5ICT A;  2JVA A;  1YXI A;  1SPI A;  3FV1 A;  1LCT A;  3H6T A;  4LP2 B;  3IOT A;  5DYH A;  2RSM A;  1UTH B;  2CPN A;  3TEL A;  3V5A A;  1QGX A;  5H8Q A;  3M3K A;  5H8S A;  1QW0 A;  2EOJ A;  3E4R A;  2L6M A;  2BJI A;  4PAF A;  4JI1 E;  2G93 A;  1N3X A;  2WCC 3;  2RC8 A;  1A7L A;  4H0W A;  1D4N A;  3O97 A;  4G2Z A;  4HW8 A;  3C33 A;  4NAP A;  4O24 A;  3J80 C;  4AB5 A;  2VOZ A;  1FBG A;  2VHA A;  4F9C B;  2OK2 A;  1LBZ A;  3UA8 A;  1D9Y A;  1X5W A;  1FTJ A;  2EOS A;  4JI0 E;  1NUX A;  2B3B A;  1IBM E;  2P2A A;  1R1N A;  4PQJ A;  4GEQ B;  2PRT A;  2M7Q A;  4N6D A;  4PBH A;  3KSX A;  2CT1 A;  2E72 A;  2EOX A;  2K4V A;  3FGS A;  3CVG A;  3CSG A;  2H5Y A;  4Q0C A;  2R1F A;  3RNN A;  2RS7 A;  2ZMB A;  2LJH A;  1KZ8 A;  4RY1 A;  4JSO A;  4OX9 E;  4JVC A;  1MXU A;  4DR4 E;  3HPZ A;  3PMW A;  1JK2 A;  4I62 A;  3EPL A;  4BDM A;  4X65 E;  4H5G A;  1HSL A;  2HQ0 A;  2O7I A;  4GWW A;  4NWD A;  2QS1 A;  5F7V A;  4WXC A;  1NV5 A;  3OO6 A;  1X3C A;  2GH9 A;  3A09 A;  1CB6 A;  4P7D A;  2V8Q B;  1FBD A;  3CFL A;  4JSD A;  4BDL A;  3RN8 A;  2Q89 A;  1MRP A;  4KXP A;  2LTS A;  1QU6 A;  2HXR A;  2DMI A;  5JK4 A;  4KQP A;  3K02 A;  1LBX A;  2FNC A;  3VYY A;  2EL4 A;  1SQY A;  2ZYN A;  3QG5 C;  5A5L A;  4MHF A;  1MGT A;  2KHX A;  3L6G A;  4IO3 A;  4YIC A;  3U1O A;  2BJJ X;  4ZZA A;  4PAK A;  2EM2 A;  1RYX A;  4ELO A;  3KGC A;  1JP4 A;  5DTB A;  5KZT A;  3J81 C;  2F36 A;  4R2F A;  1O63 A;  5I56 B;  4LF8 E;  3H3G A;  4OOG C;  4KCD A;  4OVQ A;  1IME A;  4P0G A;  1X6F A;  5KDT A;  3C4B A;  1Y4T A;  1FBE A;  3J7A G;  1UTB B;  2EOE A;  1QUI A;  1NL5 A;  3ILU B;  3RUM A;  3OSR A;  1KWH A;  1HNX E;  2WBD A;  3IWB A;  1HNW E;  3FVG A;  2GQ1 A;  4I3Y A;  2PVU A;  5AE3 A;  1L4S A;  1FPJ A;  3BFU A;  2UVI A;  5I2K A;  3OEL A;  3QK6 A;  3DM0 A;  4LFB E;  3AXF A;  3H6V A;  2DOJ A;  1N3W A;  5BR8 E;  4QSD A;  1MXX A;  5KCJ B;  1VR5 A;  2HEU A;  2JY9 A;  2QSX A;  3QYT A;  1FJG E;  2L33 A;  2Q88 A;  3VXC A;  2UXA A;  1B3H A;  2EMY A;  1XNQ E;  1URD A;  4PC9 A;  5ET5 A;  4ZYH A;  1T4L B;  4ECF A;  4M30 A;  1B1H A;  2QS4 A;  3RY3 A;  4DV2 E;  2XD3 A;  2HZK A;  4DKK A;  2EMG A;  4O4K A;  1SW2 A;  4DUY E;  4X66 E;  1NV0 A;  1UIL A;  4U4S A;  1L5T A;  2XXU A;  1BB8 A;  3MYU A;  3TDJ A;  5J16 A;  3EN3 A;  1FPE A;  4C1T A;  5A6K A;  2ELZ A;  2NA2 A;  5I5P A;  4DCX A;  1PJT A;  1Z7N E;  1LAF E;  1SI0 A;  3PUW E;  4U1Z A;  4M1V A;  3K6X A;  4PGP A;  1EZ9 A;  1YZ9 A;  3Q29 A;  1HR0 E;  2R8T A;  1J26 A;  3V8X B;  2JWO A;  3SEW A;  3R7X A;  1M5E A;  2JOB A;  3PV0 E;  4H45 A;  4F2O A;  1WOD A;  4O7M A;  4F2J C;  4U22 A;  5LMN E;  2F8B A;  2HAV A;  4XXU A;  4OER A;  4YB7 A;  1CNQ A;  3P1X A;  2UXD E;  2UVH A;  4MJO A;  4PAI A;  2M1S A;  5DVI A;  1B0H A;  5IV8 B;  2MKN A;  5CMC A;  4DV3 E;  4R6K A;  1WVJ A;  1MXW A;  2KQZ A;  4GWY A;  4GRK A;  1MY3 A;  4PE5 B;  4ZEK A;  1B52 A;  1NNT A;  2G29 A;  1Y9U A;  2DP8 A;  3MBP A;  2EM3 A;  5EYH A;  2F97 A;  3B6Q A;  4DV6 E;  2FYI A;  2EMA A;  2RTX A;  3HQ1 A;  4DR6 E;  4H8I A;  5ITP A;  2UUC E;  4JI6 E;  2WEF A;  5I2K B;  3M8U A;  4QXD A;  4P8B A;  3PUZ E;  2UYE A;  4PFB A;  2JOX A;  5FHO A;  1T38 A;  1INP A;  4NN3 A;  3RGY A;  2YJP A;  4RJZ A;  5DT6 A;  1IQO A;  1BK4 A;  3JV9 A;  2RCB A;  2N3G A;  5DVJ A;  4OEU A;  1OIB A;  3MPK A;  2DLK A;  2X26 A;  2A5T A;  1NV2 A;  3S9L C;  3U94 A;  1LCF A;  2PT1 A;  3G3K A;  2I48 A;  4OVJ A;  4F54 A;  1NCS A;  1G0I A;  5H8H B;  4OAN A;  3KJ7 A;  1FJ6 A;  4NHR A;  1PB7 A;  1OVT A;  2I4C A;  1MXZ A;  1YCJ A;  4YHH E;  1HSJ A;  3S9E A;  4JI5 E;  4OVP A;  5CMM A;  3G3F A;  4JWY A;  3C35 A;  2LUP B;  4N8G A;  4OFO A;  1LBB A;  3KEI A;  4PE3 A;  3EPE A;  4U23 A;  3O6H A;  4LTY A;  1MPB A;  5EQA A;  3T66 A;  3IB2 A;  4BHB A;  3V89 B;  4ESX A;  2O69 A;  3H06 B;  4BHC A;  5FTH A;  4IGR A;  2I58 A;  1Q1K A;  3TCH A;  2EPL X;  2RPC A;  1N3G A;  4FJP A;  1P1N A;  1DI2 A;  4O5G A;  3LSW A;  3MHS C;  3KG2 A;  2LBS B;  2AYS A;  1WRJ A;  3PMX A;  1VE4 A;  2QFL A;  2Y5K A;  4HE1 A;  1H45 A;  3PUV E;  4PFU A;  4R03 A;  2Y7P A;  3MVZ A;  2QS3 A;  3F6H A;  1Y3N A;  4OQO A;  4DZ1 A;  4OEV A;  1RC7 A;  2Y7W A;  2EPX A;  4QFO A;  3N26 A;  4TLL B;  3B6T A;  2XXR A;  1FQC A;  3IB0 A;  4MIJ A;  2Y7K A;  1YTV A;  4XEQ A;  1PDA A;  2F6P A;  4N4R B;  5A2Q C;  2OWZ A;  2EOQ A;  1DGC A;  2DWA A;  4ZEB A;  2REG A;  4MLQ A;  1SFE A;  1P99 A;  1J1N A;  1XT8 A;  4LZ7 A;  2UU9 E;  1Y4C A;  1M5F A;  3EPJ A;  2B3T B;  4R2E A;  4G4P A;  1B3E A;  4NQ8 A;  2EZ6 A;  3OMB A;  3J7Y p;  2WZO A;  4I9D A;  4JI8 E;  2LJU A;  5ICQ A;  1USY H;  4I1D A;  2E5L E;  2L8T A;  1B46 A;  4DXC A;  1N84 A;  1B32 A;  4DXB A;  4BC7 A;  2XWV A;  4DR3 E;  3R26 A;  2ADR A;  4FBP A;  4ZEC A;  2NUF A;  2REJ A;  2CMO A;  1X49 A;  1UIU A;  3ILT B;  4Z0I A;  2DVZ A;  2LUQ A;  3A3U A;  4N91 A;  2WYK A;  2EMH A;  1IQ7 A;  3PD9 A;  2DSY A;  5IM2 A;  3HHG A;  3ZOQ B;  2DYX A;  3F6G A;  4P47 A;  1G2D C;  4ELR A;  3OOA A;  3E79 A;  4M9V C;  3MWB A;  3SEY A;  5AA2 A;  4ZEI A;  2O7U A;  2MDG A;  4F18 A;  2Y84 A;  4X8R A;  1EH3 A;  1A1K A;  4F1Y A;  1PJS A;  2DMY A;  2F8D A;  3ONM A;  2OLB A;  1FQB A;  1ZBT A;  4NF5 A;  5CBR A;  2V3U A;  3TZA A;  5IZ3 A;  2ONS A;  2HZL A;  2XA5 A;  3B50 A;  4F19 A;  3S2V A;  4PF6 A;  2YTI A;  3JU0 A;  1H44 A;  1OLC A;  5AC5 A;  4WSG A;  2CZL A;  5F1Q A;  4GQO A;  3B7D A;  4ELP A;  1ZBQ A;  3PTY A;  2PYY A;  2V88 A;  4DR2 E;  1VFD A;  4ND9 A;  4EDP A;  5A6B D;  4HTG A;  4QSC A;  1FPF A;  1FQD A;  4WX9 A;  5L9S A;  4ZYG A;  3IWC A;  4ESW A;  1Z1B A;  2V4C A;  4DLD A;  2P3V A;  1F9B A;  2L3J A;  4R75 A;  2E0S A;  2Q74 A;  3QAX A;  1MQI A;  1F2I G;  2E1M A;  4X9J A;  3TCF A;  3FIG A;  2IA4 A;  1USY E;  1FKA E;  3C32 A;  2QRY A;  4HCY A;  3RPL B;  1XMO E;  2QVV A;  3DP8 A;  1ZU1 A;  2EPA A;  3UGW A;  1DPE A;  1VSO A;  4RK2 A;  3P7I A;  2GFE A;  5FHM A;  4OA4 A;  5LOM A;  4DDD A;  4KFQ A;  5H8N A;  1NNF A;  3FJ7 A;  4IJD A;  4DCY A;  3USD A;  4NTL A;  2ELY A;  1A8E A;  3ODB A;  2Q2A A;  1TFD A;  3K6V A;  2PFZ A;  2UYF A;  2PCR A;  4GFR A;  3O28 A;  1N32 E;  3N5L A;  2BBG A;  1B5J A;  5LTC A;  2YRK A;  4LAT A;  1AL3 A;  3BID A;  2QS2 A;  3WAE A;  1TF6 A;  4R9F A;  1PC3 A;  2YTN A;  3UN6 A;  1S50 A;  2NUV A;  4YZZ A;  2O68 A;  2RQL A;  3BBR A;  2ENH A;  3MVW A;  3TOD A;  4OVS A;  5I3S A;  1UBD C;  5JEI A;  4OET A;  5A69 A;  1QUJ A;  1A1L A;  1NV1 A;  5H8F A;  4PBQ A;  4R2R A;  4OWD A;  5A6J A;  1US5 A;  2FVZ A;  2Z23 A;  4K0K E;  3FXB A;  4F29 A;  5IZ3 B;  2RKM A;  2YSO A;  4H5F A;  2I9I A;  2M9A A;  3TTL A;  4TOZ A;  1GV8 A;  2GLI A;  1WXR A;  1P1U A;  2EN3 A;  1MY1 A;  4KYS A;  5B70 A;  1BLF A;  4U21 A;  4FEC A;  2Q9T A;  3K00 A;  4Q30 B;  5LMU E;  3RQT A;  3TAJ A;  4BDN A;  1A1J A;  2EMX A;  2YU8 A;  1LEV A;  4MH5 A;  4TLM B;  3VVD A;  3KSJ A;  4LA9 A;  2I3W A;  4IR8 A;  2DGC A;  4E0W A;  3TFL A;  1NNP A;  4DV0 E;  5JTY B;  2O1L A;  2Q8U A;  4H67 A;  4BDO A;  2V83 A;  5LL6 R;  3MST A;  1B58 A;  4R74 A;  4F3S A;  1PJQ A;  2V87 A;  3IL1 B;  4F9A B;  5HPQ A;  3ADG A;  4NF8 A;  5IT9 C;  4FEB A;  5AE4 A;  1QVS A;  3HFU A;  3C4M A;  3IFC A;  3GBB A;  3E9X A;  2B7T A;  4RXL A;  2O1M A;  2E1S A;  3KN8 A;  1EYK A;  2ODR C;  4HE0 A;  5T6J A;  1X6H A;  3HPS A;  1K9Y A;  2EPU A;  2PT2 A;  4KHP E;  2YSP A;  3T22 A;  1DMB A;  1LAG E;  2ABH A;  5H8N B;  4N07 A;  4NXN E;  1ZR9 A;  5HM4 B;  1LLM C;  1US4 A;  4NZV A;  1BTJ A;  3RMP A;  4KI0 E;  3B6W A;  2KLF A;  4U4X A;  4K3F A;  1YFH A;  4NF6 A;  4GX4 A;  1B7U A;  4NWC A;  2EPZ A;  2EN8 A;  4FAJ A;  1JEU A;  1SDX A;  3TTK A;  2EM7 A;  3T9X B;  5AA2 D;  1LBW A;  4GL0 A;  4NF4 A;  2Z8D A;  2EN2 A;  4G61 A;  2B4M A;  4PDH A;  4TQU Q;  1MPD A;  3C6M A;  3UP9 A;  2JPA A;  2NXO A;  3ISP A;  4JVI A;  1AMF A;  2Q8M A;  1MPC A;  2EJ4 A;  3KZG A;  2MDR A;  2FBP A;  3ADJ A;  1LFH A;  3TUS A;  4BS9 A;  1IMU A;  5H8F B;  3U92 A;  3TEP A;  4G68 A;  2LCE A;  1X48 A;  3UK4 A;  1MQH A;  3VFJ A;  2L2K B;  4E0X A;  3THI A;  3T9U A;  2QL3 A;  2R9J A;  3QUJ A;  1GVC A;  3VDF A;  1IXH A;  4HE2 A;  4QFN A;  1ZLQ A;  4GX6 A;  4YMA A;  2CEX A;  3G3I A;  3MUQ A;  3ECR A;  5L8D A;  5I57 A;  5AAS A;  3GBA A;  1JNF A;  1LBV A;  3C31 A;  2EL6 A;  1IEJ A;  2VPN A;  1IZ1 A;  1LB9 A;  3RLF E;  4XKN A;  4P9K A;  3CR9 A;  1O0W A;  2EM9 A;  1FPL A;  1JVY A;  2JR1 A;  1ANF A;  1N7X A;  2RF1 A;  3G7W A;  2FIE A;  1MEY C;  3C36 A;  2F35 A;  1IIW A;  5H8Q B;  1TF3 A;  2Y7R A;  2V3Q A;  2YLN A;  4QBA A;  3ADI A;  2PBW A;  4G68 C;  2LE2 A;  3IFA A;  2Z8F A;  1IXC A;  1SI1 A;  3ZKK A;  4EF1 A;  3UIF A;  2EOM A;  1NH7 A;  5DEX A;  1FJ9 A;  3M3L A;  4IY6 A;  2LMZ A;  3K0V A;  1FPB A;  2BB8 A;  3FXQ A;  1B40 A;  5KL7 A;  5BWJ A;  1SD3 A;  2YTO A;  4P1L A;  3O66 A;  1H43 A;  4YY3 E;  2XHD A;  4F2Q A;  4POW A;  1S7Y A;  1A40 A;  4NF6 B;  1DSN A;  3VK6 A;  4KZS A;  4C1U A;  3K2D A;  3DJW A;  1FRP A;  3C9H A;  1Q35 A;  1QJM A;  4NF4 B;  2XXX A;  4HS7 A;  1LAH E;  3S4U A;  1R9L A;  3FJM A;  1JET A;  1JW1 A;  1B05 A;  1Y3Q A;  5T3J A;  5B7D A;  3E3K A;  4H46 A;  2ODR D;  2HPG A;  3VVF A;  2I0B A;  2MC6 A;  3G3J A;  2I0C A;  3ADL A;  1UHZ A;  1Z7M E;  1RMD A;  2QMW A;  2Z22 A;  4BDQ A;  3UK3 C;  3LV0 A;  5EYF A;  3K4U A;  5TP9 A;  3TQL A;  2F34 A;  4KYD A;  2YTD A;  1VDW A;  4JI2 E;  2X7Q A;  1I6A A;  5I84 A;  1P1O A;  3EPH A;  1OQH A;  4P0I A;  1POY 1;  3OO9 A;  1II5 A;  1NFT A;  4DI4 B;  2FHY A;  4F3P A;  1FTA A;  1CE2 A;  2F6G A;  1WHQ A;  4R9G A;  1ZIU A;  2F4V E;  5A6B A;  1D9V A;  3TMG A;  4LF9 E;  2EN1 A;  4EQ9 A;  1XOC A;  5KDT B;  2VE7 C;  2HHM A;  3I3V A;  1T4N A;  2FA7 A;  3MVY A;  2HCA A;  5AA1 A;  1FBC A;  4THI A;  1EH6 A;  1AWB A;  5FBP A;  4MMP A;  1H3D A;  2A5S A;  2H99 A;  2F7B A;  2L92 A;  2G7H A;  3AV0 A;  3U72 A;  3LR1 A;  1JVX A;  2I13 A;  4I40 A;  3K6Q A;  3KN7 A;  4J8Z A;  2Y5L A;  2MKZ A;  4NGU A;  4HCW A;  1SR9 A;  2M8C A;  3CFX A;  3GXA A;  4DR5 E;  3SDF A;  2ZZX A;  4FE8 A;  3Q26 A;  3LLH A;  2ENC A;  2VD2 A;  2EMW A;  1N76 A;  2WX9 A;  4OZ9 A;  2R76 A;  2F3D A;  4F6M A;  5ISU A;  3KZY A;  3BKI B;  3HTX A;  2UVJ A;  4XKR A;  3EHS A;  1FPG A;  1OMP A;  1FQA A;  1P1W A;  3KN3 A;  4RHB B;  1FTM A;  1JK1 A;  3MZ9 A;  2RCA A;  3JZJ A;  4F22 A;  2EN7 A;  2OX3 A;  3JYR A;  3EQ1 A;  2F5X A;  2I49 A;  4O3C A;  1GGG A;  1R6Z A;  3PPQ A;  2F7A A;  3IO4 A;  1AOV A;  4PF8 A;  1HNZ E;  3W9W A;  1Y20 A;  3I6V A;  1QUL A;  2DDK A;  5DVF A;  4B3R E;  1MG1 A;  4MEV A;  3D4G A;  5L9O A;  4X1B A;  3OXN A;  4GWU A;  4OES A;  5ELV A;  1FPK A;  3SEU A;  1O64 A;  2ENA A;  1NI9 A;  1WDN A;  5IZZ A;  5TP9 B;  3HST A;  4FAT A;  1EU8 A;  2WBU A;  4IO2 A;  4X04 A;  1URG A;  4ZE9 A;  1B1X A;  3T93 B;  4LZ8 A;  2N8X A;  3AUZ A;  1K9Z A;  5CMK A;  3T0J A;  4R2S A;  3FJG A;  3T9H B;  2XXV A;  2CZK A;  2QVR A;  3SZP A;  2H25 A;  2V3T A;  2L3C A;  3VYX A;  5CRY A;  4JBZ A;  4PP0 A;  1P47 A;  2I4B A;  5CM6 A;  2NUE A;  3IWD A;  1R9Q A;  1ZBM A;  2EPK X;  3OO7 A;  1NH8 A;  3S9N C;  4TUG A;  3VE1 B;  4JWX A;  4GX3 A;  2WBB A;  2WBT A;  4P11 A;  4N17 A;  3M3F A;  1XVX A;  5EHS A;  4PFT A;  3FIR A;  1EYI A;  2DE2 A;  3MVX A;  2Y7I A;  2B7V A;  1OQG A;  4MAG A;  3SEX A;  4R2A A;  2UXC E;  1FQE A;  3FAS A;  4PET A;  3PPR A;  1B3L A;  4IO6 A;  1EZO A;  2A5T B;  3EPK A;  4H65 A;  5CI5 A;  2EWL A;  1TT1 A;  4JI4 E;  1AH5 A;  2XX7 A;  4EXL A;  3HPI A;  1SYI A;  3MP8 A;  1UIV A;  1MH4 A;  4B3M E;  4WKM A;  4ELQ A;  1RDY A;  3ZSF A;  3GZG A;  5I58 A;  2YU5 A;  4IS1 C;  1QUK A;  4POX A;  2B65 A;  1LB8 A;  5CMB A;  2RC9 A;  2YZT A;  3KOS A;  3I5O A;  1FTL A;  3GYY A;  3OSQ A;  2LV2 A;  3LSF B;  4BDR A;  3MAM A;  1ZMG A;  2P3N A;  3KC1 A;  4XKP A;  1Y1Z A;  4I8C A;  2RS6 A;  4DV1 E;  2HXW A;  1ATG A;  5TPA A;  5AE2 A;  1DOT A;  1FTK A;  2DXR A;  5IZ1 A;  4OTE A;  1WJP A;  4MFI A;  1B0L A;  4P3L A;  2DXY A;  4LUB A;  1Q9D A;  2EOZ A;  2EQ3 A;  1KJK A;  2L5V A;  1D3K A;  2MC5 A;  2DWJ A;  4ZYE A;  2XXI A;  1DBZ A;  4QSE A;  1YZ0 A;  2N3H A;  2RSI A;  4DXU A;  1A1H A;  2EMI A;  3V83 A;  4QFP A;  2XXQ A;  5IXM B;  3THO B;  2ONK E;  4ZED A;  3CIJ A;  1A1F A;  1N34 E;  3LC8 A;  2VP1 A;  4OMB A;  4BBY A;  3PD8 A;  1NV7 A;  2YRH A;  3LML A;  1T39 A;  1N7W A;  3O6G A;  4WYQ B;  2EPR A;  4DE8 A;  3M99 B;  3IO6 A;  5EYG A;  4QFL A;  4WED A;  2XXK A;  4GBV A;  1IUD A;  4WXJ A;  3UOR A;  4O43 A;  4JB7 A;  3A3C A;  4G8N A;  4ZEF A;  1POT A;  2IHR 1;  2YTQ A;  3CHG A;  3MC2 A;  4XKQ A;  4O7I A;  3VVE A;  3CG1 A;  3B8B A;  4Q35 B;  5LDZ A;  2EOH A;  5I58 B;  4GL8 A;  2OBG A;  3TTR A;  4X8W A;  1PKP A;  2ZNU A;  4OYV A;  3TPA A;  3W15 C;  3C6K A;  5FTI A;  2V85 A;  3E13 X;  4TUI A;  1B69 A;  5AA2 B;  3R6U A;  2OJT A;  2B4L A;  2EN6 A;  1YAE A;  1RYO A;  1VFE A;  2GRV A;  2OCU A;  3PUY E;  3ZS6 A;  3BIG A;  3TYH A;  2HC5 A;  2XWO A;  1MDP 1;  4LZ5 A;  2H36 X;  3CSB A;  1B4Z A;  4NF5 B;  1GTK A;  2DE3 A;  4FED A;  4UAB A;  2H98 A;  4XIG Q;  2ZNT A;  5CFF E;  5TPA B;  4YAH X;  4PFW A;  3MSW A;  4G8H A;  4LN5 A;  3N6U A;  3FVK A;  2AL5 A;  3O6I A;  4LU9 A;  1MS7 A;  4AQY E;  3MPL A;  4NE4 A;  2LVH A;  4BCA A;  1SYH A;  3T96 B;  3E78 A;  4HEI A;  4KR5 A;  4RH8 A;  3T1B A;  4O8M A;  2EOO A;  5A6A A;  3MHH C;  1YYO A;  2XD2 A;  2I6E A;  3SES A;  2D3I A;  3DP6 A;  4YB6 A;  4WXD A;  3A29 A;  3OEM A;  4FIM A;  1T4O A;  2DQV A;  2NUG A;  3NOH A;  4MNC A;  1M5B A;  3LBS A;  4F1V A;  1IMB A;  1A1I A;  1YUJ A;  2XXT A;  4O94 A;  1MH3 A;  5DNY A;  2CEY A;  3EF7 A;  2GHB A;  3IAZ A;  1KA0 A;  1NKX A;  2KON A;  3IK6 B;  3RT6 B;  5AA4 A;  1TN9 A;  1DTZ A;  4P56 A;  4IO5 A;  2VF1 A;  3IJX B;  1MY4 A;  3IOV A;  2EOR A;  4LF4 E;  4OHN A;  5K2X A;  2HFB A;  4H1X A;  1BBG A;  3RYD A;  4DUZ E;  3FVO A;  5KCJ A;  2ALU A;  4AQ4 A;  5ADZ A;  3PMV A;  2D9H A;  1M5C A;  3MP6 A;  3SEV A;  2V93 A;  4EF2 A;  4MLV A;  1PB9 A;  1B7Z A;  2LAO A;  1FPD A;  1YPN A;  1SW5 A;  5ET8 A;  5ITO A;  3TQM A;  4OVT A;  1KYQ A;  4P1E A;  2YPN A;  3MZB A;  2O6A A;  4GXS B;  5KL5 A;  1ZAA C;  2HHH E;  3N94 A;  4F6N A;  2EML A;  4R73 A;  1YYW A;  1NV6 A;  4PFR A;  4KD5 A;  1FCK A;  4G77 A;  1BBO A;  2I3V A;  1SW4 A;  4WFT A;  4X48 A;  1IMA A;  4PFY A;  1RDX A;  2ONR A;  2AIX A;  2NOO A;  4GKJ E;  4GWO A;  1LGB C;  2KR0 A;  3IR1 A;  3PPP A;  3MW0 A;  4L17 A;  1PBP A;  1SW1 A;  1QNT A;  1A54 A;  4NX1 A;  1FW0 A;  2ESN A;  4RA1 A;  4IO7 A;  3FZV A;  4LFA E;  4ZS9 A;  3FUZ A;  4EQ7 A;  2YT4 A;  2ZZV A;  3LUZ A;  3PPO A;  4U1O A;  4R2D A;  1LFI A;  3T1Y E;  4F3B A;  2IEE A;  5K2Y A;  5EQ9 A;  3EHU A;  4EXK A;  1B5H A;  3HHF A;  2VQF E;  4YKK A;  1B7H A;  1PEB A;  4MX6 A;  4NF8 B;  1EKZ A;  3G3G A;  2PMS A;  3KBZ A;  4F1U A;  4QHQ A;  4YU0 A;  3K1N A;  3H6W A;  1B5I A;  1B6H A;  4LQ5 A;  4X64 E;  4GOT A;  3U65 A;  3HN0 A;  5BUU A;  1MY0 A;  4MNP A;  2LRS A;  2Q2C A;  4GIZ A;  2EM5 A;  1XMQ E;  4MF3 A;  2JXP A;  5EQ7 A;  1NV3 A;  3L00 A;  2EMF A;  1NUW A;  2GPI A;  3FVN A;  2EPN A;  3F11 A;  3D1R A;  2J7J A;  3MQ9 A;  5AA4 B;  2ZNS A;  3BGH A;  1GR2 A;  2F7C A;  4Q28 A;  1B3G A;  1RQ0 A;  1I94 E;  4G8M A;  3JTZ A;  1GZ6 A;  3HV1 A;  5AA3 A;  3OEK A;  1XC1 A;  4C0R A;  4LF5 E;  3TQW A;  2FV4 B;  2KOU A;  3ROJ A;  4DMI A;  1MY2 A;  2OWS A;  4NMY A;  4F31 B;  1B3F A;  2P1S A;  3EHT A;  1FBH A;  1YYZ A;  1AAY A;  4GLI A;  4R2P A;  1NNK A;  4BMJ A;  4R6Y A;  3BBG A;  4ZZE A;  3WAF A;  3FXU A;  2PFY A;  4M2Z A;  2YTF A;  3KZZ A;  1N36 E;  2XX9 A;  4ONY A;  5H8H A;  4DI3 D;  3SKP A;  4H6D A;  4KWY A;  1XI6 A;  3U93 A;  2HAU A;  1IBK E;  4PTK A;  4G68 B;  3LSL A;  1B2H A;  1N33 E;  4Q8R A;  4FOR A;  2F78 A;  3KOT A;  2EPP A;  3T9V A;  3KC0 A;  4X9T A;  4JI3 E;  1IMD A;  5TU0 A;  2FGG A;  4L5N C;  1RKM A;  4Z7E A;  2EPO A;  2UUB E;  1NUZ A;  2CTD A;  3QXM A;  4R6H A;  2EQ1 A;  1MDQ A;  5J1D A;  4DV5 E;  4JVD A;  1GQE A;  3IOR A;  1FTO A;  4B3T E;  4M4G A;  1ZKB A;  1G0H A;  5I57 B;  2CZH A;  1LAX A;  3GLB A;  4NHB A;  2K7I A;  1HSE A;  2EMB A;  2H9B A;  1XVY A;  2XXH A;  3FAT A;  1JW4 A;  3VLW A;  2W7Y A;  3S9M C;  2FTX B;  4I8O A;  3TKD A;  3VHT B;  3O9P A;  3TTN A;  1RDZ A;  3HCQ A;  4RNS A;  3L6H A;  1LFG A;  2DWI A;  4M0V A;  1G2F C;  2XWI A;  3QUF A;  2DSF A;  2YTE A;  3VXB A;  1FBP A;  4NED A;  4PGN A;  1OVB A;  3IJO B;  4XFE A;  2O51 A;  3ZKL A;  4DIG A;  2VT5 A;  4LFC E;  4OXV A;  2EL5 A;  4R2B A;  4JXI A;  4RPN A;  1BKA A;  2B3F A;  5DEX B;  3LUY A;  4YKJ A;  1I69 A;  5CBS A;  5DW8 A;  2RC7 A;  4GWZ A;  2UVG A;  2EOF A;  4KPT A;  1MQJ A;  5FHN A;  3K6W A;  3QIM A;  1ZJL A;  1LLS A;  1QKA A;  2GHF A;  2V84 A;  2OWT A;  4NG7 A;  1X6E A;  1NUY A;  2QMX A;  3MJN A;  3K01 A;  2D21 A;  2UXB E;  4LF7 E;  1Y3P A;  2X7P A;  1TWY A;  5KL4 A;  3O2A A;  3IX1 A;  2DIX A;  4WSP A;  3FD3 A;  3OO8 A;  1XS5 A;  1URS A;  1B4H A;  4GF8 A;  4UAC A;  1OLA A;  4N81 A;  2XXP A;  1S9T A;  1FQF A;  2F3B A;  4R2C A;  3Q27 A;  1SVX B;  4GXA A;  3TTM A;  1EH8 A;  2MKD A;  3O29 A;  3FV2 A;  2DS9 A;  4N15 A;  3MP1 A;  2XXW A;  4R2Q A;  2CZI A;  4U2R A;  2ZYK A;  4JI7 E;  4GVO A;  4AB6 A;  4N8Y A;  4OEN A;  4F39 A;  5CC2 A;  3OTO E;  4RYA A;  3IB1 A;  3K1P A;  4ZYD A;  1PB8 A;  2VPO A;  1SBP A;  4YB5 A;  3QSL A;  2V89 A;  4UA8 A;  1IBL E;  2XX8 A;  1XHY A;  3PU5 A;  4N6P A;  2M4I A;  4LQ2 A;  2WKY A;  3THN A;  4LF6 E;  3K1M A;  4F9B B;  2JYA A;  1BIY A;  4Q5T A;  1QKB A;  2EM0 A;  2VD3 A;  2DWH A;  5IGA A;  3DEL B; 
#chains in the Genus database with same CATH homology
 1A8F A;  4IGT A;  1JEV A;  3DP4 A;  1MM7 A;  1ZU0 A;  1TXF A;  3PPN A;  3PUX E;  2ZYO A;  1B9J A;  1BP5 A;  5I59 A;  3LSX A;  3Q25 A;  4JWO A;  4RPO A;  1MQG A;  3Q28 A;  1JW5 A;  1MQD A;  1H76 A;  4R72 A;  3HO7 A;  4QFK A;  4ISU A;  3U8Q A;  2GHA A;  3PGF A;  3G3H A;  5L9M A;  3RPW A;  3RTW B;  1A99 A;  3W9V A;  3VV5 A;  1EZP A;  1NMU A;  4LON B;  5A5X A;  4N13 A;  3H4Z A;  3D4C A;  2Q8J A;  4YKI A;  1DTG A;  4MBP A;  4QRZ A;  3K6U A;  3BFT A;  4QF9 A;  1T0K A;  2PX1 A;  1IXG A;  3OEN A;  4X1D A;  4ZE8 A;  3SET A;  2DVC A;  3H7M A;  3FXR A;  5HBC A;  3C34 A;  1MXY A;  3MZ1 A;  4O3B A;  4OFJ A;  4KHZ E;  2DE4 A;  1B51 A;  5I2N A;  1MXV A;  1O7T A;  2THI A;  4IY5 A;  4BLA A;  1I6B A;  4YKP A;  3DLN A;  5JTY A;  3CI8 A;  2OZZ A;  2RIN A;  5I59 B;  4YMB A;  2XXY A;  4O3A A;  2VGQ A;  3RT8 A;  2QJE A;  1UTH A;  3TCG A;  4KYE A;  4XTC Q;  2H4I A;  4OFL A;  4JDF A;  4H8J A;  3IOU A;  3CRB A;  3KBR A;  3VLV A;  1N04 A;  1IXI A;  2R71 A;  3H6U A;  2ZXT A;  3H03 A;  3KJT A;  2V25 A;  2ZYM A;  2R6G E;  5IKB A;  3VLU A;  1M5D A;  4ZDM A;  2NWJ A;  4IB2 A;  1UQW A;  3N6T A;  3SER A;  3KFM A;  1P1Q A;  3IOW A;  3CG3 A;  1N0T A;  2ANJ A;  3RTF B;  5EHM A;  1DPP A;  4KCC A;  3OD7 A;  5A5X B;  2P0S A;  2QPQ A;  4LVQ A;  1Y1M A;  1ELJ A;  1ZTY A;  4EUO A;  1TFA A;  2Z8E A;  4EQB A;  1A55 A;  5M2V A;  1LST A;  2D5W A;  1I6Q A;  1PBQ A;  2AL4 A;  5IAI A;  1MM6 A;  2NVU B;  4GD5 A;  1LBC A;  3CFZ A;  1AIV A;  4RK9 A;  1JQF A;  4IO4 A;  1IIT A;  2O84 X;  5I2N B;  4F3G A;  5I56 A;  4WEP A;  1UTB A;  5ICT A;  3FV1 A;  1LCT A;  3H6T A;  4LP2 B;  3IOT A;  5DYH A;  1UTH B;  3TEL A;  3V5A A;  5H8Q A;  3M3K A;  5H8S A;  1QW0 A;  3E4R A;  2G93 A;  1N3X A;  2RC8 A;  1A7L A;  4H0W A;  1D4N A;  3O97 A;  4G2Z A;  4HW8 A;  3C33 A;  4AB5 A;  2VOZ A;  2VHA A;  2OK2 A;  3UA8 A;  1D9Y A;  1FTJ A;  2B3B A;  2P2A A;  1R1N A;  4PQJ A;  3KSX A;  3FGS A;  3CVG A;  3CSG A;  2H5Y A;  4Q0C A;  3RNN A;  2ZMB A;  4RY1 A;  4JSO A;  1MXU A;  3PMW A;  4I62 A;  4BDM A;  4H5G A;  1HSL A;  2HQ0 A;  2O7I A;  4NWD A;  2QS1 A;  5F7V A;  3OO6 A;  2GH9 A;  3A09 A;  1CB6 A;  3CFL A;  4JSD A;  4BDL A;  3RN8 A;  2Q89 A;  1MRP A;  5JK4 A;  4KQP A;  3K02 A;  2FNC A;  1SQY A;  2ZYN A;  3L6G A;  4IO3 A;  4YIC A;  3U1O A;  2BJJ X;  4ZZA A;  1RYX A;  4ELO A;  3KGC A;  5DTB A;  5KZT A;  2F36 A;  4R2F A;  1O63 A;  5I56 B;  3H3G A;  4KCD A;  4P0G A;  5KDT A;  1Y4T A;  1UTB B;  1QUI A;  1NL5 A;  3ILU B;  3RUM A;  3OSR A;  1KWH A;  3FVG A;  2PVU A;  3BFU A;  2UVI A;  5I2K A;  3OEL A;  3QK6 A;  3DM0 A;  3AXF A;  3H6V A;  2DOJ A;  1N3W A;  4QSD A;  1MXX A;  5KCJ B;  1VR5 A;  2HEU A;  2QSX A;  3QYT A;  2Q88 A;  3VXC A;  2UXA A;  1B3H A;  1URD A;  4ECF A;  1B1H A;  2QS4 A;  3RY3 A;  2XD3 A;  2HZK A;  1SW2 A;  1L5T A;  4U4S A;  2XXU A;  3TDJ A;  3EN3 A;  4C1T A;  4DCX A;  1Z7N E;  1LAF E;  1SI0 A;  3PUW E;  4U1Z A;  4M1V A;  3K6X A;  1EZ9 A;  3Q29 A;  3V8X B;  3SEW A;  3R7X A;  1M5E A;  3PV0 E;  4F2O A;  1WOD A;  4U22 A;  2HAV A;  4YB7 A;  4XXU A;  4OER A;  2UVH A;  5DVI A;  1B0H A;  5CMC A;  4R6K A;  1WVJ A;  1MXW A;  4GRK A;  1MY3 A;  4PE5 B;  4ZEK A;  1B52 A;  1NNT A;  2G29 A;  1Y9U A;  2DP8 A;  3MBP A;  2F97 A;  3B6Q A;  2FYI A;  4H8I A;  5ITP A;  5I2K B;  3M8U A;  3PUZ E;  2UYE A;  5FHO A;  3RGY A;  2YJP A;  4RJZ A;  5DT6 A;  3JV9 A;  2RCB A;  5DVJ A;  4OEU A;  1OIB A;  3MPK A;  2X26 A;  2A5T A;  3S9L C;  3U94 A;  1LCF A;  2PT1 A;  3G3K A;  2I48 A;  4OVJ A;  5H8H B;  3KJ7 A;  1PB7 A;  1OVT A;  2I4C A;  1MXZ A;  1YCJ A;  1HSJ A;  3S9E A;  5CMM A;  3G3F A;  4JWY A;  3C35 A;  4OFO A;  1LBB A;  3KEI A;  3EPE A;  4U23 A;  3O6H A;  1MPB A;  3T66 A;  3IB2 A;  3V89 B;  4ESX A;  2O69 A;  3H06 B;  5FTH A;  4IGR A;  2I58 A;  1Q1K A;  3TCH A;  4FJP A;  1P1N A;  3LSW A;  3KG2 A;  2AYS A;  3PMX A;  1VE4 A;  4PFU A;  1H45 A;  3PUV E;  2Y7P A;  3MVZ A;  2QS3 A;  1Y3N A;  4OQO A;  4DZ1 A;  4OEV A;  2Y7W A;  4QFO A;  3N26 A;  4TLL B;  3B6T A;  2XXR A;  1FQC A;  3IB0 A;  2Y7K A;  1YTV A;  1PDA A;  2F6P A;  2DWA A;  4ZEB A;  2REG A;  4MLQ A;  1P99 A;  1J1N A;  1XT8 A;  4LZ7 A;  1Y4C A;  1M5F A;  4G4P A;  1B3E A;  3OMB A;  4I9D A;  5ICQ A;  1USY H;  4I1D A;  1B46 A;  4DXC A;  1N84 A;  1B32 A;  4DXB A;  3R26 A;  4ZEC A;  2REJ A;  2CMO A;  1UIU A;  3ILT B;  4Z0I A;  2DVZ A;  3A3U A;  1IQ7 A;  3PD9 A;  3HHG A;  2DYX A;  4ELR A;  3OOA A;  3MWB A;  3SEY A;  5AA2 A;  4ZEI A;  2O7U A;  4F18 A;  2Y84 A;  1EH3 A;  4F1Y A;  2F8D A;  3ONM A;  1FQB A;  2OLB A;  4NF5 A;  5CBR A;  2V3U A;  3TZA A;  2ONS A;  2HZL A;  4F19 A;  3S2V A;  1OLC A;  1H44 A;  2CZL A;  5F1Q A;  4GQO A;  3B7D A;  4ELP A;  2PYY A;  1VFD A;  4ND9 A;  4EDP A;  4HTG A;  4QSC A;  1FQD A;  5L9S A;  4ESW A;  4DLD A;  1F9B A;  4R75 A;  2E0S A;  3QAX A;  1MQI A;  3TCF A;  2IA4 A;  1USY E;  3C32 A;  2QRY A;  4HCY A;  3DP8 A;  3UGW A;  1DPE A;  1VSO A;  4RK2 A;  3P7I A;  2GFE A;  5FHM A;  5LOM A;  4DDD A;  4KFQ A;  5H8N A;  1NNF A;  3FJ7 A;  4DCY A;  3USD A;  4NTL A;  1A8E A;  3ODB A;  2Q2A A;  1TFD A;  3K6V A;  2UYF A;  4GFR A;  3O28 A;  3N5L A;  1B5J A;  4LAT A;  1AL3 A;  2QS2 A;  3WAE A;  4R9F A;  1PC3 A;  3UN6 A;  1S50 A;  2NUV A;  4YZZ A;  2O68 A;  3BBR A;  3TOD A;  3MVW A;  5JEI A;  4OET A;  1QUJ A;  5H8F A;  4OWD A;  1US5 A;  2Z23 A;  4F29 A;  2RKM A;  4H5F A;  3TTL A;  4TOZ A;  1GV8 A;  1P1U A;  1MY1 A;  4KYS A;  5B70 A;  1BLF A;  4U21 A;  4FEC A;  2Q9T A;  3K00 A;  4Q30 B;  3RQT A;  3TAJ A;  4BDN A;  4TLM B;  4MH5 A;  3VVD A;  3KSJ A;  4LA9 A;  2I3W A;  4E0W A;  3TFL A;  1NNP A;  5JTY B;  2O1L A;  4H67 A;  4BDO A;  4F3S A;  1B58 A;  4R74 A;  3IL1 B;  5HPQ A;  4NF8 A;  4FEB A;  5AE4 A;  1QVS A;  3C4M A;  3GBB A;  3E9X A;  4RXL A;  2O1M A;  2E1S A;  3KN8 A;  2PT2 A;  3T22 A;  1DMB A;  1LAG E;  2ABH A;  5H8N B;  4N07 A;  5HM4 B;  1US4 A;  1BTJ A;  4KI0 E;  3B6W A;  2KLF A;  4U4X A;  4K3F A;  4NF6 A;  1B7U A;  4NWC A;  4FAJ A;  1JEU A;  1SDX A;  3TTK A;  3T9X B;  5AA2 D;  4NF4 A;  4GL0 A;  2Z8D A;  4TQU Q;  1MPD A;  3UP9 A;  2NXO A;  1AMF A;  1MPC A;  3KZG A;  1LFH A;  3TUS A;  5H8F B;  3U92 A;  3TEP A;  4G68 A;  3UK4 A;  1MQH A;  3VFJ A;  4E0X A;  3THI A;  3T9U A;  2QL3 A;  2R9J A;  3QUJ A;  1GVC A;  3VDF A;  1IXH A;  4QFN A;  1ZLQ A;  4YMA A;  3G3I A;  3MUQ A;  3ECR A;  5L8D A;  5I57 A;  3GBA A;  1JNF A;  3C31 A;  1IEJ A;  1IZ1 A;  1LB9 A;  3RLF E;  4XKN A;  3CR9 A;  1JVY A;  1ANF A;  1N7X A;  2RF1 A;  3G7W A;  3C36 A;  2F35 A;  1IIW A;  5H8Q B;  2Y7R A;  2V3Q A;  2YLN A;  2PBW A;  4G68 C;  2Z8F A;  1IXC A;  1SI1 A;  3ZKK A;  4EF1 A;  3UIF A;  1NH7 A;  5DEX A;  3M3L A;  4IY6 A;  3K0V A;  3FXQ A;  1B40 A;  5BWJ A;  1SD3 A;  3O66 A;  1H43 A;  2XHD A;  4F2Q A;  4POW A;  1S7Y A;  1A40 A;  4NF6 B;  1DSN A;  4C1U A;  3K2D A;  3C9H A;  1Q35 A;  1QJM A;  4NF4 B;  2XXX A;  4HS7 A;  3S4U A;  1LAH E;  1R9L A;  3FJM A;  1JET A;  1JW1 A;  1B05 A;  1Y3Q A;  5B7D A;  3E3K A;  3VVF A;  2I0B A;  3G3J A;  2I0C A;  1Z7M E;  2QMW A;  4BDQ A;  2Z22 A;  5EYF A;  3K4U A;  5TP9 A;  3TQL A;  2F34 A;  4KYD A;  2X7Q A;  1I6A A;  5I84 A;  1P1O A;  1OQH A;  4P0I A;  1POY 1;  3OO9 A;  1II5 A;  1NFT A;  4F3P A;  1CE2 A;  2F6G A;  4R9G A;  1ZIU A;  1D9V A;  3TMG A;  4EQ9 A;  1XOC A;  5KDT B;  3I3V A;  2FA7 A;  3MVY A;  2HCA A;  5AA1 A;  4THI A;  1H3D A;  2A5S A;  2H99 A;  2F7B A;  3U72 A;  3LR1 A;  1JVX A;  3KN7 A;  4HCW A;  2M8C A;  3CFX A;  3GXA A;  3SDF A;  4FE8 A;  3Q26 A;  2VD2 A;  1N76 A;  4OZ9 A;  5ISU A;  3BKI B;  2UVJ A;  4XKR A;  3EHS A;  1OMP A;  1FQA A;  1P1W A;  3KN3 A;  1FTM A;  3MZ9 A;  2RCA A;  3JZJ A;  4F22 A;  3JYR A;  3EQ1 A;  2F5X A;  2I49 A;  4O3C A;  1GGG A;  1R6Z A;  3PPQ A;  2F7A A;  3IO4 A;  1AOV A;  3W9W A;  1Y20 A;  3I6V A;  1QUL A;  5DVF A;  1MG1 A;  3D4G A;  5L9O A;  4X1B A;  3OXN A;  4OES A;  5ELV A;  3SEU A;  1O64 A;  1WDN A;  5TP9 B;  3HST A;  4FAT A;  1EU8 A;  4IO2 A;  1URG A;  4ZE9 A;  1B1X A;  3T93 B;  4LZ8 A;  5CMK A;  3FJG A;  3T9H B;  2XXV A;  2H25 A;  2V3T A;  5CRY A;  4JBZ A;  4PP0 A;  2I4B A;  5CM6 A;  1R9Q A;  1ZBM A;  3OO7 A;  1NH8 A;  3S9N C;  3VE1 B;  4JWX A;  4P11 A;  3M3F A;  1XVX A;  5EHS A;  4PFT A;  3FIR A;  2DE2 A;  3MVX A;  2Y7I A;  1OQG A;  3SEX A;  1FQE A;  3FAS A;  4PET A;  3PPR A;  1B3L A;  4IO6 A;  1EZO A;  2A5T B;  4H65 A;  5CI5 A;  1TT1 A;  1AH5 A;  2XX7 A;  4EXL A;  3HPI A;  1SYI A;  3MP8 A;  1UIV A;  1MH4 A;  4WKM A;  4ELQ A;  3ZSF A;  5I58 A;  3GZG A;  1QUK A;  4POX A;  2B65 A;  1LB8 A;  5CMB A;  2RC9 A;  3KOS A;  3I5O A;  1FTL A;  3OSQ A;  3LSF B;  4BDR A;  3MAM A;  1ZMG A;  4XKP A;  1Y1Z A;  4I8C A;  2HXW A;  1ATG A;  5TPA A;  1DOT A;  1FTK A;  2DXR A;  4OTE A;  4MFI A;  1B0L A;  2DXY A;  4LUB A;  1D3K A;  2DWJ A;  2XXI A;  4QSE A;  4DXU A;  3V83 A;  4QFP A;  2XXQ A;  2ONK E;  4ZED A;  3CIJ A;  3LC8 A;  2VP1 A;  4OMB A;  3PD8 A;  4DE8 A;  3O6G A;  1N7W A;  3IO6 A;  4QFL A;  4WED A;  4WXJ A;  1IUD A;  3UOR A;  4JB7 A;  3A3C A;  4G8N A;  4ZEF A;  1POT A;  3MC2 A;  4XKQ A;  3VVE A;  3CG1 A;  5I58 B;  4GL8 A;  2OBG A;  3TTR A;  2ZNU A;  4OYV A;  3TPA A;  3W15 C;  5FTI A;  3E13 X;  5AA2 B;  3R6U A;  2OJT A;  1YAE A;  1RYO A;  1VFE A;  2GRV A;  2OCU A;  3PUY E;  3ZS6 A;  3TYH A;  1MDP 1;  4LZ5 A;  3CSB A;  1B4Z A;  4NF5 B;  1GTK A;  2DE3 A;  4FED A;  2H98 A;  4XIG Q;  2ZNT A;  5TPA B;  4YAH X;  4PFW A;  4G8H A;  3N6U A;  3FVK A;  2AL5 A;  3O6I A;  1MS7 A;  3MPL A;  4NE4 A;  3T96 B;  1SYH A;  4KR5 A;  2XD2 A;  2I6E A;  3SES A;  2D3I A;  3DP6 A;  4YB6 A;  3OEM A;  4FIM A;  2DQV A;  1M5B A;  3LBS A;  4F1V A;  2XXT A;  1MH3 A;  3EF7 A;  2GHB A;  3IAZ A;  1NKX A;  3IK6 B;  3RT6 B;  5AA4 A;  1DTZ A;  4IO5 A;  3IJX B;  1MY4 A;  3IOV A;  4OHN A;  5K2X A;  2HFB A;  4H1X A;  3FVO A;  5KCJ A;  2ALU A;  4AQ4 A;  3PMV A;  1M5C A;  3MP6 A;  3SEV A;  2V93 A;  4EF2 A;  4MLV A;  1PB9 A;  1B7Z A;  2LAO A;  1YPN A;  1SW5 A;  5ITO A;  2YPN A;  3MZB A;  2O6A A;  4GXS B;  3N94 A;  4R73 A;  4KD5 A;  1FCK A;  4G77 A;  2I3V A;  1SW4 A;  4X48 A;  4PFY A;  2ONR A;  2AIX A;  2NOO A;  4GWO A;  1LGB C;  3IR1 A;  3PPP A;  3MW0 A;  4L17 A;  1PBP A;  1SW1 A;  1A54 A;  1FW0 A;  2ESN A;  4RA1 A;  4IO7 A;  3FZV A;  4ZS9 A;  3FUZ A;  4EQ7 A;  3PPO A;  4U1O A;  1LFI A;  4F3B A;  2IEE A;  5K2Y A;  3EHU A;  4EXK A;  1B5H A;  3HHF A;  4YKK A;  1B7H A;  1PEB A;  4NF8 B;  3G3G A;  2PMS A;  4F1U A;  4QHQ A;  4YU0 A;  3K1N A;  3H6W A;  1B5I A;  1B6H A;  4LQ5 A;  4GOT A;  3HN0 A;  5BUU A;  1MY0 A;  2Q2C A;  4GIZ A;  4MF3 A;  3FVN A;  3F11 A;  3MQ9 A;  5AA4 B;  2ZNS A;  1GR2 A;  2F7C A;  1B3G A;  4G8M A;  3HV1 A;  5AA3 A;  3OEK A;  1XC1 A;  4C0R A;  3TQW A;  1MY2 A;  2OWS A;  4NMY A;  4F31 B;  1B3F A;  2P1S A;  3EHT A;  4GLI A;  1NNK A;  4R6Y A;  4ZZE A;  3WAF A;  3FXU A;  2XX9 A;  5H8H A;  4ONY A;  3SKP A;  4H6D A;  3U93 A;  2HAU A;  4G68 B;  3LSL A;  1B2H A;  4Q8R A;  4FOR A;  2F78 A;  3KOT A;  3T9V A;  4X9T A;  5TU0 A;  1RKM A;  4Z7E A;  3QXM A;  4R6H A;  1MDQ A;  5J1D A;  3IOR A;  1FTO A;  4M4G A;  1ZKB A;  5I57 B;  1LAX A;  3GLB A;  1HSE A;  2H9B A;  1XVY A;  2XXH A;  3FAT A;  1JW4 A;  3VLW A;  2W7Y A;  3S9M C;  3TKD A;  3O9P A;  3TTN A;  3HCQ A;  4RNS A;  3L6H A;  1LFG A;  2DWI A;  3QUF A;  2DSF A;  3VXB A;  4NED A;  1OVB A;  3IJO B;  2O51 A;  3ZKL A;  4DIG A;  4OXV A;  4R2B A;  4JXI A;  4RPN A;  1BKA A;  2B3F A;  5DEX B;  3LUY A;  4YKJ A;  1I69 A;  5CBS A;  2RC7 A;  2UVG A;  4KPT A;  1MQJ A;  5FHN A;  3K6W A;  3QIM A;  1ZJL A;  1LLS A;  1QKA A;  2V84 A;  2OWT A;  2QMX A;  3MJN A;  3K01 A;  2D21 A;  2X7P A;  1Y3P A;  1TWY A;  3O2A A;  3IX1 A;  3FD3 A;  3OO8 A;  1XS5 A;  1URS A;  1B4H A;  4GF8 A;  4UAC A;  1OLA A;  2XXP A;  1S9T A;  1FQF A;  3Q27 A;  1SVX B;  4GXA A;  3TTM A;  3O29 A;  3FV2 A;  2DS9 A;  3MP1 A;  2XXW A;  4U2R A;  2ZYK A;  4GVO A;  4AB6 A;  4F39 A;  4OEN A;  5CC2 A;  4RYA A;  3IB1 A;  3K1P A;  1PB8 A;  1SBP A;  4YB5 A;  3QSL A;  4UA8 A;  2XX8 A;  1XHY A;  3PU5 A;  4N6P A;  4LQ2 A;  2WKY A;  3K1M A;  1BIY A;  4Q5T A;  1QKB A;  2VD3 A;  2DWH A;  3DEL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...