4MLVA

Crystal structure of bacillus megaterium porphobilinogen deaminase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
290
Chain Sequence
SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKLLIDRVKEELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the partially oxidized dipyrromethene and dipyrromethanone forms of the cofactor of porphobilinogen deaminase: structures of the Bacillus megaterium enzyme at near-atomic resolution.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
total genus 102
structure length 290
sequence length 311
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 4mlvA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA02
3CIJA 3R26A 1P1OA 3Q26A 4RK2A 3T9XB 3KOTA 1PC3A 3RQTA 3LSWA 5HM4B 4N13A 4MF3A 3I6VA 4R6HA 1A7LA 2XX9A 1LFIA 4E0XA 2ZYMA 4OENA 4F22A 5I58A 2DWIA 3GZGA 3IX1A 1IZ1A 2XHDA 3MP8A 3C31A 4GXAA 3D4CA 3TPAA 4RPOA 1LLSA 4EXLA 4NMYA 3K1PA 5EHSA 2YPNA 3KGCA 4JBZA 3C9HA 3H6WA 3DP6A 2OZZA 5I2KA 2Q88A 1Y1ZA 3T93B 1B58A 1ZBMA 2F6GA 2HZLA 1Y4CA 2Q89A 4U2RA 3TMGA 4X48A 1FW0A 1B1XA 2X26A 4U4XA 3TELA 1KWHA 5HPQA 1B7HA 2DWAA 3N5LA 5AA2A 3R6UA 3F11A 1Y4TA 1H3DA 1I6AA 4NF6A 1EZOA 4NWDA 2RC8A 3LSLA 4YKKA 4I62A 3VVFA 1AH5A 4IO3A 5FHNA 3B6TA 4IO4A 5ISUA 2M8CA 5H8QB 1AL3A 3IK6B 1PB9A 2XX8A 3OXNA 3VE1B 3WAEA 1Z7ME 5KCJB 1SI1A 3TEPA 1B3LA 4F3BA 5F7VA 3C32A 1DTGA 5KCJA 2Z8EA 1MPDA 2XX7A 3OO8A 4OXVA 3UA8A 1NKXA 4ESWA 1GGGA 1MXZA 2QMWA 4H65A 3IO6A 3QK6A 4G68A 5EYFA 3IB1A 4YICA 3C33A 3TCGA 4KPTA 3MAMA 4N6PA 4OMBA 3LSXA 4RXLA 1NFTA 1ANFA 2XD2A 5H8HB 2O7UA 5DT6A 3SETA 5H8FB 2P1SA 4DLDA 1D4NA 1Y3NA 1Y3QA 2D3IA 3G3JA 3MP1A 1JW4A 3G3KA 3PD8A 4U21A 1FQDA 2A5TA 3HO7A 3IAZA 3PUYE 4EQ9A 1B40A 1EU8A 1PB7A 2Y84A 4JB7A 2ZXTA 4NF5B 2F34A 4QFLA 5K2XA 2F97A 3KN3A 4DXBA 1JW5A 1BIYA 1ZIUA 2HQ0A 3OOAA 4H8IA 3TZAA 4F1UA 1IITA 2DXYA 3G3HA 4YAHX 3TTLA 4LZ8A 1LCTA 4IGTA 4R6KA 3EF7A 3K6VA 4G8NA 3V89B 2WKYA 1IUDA 1UIUA 5CM6A 5I2NB 5I58B 3CSGA 4NF5A 1AMFA 4LQ5A 4GRKA 2XXQA 3H6TA 2I4CA 3EHSA 2AL5A 4ISUA 4DZ1A 1B3GA 3UIFA 1N04A 3FATA 1HSLA 2V3TA 1B4HA 3EHUA 4F1VA 2GHBA 4MH5A 4ZZEA 1MH4A 1Y3PA 1DPPA 1US5A 1R9LA 4GXSB 4H5FA 1DSNA 3BKIB 1MRPA 4WEDA 4L17A 1DOTA 1N84A 1PB8A 4G68B 4PQJA 1POY1 3C34A 4RJZA 2RF1A 4RY1A 3E3KA 2I49A 2VD3A 3FVNA 3O66A 3ECRA 2DE2A 4IO5A 4IY5A 4XKQA 2UVHA 3TDJA 1QULA 1BP5A 1M5EA 1R1NA 4GFRA 4O3CA 4U1ZA 3USDA 4NF4A 2Z22A 1RYOA 4JWYA 1BLFA 4G4PA 4ONYA 2A5SA 1VE4A 1MY4A 1SYIA 1MM7A 3TYHA 1NNFA 3K0VA 2O84X 2Y7IA 3OSRA 4EXKA 5L9SA 1I6BA 3OSQA 3TFLA 1FQCA 1POTA 2H25A 3IJOB 4XKRA 4TQUQ 3OO7A 1MQGA 3O6HA 4U1OA 4MLVA 3TAJA 3MZ9A 3PPPA 1DPEA 3UP9A 4EDPA 1O7TA 2RCBA 3L6GA 3G3FA 1O64A 3PPNA 3SEUA 4YMAA 3DLNA 1O63A 1UTBB 2CZLA 2YLNA 1US4A 4LONB 5L9MA 4F3PA 4RNSA 1P99A 4FATA 3EHTA 1MXUA 2H9BA 1SBPA 3LUYA 3S2VA 2PMSA 3FJ7A 4GF8A 4RYAA 3SEXA 4BDOA 5KZTA 1PBPA 4Q5TA 3TCHA 5J1DA 3DELB 2V93A 4I9DA 4R75A 1B2HA 4G68C 4R72A 3RTWB 4PFYA 1OVBA 1A99A 1N3XA 1RKMA 3PUXE 3S9EA 1F9BA 2PVUA 3QIMA 2NWJA 3JYRA 3S4UA 4GOTA 1I6QA 4FJPA 2G93A 2PT1A 3CFZA 3GXAA 4ZZAA 5LOMA 4OFOA 2A5TB 3PMWA 1LFHA 2F7AA 4JSDA 3LSFB 1N0TA 3N6UA 4ELRA 3CI8A 1NMUA 2VHAA 1N7XA 4BLAA 1SW5A 3QUJA 3O29A 3H4ZA 3PPQA 4ELOA 1P1UA 4Z7EA 1LAFE 2OWSA 3K1MA 3RPWA 3E4RA 1P1WA 1TXFA 3M3KA 4YB7A 3KG2A 1MXVA 2QSXA 1NH8A 4OQOA 4R73A 3KJTA 2GFEA 3N94A 1QUKA 3B6QA 3O97A 2AL4A 4GQOA 3A3UA 4OWDA 3ZKKA 1ELJA 1TFAA 2RC7A 4F19A 4TLLB 1IEJA 4ELQA 2Y7WA 1FTMA 5I57A 2XXUA 5F1QA 3U94A 3O28A 5B70A 2THIA 2ZNTA 4QFKA 4F3GA 2Q8JA 2RKMA 1PDAA 1MQDA 4P11A 4ZE8A 3IOUA 1XOCA 3TCFA 1Y9UA 2B3BA 4IB2A 4P0IA 5H8SA 3T96B 1LAGE 4BDMA 1MH3A 4NF6B 4OEVA 4POWA 5KDTA 3B7DA 3HHFA 3ONMA 3M3FA 5IKBA 2UVIA 4NTLA 2O6AA 2QRYA 4YMBA 3FVGA 4I8CA 2I0BA 2O1LA 2UXAA 4JWOA 5H8NA 2QL3A 3FVOA 3OEKA 4HS7A 1QKAA 3IL1B 2QS3A 3I3VA 4ECFA 4KYSA 1EZPA 1B5HA 3Q28A 4KCDA 3SEVA 1LGBC 3PPOA 2REGA 3GLBA 4P0GA 4HTGA 1UQWA 3MZBA 3T22A 3THIA 4ELPA 5H8QA 2Z8DA 4EF2A 1ZJLA 5JTYA 4FORA 4KYDA 5CMMA 3UORA 1NNPA 4F31B 2O7IA 4OYVA 1Z7NE 3V8XB 2ZNUA 3VXCA 2B3FA 3K6UA 3GBAA 3KN8A 5M2VA 1B0HA 1OLCA 4G8MA 4PFWA 5DVFA 1YPNA 2H99A 5A5XA 2ESNA 1OQHA 3C36A 5CMBA 1B6HA 3IB0A 3KEIA 2V25A 2E0SA 2GHAA 5CRYA 1MDP1 1ZMGA 2VP1A 2E1SA 1GTKA 1VSOA 1JNFA 2Z23A 3CFLA 1UTHB 1TT1A 2ONSA 1B05A 3MVWA 2V3QA 3H03A 1LB9A 3K1NA 3O2AA 1FQFA 4H8JA 3ODBA 2ONKE 4GD5A 3KSJA 1RYXA 4WEPA 4EQBA 3QAXA 3RTFB 3VVDA 2G29A 3M3LA 4AB5A 5I59B 3D4GA 2R9JA 2F6PA 4DXUA 4FIMA 1JW1A 4KI0E 4Q30B 4YU0A 1IXGA 3ZSFA 1A54A 1WVJA 2RINA 3FXQA 4GIZA 2H98A 3UN6A 4WXJA 4ZECA 3LBSA 4LZ5A 3AXFA 1AOVA 4IO7A 4O3AA 3EPEA 1B52A 3DM0A 2I4BA 1LAHE 1L5TA 3KJ7A 4KYEA 2F5XA 2P0SA 3CSBA 3MZ1A 3DP8A 3TTNA 3FGSA 3TTRA 3V83A 3TQLA 4EF1A 2Q2CA 3T9HB 1Y1MA 1IQ7A 3C35A 5DYHA 1LFGA 4KR5A 5AA1A 3U92A 2D21A 2OBGA 4HW8A 4O3BA 3OO6A 4UA8A 4F29A 3VLVA 5A5XB 5IAIA 3IOVA 2O51A 3RGYA 2NUVA 3RY3A 5I56B 1M5BA 1QVSA 2OJTA 2QS4A 3TTMA 3H6VA 3U93A 2R6GE 1XS5A 3VFJA 3VXBA 2DXRA 2HXWA 3ILTB 3SERA 1B46A 2PBWA 3T66A 3G7WA 2ONRA 4POXA 4XTCQ 4NF8B 3U8QA 4PP0A 1MQJA 3MW0A 5FTIA 4F39A 2BJJX 1HSJA 2ALUA 2I6EA 1B32A 2AYSA 1R6ZA 2LAOA 2F36A 3H06B 2REJA 4ZS9A 4KD5A 4KFQA 1CB6A 2DOJA 3FXUA 4DDDA 1TFDA 1Q35A 2FA7A 4X1DA 3T9VA 3LC8A 3RNNA 1SD3A 1S50A 4R9FA 1Q1KA 5TPAB 1MQHA 1XT8A 3PU5A 1H43A 1WODA 3KBRA 3CG1A 2V84A 3MWBA 3PPRA 4OTEA 5CI5A 3V5AA 2Q2AA 2HAVA 4QF9A 3CFXA 4Q8RA 4LZ7A 3U1OA 4C0RA 3ZKLA 3S9MC 2XXVA 1M5FA 2ZYNA 3PGFA 4QFPA 1MXXA 1FQAA 1OIBA 1SW1A 5FTHA 2HAUA 4OESA 4E0WA 5I56A 1FTOA 2UYEA 1JEUA 1VFDA 4KCCA 3U72A 3KOSA 4KHZE 3MQ9A 1GV8A 5ITPA 3SDFA 2XXRA 4DXCA 1ZKBA 1T0KA 4ZEFA 3H6UA 1H45A 4RPNA 5K2YA 4THIA 2Q9TA 3A3CA 4YZZA 1ATGA 1S9TA 4GL0A 4ZEIA 5TU0A 2NVUB 1R9QA 1B7ZA 2HCAA 5DVIA 3FIRA 1ZTYA 4R9GA 1EZ9A 1FTLA 3O6GA 2O1MA 1MQIA 4M1VA 2Z8FA 4C1UA 1MDQA 1URSA 1MS7A 1MXYA 5BWJA 3SEWA 5KDTB 3PD9A 4C1TA 4YKPA 2RCAA 4UACA 1CE2A 3E9XA 2ZNSA 3QXMA 1MM6A 3MBPA 4R74A 3FJMA 4RK9A 4K3FA 3W15C 1XVXA 4FAJA 2XXHA 3W9WA 1J1NA 1N76A 1TWYA 4ZDMA 4NWCA 5CMKA 3PMXA 1Y20A 2P2AA 2XXXA 3MVXA 1JQFA 1LSTA 3RUMA 1MXWA 3KFMA 1SW2A 3ILUB 4OZ9A 4R6YA 4QHQA 1QW0A 5DTBA 3UK4A 3MJNA 1VFEA 4MLQA 1NH7A 1SQYA 1NNTA 2UVGA 4U23A 5FHMA 3VLUA 2FYIA 5HBCA 1NNKA 3B6WA 3K2DA 3C4MA 4G8HA 3MP6A 2Y7PA 2OCUA 4PETA 4JXIA 5JTYB 2DS9A 4GWOA 3FJGA 5FHOA 1B3HA 3K6WA 4AB6A 2UYFA 4F18A 4QFNA 1NL5A 3IOWA 1B1HA 1MY1A 3L6HA 3OO9A 4H0WA 3TODA 4MBPA 3I5OA 3N6TA 1IXCA 5DEXB 1LCFA 1FQEA 4GLIA 3HPIA 1OQGA 4Q0CA 5CBRA 4DE8A 5I84A 1MPBA 1A8FA 4M4GA 1LB8A 3K01A 3CRBA 2D5WA 4R2FA 1SVXB 4JSOA 4EUOA 2OWTA 4NE4A 4YB6A 3G3GA 1MY2A 1B7UA 2I0CA 3HN0A 1A8EA 3MPLA 3VLWA 2I3VA 1QKBA 2XXYA 3TQWA 5CC2A 3IJXB 5I2KB 5BUUA 4G2ZA 3Q27A 2RC9A 3FZVA 4IO2A 5I2NA 1B3EA 2ZYOA 1URGA 1USYH 3EN3A 3IR1A 1YCJA 1P1NA 3JV9A 3PV0E 1SI0A 3FV2A 1S7YA 2PYYA 4XKPA 4NEDA 1MY3A 1N7WA 4Z0IA 2QS1A 4PFUA 3CR9A 4NF4B 3N26A 3FUZA 4OERA 3IB2A 4N07A 4QRZA 1BTJA 5I57B 2F7BA 3CG3A 1D9YA 1WDNA 2O68A 4QSEA 4YKIA 3W9VA 3LR1A 4F2QA 3S9NC 1JVXA 5AA4A 4OETA 3PUWE 3M8UA 3OELA 4ZEBA 4KQPA 1HSEA 4LP2B 4IGRA 1B51A 5ELVA 5TP9B 4EQ7A 3OMBA 5CBSA 1P1QA 4R2BA 3HSTA 4PFTA 5H8HA 1MY0A 3RN8A 3RT8A 4H1XA 1OVTA 1EH3A 1URDA 5L8DA 3G3IA 3ZS6A 1H76A 3IO4A 3R7XA 3SEYA 4JDFA 3P7IA 3MUQA 3OEMA 2QPQA 2X7QA 2H4IA 3E13X 3HCQA 3O6IA 5EHMA 1FQBA 1N3WA 1PBQA 1QJMA 2XXTA 4BDQA 1DMBA 2XXWA 4ND9A 3PUVE 3SKPA 4LQ2A 3FXRA 3K02A 3MC2A 3S9LC 1JVYA 3K6XA 2XD3A 4AQ4A 3FV1A 4FEDA 2DVCA 3H7MA 2QMXA 2PX1A 4ESXA 1B9JA 4OFLA 1VR5A 4H67A 1IIWA 1MPCA 1XHYA 5AE4A 3K4UA 2FNCA 3RLFE 2HZKA 2GRVA 2I48A 2Y7RA 4IY6A 2DWHA 2DWJA 1B5IA 4OHNA 2YJPA 1B4ZA 3OENA 4TOZA 2VD2A 3GBBA 5I59A 5DEXA 4XKNA 1GVCA 4H5GA 5TPAA 4F2OA 4LVQA 3TUSA 3UGWA 2HEUA 4LUBA 1JETA 3KN7A 4X1BA 3MVYA 4DCYA 5B7DA 5L9OA 2OK2A 2W7YA 1M5CA 2I3WA 2PT2A 4F1YA 4LATA 4ZEKA 4QSDA 4ZE9A 2QJEA 4MFIA 2VOZA 4JWXA 4HCWA 2KLFA 3VDFA 5JEIA 2IEEA 5AA2D 4YB5A 3DP4A 2ZMBA 3KSXA 3MVZA 1GR2A 1UTHA 1II5A 2DSFA 2NOOA 3BBRA 2DQVA 3HHGA 4U4SA 3VV5A 2HFBA 2ZYKA 1D9VA 3HV1A 3BFTA 2V3UA 1B5JA 1PEBA 2B65A 3O9PA 3SESA 1FCKA 1SDXA 3A09A 5AA3A 4FEBA 5AA2B 2F78A 5ITOA 4BDRA 3IOTA 3FVKA 4QSCA 3MPKA 3EQ1A 5ICQA 1LBBA 3PUZE 3OD7A 4BDLA 1XVYA 1A40A 3FASA 1SW4A 1IXHA 1M5DA 2UVJA 5AA4B 1LBCA 1FTKA 1JEVA 2DE4A 5CMCA 3Q29A 4H6DA 3QUFA 1YTVA 4DCXA 5H8NB 2OLBA 1UTBA 1B0LA 2DVZA 4WKMA 4G77A 1IXIA 1B3FA 1I69A 2ANJA 2Y7KA 4DIGA 2F7CA 1H44A 1DTZA 2GH9A 1XC1A 2DYXA 2QS2A 4FECA 4QFOA 4NF8A 4YKJA 3IORA 3T9UA 3TTKA 4BDNA 4OVJA 3QYTA 2F35A 2O69A 4GL8A 5JK4A 4I1DA 1YAEA 4OFJA 3JZJA 4HCYA 3TKDA 1USYE 1BKAA 2NXOA 2DP8A 1FTJA 1OLAA 5H8FA 2VGQA 3Q25A 3QSLA 4XXUA 5DVJA 2DE3A 3PMVA 3WAFA 3CVGA 4IO6A 2XXIA 4RA1A 4OEUA 2H5YA 2I58A 3BFUA 3RT6B 4LA9A 1QUIA 4ZEDA 5ICTA 1ZLQA 1ZU0A 4PE5B 4U22A 4XIGQ 3VVEA 2IA4A 3FD3A 3H3GA 3KZGA 4FE8A 1AIVA 1QUJA 2X7PA 2XXPA 2ABHA 1MG1A 1LAXA 4X9TA 4TLMB 2CMOA 1UIVA 1OMPA 2AIXA 2R71A 1A55A 3K00A 4F3SA 1SYHA 1D3KA 5TP9A 4GVOA 2F8DA
chains in the Genus database with same CATH superfamily
1P1OA 3KOTA 3RQTA 4F22A 4MMPA 2ZYMA 2EMHA 1YFHA 1A1IA 1IZ1A 3IFCA 4WX9A 1XNRE 4RPOA 2EOXA 3HXLA 4DV4E 4B3SE 4JBZA 3C9HA 3H6WA 2EE8A 4PBHA 5I2KA 1Y1ZA 4U2RA 2F6GA 4R2QA 1PKPA 2LCEA 1FBHA 2EPRA 4NF6A 1Y4TA 3LSLA 2DMIA 5ISUA 2M8CA 1HR0E 5H8QB 3IK6B 4MNPA 1SI1A 2EL6A 4O94A 3TEPA 2V85A 1IMEA 1B3LA 1EH7A 2XX7A 4GWXA 3OO8A 2N8XA 1NKXA 1GGGA 2LMZA 4JI3E 4KPTA 2JXPA 4N6PA 4RXLA 3C4BA 5H8HB 3SETA 2FBPA 2D3IA 1Y3NA 3MP1A 3G3KA 1FQDA 3HO7A 3IAZA 4EQ9A 4JB7A 2EMCA 5K2XA 4N15A 2HQ0A 4F1UA 2YRKA 3H09A 1FPLA 2EOHA 4R2CA 1IUDA 1FPKA 1UIUA 1EYJA 1AMFA 2ENHA 4GRKA 3MHHC 2LTSA 2I4CA 4ISUA 2AL5A 4DZ1A 1B3GA 3FATA 3EHUA 4ZZEA 3IWDA 1MH4A 1DPPA 3BKIB 4LF8E 4FBPA 1DOTA 1PB8A 3C34A 1NV5A 1ZR9A 3C6KA 2YU5A 2I49A 2VD3A 3FVNA 2LUPB 3ECRA 1P47A 3O66A 3VHTB 2CSHA 4IJDA 4GFRA 4LU9A 3USDA 2YTNA 2Z22A 2YTGA 3LMLA 1SYIA 2NUEA 2Y7IA 5L9SA 2Q8MA 2EMGA 1POTA 3THNA 4BC7A 3TAJA 1SR9A 1O7TA 2RCBA 4IS1C 3G3FA 4YMAA 2EOEA 1O63A 5L9MA 1US4A 1YZ9A 1P99A 3MHSC 3EHTA 4FK5C 2PMSA 4RYAA 2EM3A 4GKJE 1B69A 1PBPA 3TCHA 4DMIA 2EMFA 1B2HA 4R72A 4PFYA 1OVBA 2G93A 3GXAA 2A5TB 1LFHA 2F8BA 4X65E 2EPUA 1N0TA 5ET7A 1SW5A 3QUJA 3O29A 3E4RA 4YB7A 4PTKA 3J81C 4AQYE 3O97A 1QUKA 3ZKKA 1NV1A 1AAYA 2AL4A 3A3UA 4OWDA 4DUZE 2Y7WA 5F1QA 5B70A 2RKMA 1HNXE 4P11A 1PJSA 2CEYA 1LAGE 4POWA 2EZ6A 3HHFA 4F9AB 4YMBA 2CZKA 2I0BA 2O1LA 3I3VA 1IBKE 1EZPA 1B5HA 4KHPE 3T22A 4ELPA 5H8QA 5JTYA 2R1FA 4FORA 4NXNE 4F31B 2LTRA 4PDDA 3V8XB 3VXCA 3K6UA 4PFWA 1CNQA 2H99A 5DVFA 5A5XA 2EPLX 2RPCA 4R2EA 4LF9E 3IB0A 2GHAA 1MDP1 2VP1A 4G61A 1GTKA 1JNFA 2Z23A 3CFLA 4R2FA 3MVWA 1B05A 2V3QA 1LB9A 4Q35B 2L2NA 4H8JA 3ODBA 2ONKE 4GD5A 2GLIA 3D4GA 4FIMA 1JW1A 3UN6A 3FXQA 4JVCA 2H98A 1NV7A 3IWBA 2HHHE 3MSTA 2EPXA 2EM8A 4DR5E 4BMJA 4KYEA 3CSBA 1WHNA 3TTNA 3OMLA 3FGSA 4EF1A 2L3JA 4K0KE 3C35A 1IQ7A 4H46A 4F6NA 2DLQA 2QVVA 4HW8A 4P8BA 2ADRA 5IAIA 3LV0A 2VQEE 4DV3E 5I56B 2XWIA 1QVSA 3H6VA 2R6GE 3VXBA 4DUYE 2HXWA 2RSIA 1X48A 2ONRA 1JP4A 4POXA 4H45A 4NF8B 4XTCQ 3U8QA 5FTIA 3H06B 2ALUA 1IMBA 4KFQA 2DOJA 3FXUA 4X1DA 3AV0A 3RNNA 1SD3A 5TPAB 1MQHA 3KBRA 2M7QA 4QF9A 4C0RA 2HAUA 4OESA 4BHCA 3KOSA 1GV8A 5ITPA 1PJTA 4ZEFA 1JK2A 2Q9TA 3A3CA 4YZZA 4R03A 1G0HA 1B7ZA 2HCAA 5DVIA 4R9GA 2EPKX 2YTPA 1BB8A 1URSA 1MXYA 5KDTB 3SEWA 4C1TA 4YKPA 2RCAA 4UACA 3ISPA 1I94E 4NF0A 3BIHA 3FJMA 4RK9A 1XVXA 1EYKA 1N76A 1LBVA 2XXXA 2ODRC 2RS7A 1SW2A 2KQZA 1QW0A 5DTBA 1X49A 1VFEA 4BCAA 3B6WA 3K2DA 1BK4A 3C4MA 2DS9A 2EMBA 3K6WA 2LV2A 2PRTA 5KL2A 1NL5A 4OANA 1FPIA 5IZ1A 3I5OA 3N6TA 2EMIA 1LCFA 4F6MA 4GLIA 4O24A 2EMWA 4AS4A 1A1KA 3K01A 3CRBA 2D5WA 4YB6A 2MC5A 3G3GA 1MY2A 3MPLA 4N91A 4O43A 3SZPA 3IJXB 5I2KB 1B3EA 1USYH 3IR1A 4PAFA 3OTOE 1SI0A 4MNCA 3K6QA 4QRZA 4NF4B 3FUZA 3IB2A 3CG3A 3VK6A 4QSEA 1RDXA 4GWYA 2K4VA 1X3CA 4EQ7A 1EH3A 3ZS6A 3G3IA 3SEYA 4JDFA 4PFRA 2OWZA 4BDQA 1PBQA 3C4TA 2XXTA 3PUVE 4JI4E 3FXRA 5A5LA 2HGHA 1G0IA 1B9JA 1VR5A 1IIWA 4KZSA 1MPCA 4WYQB 5AE4A 2H36X 4YY3E 5A6BA 2DWHA 4JVDA 1B5IA 2PCRA 1B4ZA 1FPEA 1QNTA 4O7IA 5B7DA 1JETA 5L9OA 4ZYDA 4R2SA 2YTJA 1YYOA 4HCWA 4YB5A 2ZMBA 3KSXA 3VV5A 2CZIA 2DQVA 2EOMA 2HFBA 2ZYKA 2EPZA 3HV1A 4DR2E 3BFTA 1B5JA 2B65A 1SDXA 5AA2B 2F3BA 5ITOA 4IR8A 2EPNA 2EOSA 4OA4A 4QSCA 3OD7A 4BDLA 2JR1A 3HQ1A 5AA4B 1LBCA 1JEVA 2XXKA 3QUFA 2DVZA 5LL6R 1B3FA 2Y7KA 1YUJA 4DIGA 2NABA 2DYXA 1FKAE 1KJKA 4FECA 4PAKA 4NF8A 3TTKA 4BDNA 4OVJA 4L8NA 4GL8A 2GHFA 1DBZA 4I1DA 1YAEA 5JK4A 4HCYA 1USYE 2EPAA 3WAFA 5FLXC 3BFUA 1DI2A 4LA9A 4ZEDA 1FBFA 3VVEA 2VQFE 2G7HA 2X7PA 2ABHA 1MG1A 4GWUA 1A55A 1SYHA 4JI2E 4LFCE 1ZBTA 3CIJA 3Q26A 3T9XB 3LSWA 5I58A 1A7LA 4OENA 3GZGA 2GPIA 2XHDA 3MP8A 3C31A 3D4CA 2EOZA 3KGCA 2UXDE 5A6BD 1F2IG 1FBEA 1B58A 2HZLA 2LVHA 1XMQE 4X62E 5EQ9A 4U4XA 5AA2A 4GWZA 3F11A 1STUA 4NWDA 2RC8A 4I62A 2EM7A 3B6TA 4IO4A 4PFIA 4PGPA 1AL3A 1ZAAC 3TQMA 4ESWA 1IQSA 1MXZA 2QMWA 3QK6A 4G68A 4LF4E 4YICA 4DV2E 1ANFA 2XD2A 4LFBE 5H8FB 4DLDA 2N3HA 3G3JA 4U21A 4F3PA 4DR4E 2A5TA 3PUYE 1EU8A 2Y84A 4GZNC 2F34A 2F97A 2B4LA 4P7DA 1ZIUA 2EMZA 3U65A 1IITA 4NAPA 4IGTA 4WSPA 2WKYA 3T1HE 5CM6A 4NF5A 1RMDA 5AE1A 1HSLA 5IXMB 2GHBA 3ROJA 2EN4A 1US5A 4GXSB 4H5FA 4WEDA 4L17A 5LMUE 2JOBA 5A6JA 4RJZA 3E3KA 4HXVA 4OOGC 1BP5A 1MGTA 1R1NA 4NF4A 1RYOA 4JWYA 4G4PA 1MY4A 3TYHA 2O84X 1I6BA 3OSQA 3TFLA 2H25A 3IJOB 4XKRA 3O6HA 4MLVA 3PPPA 1X6HA 3L6GA 1K9YA 5J16A 4OVSA 2B7VA 2CZLA 2B7TA 4LONB 5KL6A 4BDOA 2L2KB 3FJ7A 4GF8A 5KZTA 5J1DA 3DELB 4R75A 4M9VC 3S9EA 1RKMA 3PUXE 4DR7E 1F9BA 2BBGA 3QIMA 3J80C 3JYRA 2NWJA 4DV5E 4ZZAA 5IZ3B 5IT9C 5F24A 1TF3A 3PMWA 1XNQE 3LSFB 1NMUA 2VHAA 4BLAA 4ELOA 3H4ZA 1P1UA 3RPWA 3M3KA 3KG2A 1MXVA 1NV4A 4OQOA 4R73A 2Y5KA 2EMYA 4TLLB 1FTMA 5I57A 2XXUA 3L00A 4LN5A 3O28A 2JWOA 4NHRA 2THIA 2Q8JA 1PDAA 1J26A 3W9WA 1XOCA 1Y9UA 4P0IA 2LE2A 3T96B 1FPFA 5KDTA 5IKBA 4R2RA 4NTLA 2UXAA 3T0JA 2QL3A 1UBDC 3FVOA 3OEKA 2HJJA 4N6DA 5AC4A 3SEVA 1LGBC 3PPOA 2RQLA 2WBBA 2REGA 4LF5E 4HTGA 1UQWA 2D9HA 2MKNA 2Z8DA 2VF1A 1ZJLA 2EMLA 4OYVA 1Z7NE 2ZNUA 4XF5A 1DCUA 1KA0A 4G8MA 2ESNA 1OQHA 4O5GA 4F9CB 2R76A 1B6HA 3KEIA 3IWCA 4I40A 1TT1A 3H03A 3K1NA 1JK1A 4WEPA 2XWOA 2EQ1A 2R9JA 5EYGA 4KI0E 4NQ8A 1IXGA 1A54A 1WVJA 4GIZA 4WXJA 1INPA 3AXFA 4O3AA 1BBGA 3DM0A 2I4BA 1L5TA 1FTAA 4KXPA 2UU9E 3RMPA 2F5XA 2F3DA 2P0SA 2IHR1 3MZ1A 4GWWA 3TQLA 3DJWA 1MEYC 2Q2CA 3NOHA 1Y1MA 5AA1A 2D21A 2OBGA 5LMNE 2V88A 3OO6A 3VLVA 5A5XB 1UHZA 3IOVA 2O51A 2OX3A 3RY3A 1M5BA 3TTMA 3VFJA 2WX9A 1XS5A 2DXRA 3ILTB 3EKIA 3T66A 3G7WA 2XA5A 2QVRA 2ELYA 3P1XA 4PP0A 1MQJA 3MW0A 2BJJX 2I6EA 2AYSA 1NI9A 4B3TE 2F36A 4ZS9A 4HE1A 4GX4A 1TFDA 5TSEA 3T9VA 2A25A 4MAGA 2L3CA 1XT8A 4OTEA 2EM4A 2Q2AA 1AWBA 3CFXA 1FJGE 4PF6A 4Q8RA 3ZKLA 1D9QA 1M5FA 4XFEA 2B4MA 4QFPA 1FQAA 1SW1A 4E0WA 5I56A 1FTOA 4KHZE 1KA1A 3H6UA 1H45A 4THIA 1ATGA 2NVUB 4X66E 2WZOA 1ZTYA 1FTLA 2LUQA 2CEXA 2Z8FA 4PF8A 3EPKA 4X8WA 1CE2A 3E9XA 3QXMA 1MM6A 3MBPA 3W15C 2EOFA 1J1NA 4O7MA 4ZDMA 3PMXA 1JQFA 1LSTA 3RUMA 2R8TA 4OZ9A 3UK4A 4M2ZA 2M9AA 4MLQA 1NH7A 2UVGA 1NNTA 4U23A 3B50A 2OCUA 5IGAA 4PGNA 5FHOA 2DB2A 2JJKA 1QU6A 4F18A 1FPDA 4QFNA 1G2DC 3IOWA 1B1HA 2FHYA 4MBPA 2LT7A 1T39A 2J7JA 1OQGA 4Q0CA 5I84A 2V86A 2EM9A 1MPBA 4M4GA 1LB8A 1N3GA 1RQ0A 1UN6B 4JSOA 4P9KA 4NE4A 2I0CA 1B7UA 1A8EA 4P3LA 1FPBA 3TQWA 5CC2A 5BUUA 3EN3A 1URGA 3JV9A 5M2VA 1A1FA 1YCJA 4DR6E 4NEDA 1MY3A 1N7WA 1YSAC 3CR9A 5I57B 1TN9A 4N07A 4QXDA 2O68A 3S9NC 3T1YE 4YKIA 5EYHA 3MSWA 1JVXA 4GX3A 2P3NA 5TP9B 3OMBA 2EPMX 3HSTA 1MY0A 2CTDA 4H1XA 2EN1A 5EQAA 3P7IA 2RS6A 3MUQA 3E13X 2X7QA 2H4IA 3O6IA 4MJOA 1FQBA 1Q9DA 1QJMA 3SKPA 4LQ2A 4P56A 1JVYA 4AQ4A 3H7MA 2KR0A 2WEFA 5FBPA 4H67A 2MC6A 3RLFE 2I48A 4IY6A 3KZYA 2DWJA 2M4IA 2VD2A 3GBBA 4LTYA 5DEXA 1GVCA 4H5GA 4F2OA 4LVQA 3UGWA 2HEUA 4X1BA 3MVYA 4F1YA 2I3WA 2PT2A 4LATA 4RH8A 4X9JA 4QSDA 1YUIA 2QJEA 4MFIA 4LF7E 1T4LB 5AA2D 3DP4A 1GR2A 3HHGA 2MKDA 3BBGA 4B3RE 5AASA 2ENCA 1D9VA 1A1HA 2V3UA 1PEBA 3O9PA 2EL4A 5AA3A 2F78A 3IOTA 1NEIA 3MPKA 1A40A 3FASA 1SW4A 1M5DA 2P3VA 3Q29A 1UTBA 1B0LA 4WKMA 4G77A 1I69A 1H44A 4R2DA 5A69A 2ZZVA 5IWAE 1XI6A 2QFLA 2EORA 2NXOA 5H8FA 4XXUA 5DVJA 2DE3A 3CVGA 4IO6A 2XXIA 4RA1A 3KWRA 1YYZA 1QUIA 5ICTA 1ZU0A 4PE5B 4U22A 4DCXA 3FD3A 2FIXA 2V83A 2CPNA 5I5PA 2YWQA 4X9TA 1L4SA 4TLMB 3BIGA 1OMPA 2R71A 1GQEA 1DSNA 1D3KA 4R2PA 4J8ZA 4OVRA 3R26A 4RK2A 5HM4B 3I6VA 4R6HA 4E0XA 1LFIA 3IX1A 4GXAA 4I3EA 3TPAA 4EXLA 4NMYA 5EHSA 4PCDA 3DP6A 2OZZA 2Q88A 3T93B 2Q89A 1EH6A 1FBDA 1B1XA 1FW0A 2X26A 3IFAA 5ET6A 1J5EE 3TELA 2MDGA 1KWHA 5HPQA 2YU8A 4HE0A 3N5LA 3R6UA 1I6AA 1EZOA 3T1BA 1AH5A 4IO3A 1X47A 1KZ8A 2XX8A 3OXNA 3WAEA 3KC0A 4F3BA 5KCJA 2Z8EA 3HFUA 4H65A 5EYFA 5AE2A 3TCGA 3MAMA 3LSXA 4OVTA 4N81A 1D4NA 1Y3QA 2DMYA 2EJ4A 4NXME 1B40A 4DXBA 3KN3A 3OOAA 2JPAA 3TZAA 4M30A 4YAHX 3TTLA 3FBPA 3EF7A 3K6VA 5I2NB 4LQ5A 2XXQA 3EHSA 3UIFA 4F1VA 1R9LA 4BHBA 3DF6A 4G68B 4RY1A 3EPHA 2DE2A 2EQ0A 4O3CA 4U1ZA 2UXCE 4RHBB 1BLFA 4OX9E 2KONA 1VE4A 1MM7A 5A6KA 3K0VA 2WBUA 4L5NC 1G2FC 4JI5E 2YTDA 1YYWA 4U1OA 3UP9A 3HPSA 3MZ9A 1DPEA 3RYDA 1O64A 2ZM6E 3DLNA 1UTBB 4FATA 1MXUA 1SBPA 3S2VA 3SEXA 4HE2A 4I9DA 2V93A 3RTWB 4G68C 1N3XA 4ZYHA 3S4UA 2DSYA 4GOTA 4FJPA 2PT1A 3CFZA 1IMDA 2ZZWA 1QGXA 4JSDA 1IBLE 4O8MA 4LF6E 4GEQB 1NUYA 4Z7EA 3K1MA 4XEQA 1P1WA 2EPPA 1NH8A 2GFEA 3N94A 4GQOA 1ELJA 2EOJA 2RC7A 4F19A 4ELQA 2VPNA 2B3TB 4ZE8A 2B3BA 5H8SA 2EL5A 4ZYGA 1MH3A 1UILA 3B7DA 2PFZA 3LLHA 4N4UA 2UVIA 2QRYA 4I8CA 1LBYA 2EMKA 1QKAA 2QS3A 4ECFA 5LDZA 3Q28A 4DKKA 4KCDA 2V87A 3GLBA 4P0GA 1N34E 4EF2A 4Q28A 4KYDA 3UORA 1BBOA 2HHMA 1X6EA 1YPNA 3C36A 5CMBA 2E1SA 1X6FA 1VSOA 1UTHB 4NX1A 2ONSA 5L8DA 4NZVA 1FQFA 3KSJA 1RYXA 2HPGA 3QAXA 2G29A 3M3LA 4AB5A 5DNYA 3THOB 1DGCA 2F6PA 4Q30B 2EMAA 4YU0A 2RINA 4N8GA 2FIEA 3LBSA 1AOVA 5IM2A 3EPEA 1B52A 2E72A 1LAHE 4R8OA 1XMOE 3DP8A 3V83A 3TTRA 3T9HB 4MHFA 5DYHA 3B8BA 4O3BA 2LJHA 2V4CA 2QS4A 4MCOA 4WXCA 3FXBA 3SERA 2PBWA 4F39A 4WXDA 5A6AA 1B32A 1FRPA 2LAOA 3GYYA 5A2QC 4DV0E 4KD5A 1CB6A 4N4RB 1Q35A 2FA7A 3LC8A 2MKZA 3PU5A 3E78A 1H43A 2JVAA 3PPRA 2XWKA 5CI5A 3V5AA 2HAVA 4GWSA 1EH8A 3U1OA 3S9MC 2XXVA 2ZYNA 1MXXA 1OIBA 5FTHA 2UYEA 5I7IA 1JEUA 4WPYA 4KCCA 3U72A 1RDZA 3A29A 3SDFA 4DXCA 1ZKBA 2EN8A 4TUIA 2YRMA 2JYAA 1WRJA 3FIRA 1IMFA 3O6GA 5KL3A 4M1VA 1TF6A 1MS7A 5BWJA 2JP9A 2FVZA 4LFAE 2DIXA 2NA2A 4DV6E 2ZNSA 4K3FA 4FAJA 5T6JA 3PTYA 2XXHA 5CMKA 4MX6A 1IBME 1LLMC 2VT5A 1FBCA 1MXWA 4QBAA 3KFMA 3KBZA 3ILUB 4R6YA 4QHQA 3MJNA 4I3YA 1FJ6A 2FYIA 1NNKA 1FSAA 4G8HA 2Y7PA 2EM2A 3FJGA 1B3HA 2UYFA 3EPLA 4PBQA 1VDWA 2EPOA 1MY1A 3OO9A 3QMFA 4H0WA 4NG7A 4HEIA 2I13A 3HPIA 5CBRA 4DR1E 1A8FA 1Z1BA 2LRSA 2OWTA 3HN0A 1EYIA 2I3VA 3F6GA 4NGUA 4G2ZA 5I2NA 2RC9A 4IO2A 2E5LE 3PV0E 4RPNA 1IMUA 3FV2A 1S7YA 2Q8UA 4N8YA 4Z0IA 4PFUA 3N26A 4OERA 1ZU1A 1BTJA 2F7BA 4JI8E 2WYPA 4F2QA 2WYKA 3W9VA 5AA4A 3PUWE 4KQPA 1HSEA 4LP2B 4X04A 5CBSA 1P1QA 3RN8A 4PFTA 1OVTA 1URDA 2F4VE 1H76A 1NUZA 3IO4A 3R7XA 3HCQA 1NV3A 2QPQA 3BGHA 4NHBA 1N3WA 2RSMA 2XXWA 2EM6A 5I3SA 3K02A 4X8RA 2XD3A 4M0VA 4JI1E 3FV1A 4FEDA 2DVCA 2QMXA 2PX1A 3K4UA 2FNCA 4JI7E 4N6KA 2Y7RA 5ESYA 2ENAA 4GBWA 2YJPA 5I59A 4XKNA 4DI3D 3M99B 4PE3A 3KN7A 2EQ3A 4DCYA 1YYKA 5DW8A 3VDFA 2Q74A 5JEIA 2NUGA 1II5A 2NOOA 2UUBE 1RC7A 2B9DA 4BDRA 5KL7A 3KZZA 3PUZE 1XVYA 4PDHA 1FTKA 2DE4A 1A1GA 4H6DA 5AE3A 1YTVA 5H8NB 1N33E 2QVUA 1IXIA 2ANJA 1XC1A 3T9UA 2L2MA 1GZ6A 2ODRD 2O69A 2EM0A 5T3JA 1FTJA 1OLAA 2VGQA 2L8TA 1NV0A 2WBDA 3D1RA 4OEUA 2H5YA 2I58A 3RT6B 5CFFE 4XIGQ 3RPLA 3H3GA 3KZGA 4FE8A 2XXPA 2YTIA 1LAXA 2CMOA 2AIXA 5TP9A 1SPIA 2F8DA 2NUFA 4GBVA 1PC3A 2ZZXA 4O4KA 4N13A 4MF3A 3ADJA 2XX9A 2DWIA 1EKZA 2JY9A 1SFEA 1LLSA 4PC9A 3K1PA 2YPNA 1X5WA 4GKKE 1ZBMA 1Y4CA 3TMGA 4X48A 2EM5A 2EOYA 1FJ9A 4R2AA 2L92A 2EN7A 1B7HA 2DWAA 4BS9A 1H3DA 4YKKA 3VVFA 5FHNA 2YTOA 1PB9A 5KCJB 3VE1B 1Z7ME 5F7VA 3C32A 1DTGA 4ZYEA 1MPDA 4OXVA 3UA8A 4JV5E 1DK4A 1LBXA 2LJUA 2EOIA 3IO6A 1WHQA 3IB1A 3C33A 4OMBA 2XWVA 1NFTA 1WXRA 2O7UA 5DT6A 2P1SA 2FTXB 3PD8A 3HPZA 1JW4A 4GVOA 1PB7A 4ZECA 1NV6A 2ZXTA 4NF5B 4QFLA 1NV2A 1JW5A 1BIYA 4JVIA 4H8IA 2DXYA 5F3WA 3G3HA 2YSOA 4LZ8A 1LCTA 4R6KA 2E1MA 4G8NA 4PAIA 1IMCA 3V89B 5I58B 3CSGA 1NUXA 3H6TA 1N04A 2DLKA 5KL4A 2V3TA 1B4HA 4MH5A 1Y3PA 1MRPA 1ZBQA 1N84A 4PQJA 1POY1 2RF1A 2MDRA 3F6HA 4IO5A 4IY5A 4XKQA 3TDJA 3JU0A 2UVHA 1QULA 1M5EA 4ONYA 2A5SA 4EXKA 1NNFA 3OSRA 1KYQA 4GX6A 4UABA 1FQCA 4TQUQ 3OO7A 1MQGA 4EDPA 3PPNA 3EPJA 1LBZA 2YLNA 4RNSA 2H9BA 3LUYA 1O0WA 2JOXA 2FV4B 4Q5TA 2EN6A 1A99A 2PVUA 1I6QA 5LOMA 4OFOA 2WCC3 2V8QB 4JYAE 2F7AA 4ELRA 3N6UA 3CI8A 1N7XA 1FPGA 3PPQA 1LAFE 2OWSA 2L5VA 1TXFA 2QSXA 4KWYA 3KJTA 3B6QA 2FGGA 1TFAA 2EN2A 2KHXA 1IMAA 4PFBA 3JTZA 3HTXA 1IEJA 2HC5A 1FBGA 3U94A 2L33A 2ZNTA 3BIDA 4F3GA 2CZHA 4WFTA 1MQDA 3TCFA 3IOUA 4IB2A 4BDMA 4NF6B 4OEVA 4DV7E 3ONMA 3M3FA 5EQ7A 2YZTA 1LEVA 2O6AA 3FVGA 4JWOA 2RTXA 5H8NA 4HS7A 4P47A 3IL1B 2EP3A 1WJPA 3E79A 3MZBA 3CHGA 3THIA 3ADLA 5ADZA 5CMMA 1NNPA 2O7IA 2B3FA 1NUWA 3GBAA 3KN8A 1B0HA 1OLCA 2V25A 2E0SA 4WSGA 3J7Yp 5CRYA 1ZMGA 3VLUA 4GWOA 4LZ7A 3O2AA 4QFKA 4EQBA 5LTCA 3RTFB 3VVDA 3AUZA 5I59B 4DV1E 1IQOA 1YXIA 4DXUA 3ZSFA 2YTQA 4LZ5A 4IO7A 4F2JC 2BB8A 3KJ7A 4JI0E 5ET5A 4I8OA 1LFGA 4KR5A 3U92A 4UA8A 4F29A 3RGYA 2NUVA 5BR8E 2OJTA 1RDYA 3U93A 1B46A 4MEVA 1DQ3A 1HSJA 1R6ZA 2REJA 1T4OA 2WBSA 4MNIA 4DDDA 1S50A 4R9FA 1Q1KA 2EMXA 2BJIA 1WODA 3CG1A 2V89A 2V84A 3MWBA 3VYYA 1N32E 3PGFA 1PJQA 3KC1A 4P1LA 3LUZA 1VFDA 1A1LA 2I9IA 1K9ZA 3MQ9A 1T0KA 2XXRA 5K2YA 4ZEIA 4GL0A 1S9TA 5TU0A 2UUAE 1R9QA 3FIGA 4X64E 2UUCE 1EZ9A 2PFYA 1LBWA 2O1MA 5ET8A 1MQIA 2LBSB 4C1UA 1MDQA 3PD9A 1T38A 1YZ0A 2KOUA 4R74A 1A1JA 1TWYA 4NWCA 2EOQA 1Y20A 2P2AA 4NN3A 3MVXA 4OVPA 2VE7C 2YT4A 5FHMA 1SQYA 3ADGA 2EN3A 5HBCA 3MP6A 2YRHA 4JXIA 4PETA 5JTYB 4AB6A 4JI6E 3L6HA 5IZZA 3TODA 3RPLB 1IXCA 5DEXB 4MIJA 1FQEA 4DE8A 2N3GA 2UXBE 1SVXB 4EUOA 3VLWA 3J7AG 4YHHE 1QKBA 2XXYA 3C6MA 2YTFA 3Q27A 3FZVA 2ZYOA 3TKDA 4P78A 1P1NA 4XKPA 2PYYA 2QS1A 5KL5A 4N17A 4F54A 1HNZE 2EOOA 1D9YA 1WDNA 3LR1A 1FPJA 4OETA 3M8UA 3OELA 4ZEBA 4IGRA 3ADIA 1B51A 5ELVA 4R2BA 5H8HA 3RT8A 3ZOQB 3OEMA 3QG5C 5EHMA 3VYXA 1DMBA 4ND9A 4AS5A 3MC2A 1FBPA 3S9LC 3K6XA 4ESXA 2GQ1A 4OFLA 2YSPA 5EQ8A 1XHYA 2ELZA 2HZKA 2GRVA 4OVQA 3MYUA 4OHNA 3OENA 4TOZA 5TPAA 3TUSA 4LUBA 4F9BB 2M1SA 2OK2A 2W7YA 1M5CA 4ZEKA 2HXRA 4ZE9A 2EPCA 2VOZA 4JWXA 2KLFA 2IEEA 4BBYA 3MVZA 3BBRA 1UTHA 2DSFA 4U4SA 5LLQA 4DR3E 5AC5A 3UK3C 3SESA 1FCKA 3A09A 5IZ3A 4FEBA 3FVKA 5ICQA 3EQ1A 1T4NA 1LBBA 2VPOA 1IXHA 2UVJA 5CMCA 4P1EA 2EWLA 2OLBA 2L6MA 2F7CA 4QFOA 1DTZA 2GH9A 4DI4B 2QS2A 4YKJA 3IORA 2DGCA 2VRDA 3QYTA 2F35A 4OFJA 2DRPA 3JZJA 3JAMC 1BKAA 2LO3A 2DP8A 1NCSA 2CT1A 3Q25A 3QSLA 3PMVA 2DDKA 2YTEA 4BC9A 2Y5LA 1ZLQA 2K7IA 5IV8B 1N36E 2IA4A 3BF2A 1AIVA 1QUJA 2WBTA 4TUGA 1HNWE 1UIVA 3K00A 4F3SA 4KYSA 4B3ME 3SEUA
chains in the Genus database with same CATH topology
3CIJA 3R26A 1P1OA 3Q26A 4RK2A 3T9XB 3KOTA 1PC3A 3RQTA 3LSWA 5HM4B 4N13A 4MF3A 3I6VA 4R6HA 1A7LA 2XX9A 1LFIA 4E0XA 2ZYMA 4OENA 4F22A 5I58A 2DWIA 3GZGA 3IX1A 1IZ1A 2XHDA 3MP8A 3C31A 4GXAA 3D4CA 3TPAA 4RPOA 1LLSA 4EXLA 4NMYA 3K1PA 5EHSA 2YPNA 3KGCA 4JBZA 3C9HA 3H6WA 3DP6A 2OZZA 5I2KA 2Q88A 1Y1ZA 3T93B 1B58A 1ZBMA 2F6GA 2HZLA 1Y4CA 2Q89A 4U2RA 3TMGA 4X48A 1FW0A 1B1XA 2X26A 4U4XA 3TELA 1KWHA 5HPQA 1B7HA 2DWAA 3N5LA 5AA2A 3R6UA 3F11A 1Y4TA 1H3DA 1I6AA 4NF6A 1EZOA 4NWDA 2RC8A 3LSLA 4YKKA 4I62A 3VVFA 1AH5A 4IO3A 5FHNA 3B6TA 4IO4A 5ISUA 2M8CA 5H8QB 1AL3A 3IK6B 1PB9A 2XX8A 3OXNA 3VE1B 3WAEA 1Z7ME 5KCJB 1SI1A 3TEPA 1B3LA 4F3BA 5F7VA 3C32A 1DTGA 5KCJA 2Z8EA 1MPDA 2XX7A 3OO8A 4OXVA 3UA8A 1NKXA 4ESWA 1GGGA 1MXZA 2QMWA 4H65A 3IO6A 3QK6A 4G68A 5EYFA 3IB1A 4YICA 3C33A 3TCGA 4KPTA 3MAMA 4N6PA 4OMBA 3LSXA 4RXLA 1NFTA 1ANFA 2XD2A 5H8HB 2O7UA 5DT6A 3SETA 5H8FB 2P1SA 4DLDA 1D4NA 1Y3NA 1Y3QA 2D3IA 3G3JA 3MP1A 1JW4A 3G3KA 3PD8A 4U21A 1FQDA 2A5TA 3HO7A 3IAZA 3PUYE 4EQ9A 1B40A 1EU8A 1PB7A 2Y84A 4JB7A 2ZXTA 4NF5B 2F34A 4QFLA 5K2XA 2F97A 3KN3A 4DXBA 1JW5A 1BIYA 1ZIUA 2HQ0A 3OOAA 4H8IA 3TZAA 4F1UA 1IITA 2DXYA 3G3HA 4YAHX 3TTLA 4LZ8A 1LCTA 4IGTA 4R6KA 3EF7A 3K6VA 4G8NA 3V89B 2WKYA 1IUDA 1UIUA 5CM6A 5I2NB 5I58B 3CSGA 4NF5A 1AMFA 4LQ5A 4GRKA 2XXQA 3H6TA 2I4CA 3EHSA 2AL5A 4ISUA 4DZ1A 1B3GA 3UIFA 1N04A 3FATA 1HSLA 2V3TA 1B4HA 3EHUA 4F1VA 2GHBA 4MH5A 4ZZEA 1MH4A 1Y3PA 1DPPA 1US5A 1R9LA 4GXSB 4H5FA 1DSNA 3BKIB 1MRPA 4WEDA 4L17A 1DOTA 1N84A 1PB8A 4G68B 4PQJA 1POY1 3C34A 4RJZA 2RF1A 4RY1A 3E3KA 2I49A 2VD3A 3FVNA 3O66A 3ECRA 2DE2A 4IO5A 4IY5A 4XKQA 2UVHA 3TDJA 1QULA 1BP5A 1M5EA 1R1NA 4GFRA 4O3CA 4U1ZA 3USDA 4NF4A 2Z22A 1RYOA 4JWYA 1BLFA 4G4PA 4ONYA 2A5SA 1VE4A 1MY4A 1SYIA 1MM7A 3TYHA 1NNFA 3K0VA 2O84X 2Y7IA 3OSRA 4EXKA 5L9SA 1I6BA 3OSQA 3TFLA 1FQCA 1POTA 2H25A 3IJOB 4XKRA 4TQUQ 3OO7A 1MQGA 3O6HA 4U1OA 4MLVA 3TAJA 3MZ9A 3PPPA 1DPEA 3UP9A 4EDPA 1O7TA 2RCBA 3L6GA 3G3FA 1O64A 3PPNA 3SEUA 4YMAA 3DLNA 1O63A 1UTBB 2CZLA 2YLNA 1US4A 4LONB 5L9MA 4F3PA 4RNSA 1P99A 4FATA 3EHTA 1MXUA 2H9BA 1SBPA 3LUYA 3S2VA 2PMSA 3FJ7A 4GF8A 4RYAA 3SEXA 4BDOA 5KZTA 1PBPA 4Q5TA 3TCHA 5J1DA 3DELB 2V93A 4I9DA 4R75A 1B2HA 4G68C 4R72A 3RTWB 4PFYA 1OVBA 1A99A 1N3XA 1RKMA 3PUXE 3S9EA 1F9BA 2PVUA 3QIMA 2NWJA 3JYRA 3S4UA 4GOTA 1I6QA 4FJPA 2G93A 2PT1A 3CFZA 3GXAA 4ZZAA 5LOMA 4OFOA 2A5TB 3PMWA 1LFHA 2F7AA 4JSDA 3LSFB 1N0TA 3N6UA 4ELRA 3CI8A 1NMUA 2VHAA 1N7XA 4BLAA 1SW5A 3QUJA 3O29A 3H4ZA 3PPQA 4ELOA 1P1UA 4Z7EA 1LAFE 2OWSA 3K1MA 3RPWA 3E4RA 1P1WA 1TXFA 3M3KA 4YB7A 3KG2A 1MXVA 2QSXA 1NH8A 4OQOA 4R73A 3KJTA 2GFEA 3N94A 1QUKA 3B6QA 3O97A 2AL4A 4GQOA 3A3UA 4OWDA 3ZKKA 1ELJA 1TFAA 2RC7A 4F19A 4TLLB 1IEJA 4ELQA 2Y7WA 1FTMA 5I57A 2XXUA 5F1QA 3U94A 3O28A 5B70A 2THIA 2ZNTA 4QFKA 4F3GA 2Q8JA 2RKMA 1PDAA 1MQDA 4P11A 4ZE8A 3IOUA 1XOCA 3TCFA 1Y9UA 2B3BA 4IB2A 4P0IA 5H8SA 3T96B 1LAGE 4BDMA 1MH3A 4NF6B 4OEVA 4POWA 5KDTA 3B7DA 3HHFA 3ONMA 3M3FA 5IKBA 2UVIA 4NTLA 2O6AA 2QRYA 4YMBA 3FVGA 4I8CA 2I0BA 2O1LA 2UXAA 4JWOA 5H8NA 2QL3A 3FVOA 3OEKA 4HS7A 1QKAA 3IL1B 2QS3A 3I3VA 4ECFA 4KYSA 1EZPA 1B5HA 3Q28A 4KCDA 3SEVA 1LGBC 3PPOA 2REGA 3GLBA 4P0GA 4HTGA 1UQWA 3MZBA 3T22A 3THIA 4ELPA 5H8QA 2Z8DA 4EF2A 1ZJLA 5JTYA 4FORA 4KYDA 5CMMA 3UORA 1NNPA 4F31B 2O7IA 4OYVA 1Z7NE 3V8XB 2ZNUA 3VXCA 2B3FA 3K6UA 3GBAA 3KN8A 5M2VA 1B0HA 1OLCA 4G8MA 4PFWA 5DVFA 1YPNA 2H99A 5A5XA 2ESNA 1OQHA 3C36A 5CMBA 1B6HA 3IB0A 3KEIA 2V25A 2E0SA 2GHAA 5CRYA 1MDP1 1ZMGA 2VP1A 2E1SA 1GTKA 1VSOA 1JNFA 2Z23A 3CFLA 1UTHB 1TT1A 2ONSA 1B05A 3MVWA 2V3QA 3H03A 1LB9A 3K1NA 3O2AA 1FQFA 4H8JA 3ODBA 2ONKE 4GD5A 3KSJA 1RYXA 4WEPA 4EQBA 3QAXA 3RTFB 3VVDA 2G29A 3M3LA 4AB5A 5I59B 3D4GA 2R9JA 2F6PA 4DXUA 4FIMA 1JW1A 4KI0E 4Q30B 4YU0A 1IXGA 3ZSFA 1A54A 1WVJA 2RINA 3FXQA 4GIZA 2H98A 3UN6A 4WXJA 4ZECA 3LBSA 4LZ5A 3AXFA 1AOVA 4IO7A 4O3AA 3EPEA 1B52A 3DM0A 2I4BA 1LAHE 1L5TA 3KJ7A 4KYEA 2F5XA 2P0SA 3CSBA 3MZ1A 3DP8A 3TTNA 3FGSA 3TTRA 3V83A 3TQLA 4EF1A 2Q2CA 3T9HB 1Y1MA 1IQ7A 3C35A 5DYHA 1LFGA 4KR5A 5AA1A 3U92A 2D21A 2OBGA 4HW8A 4O3BA 3OO6A 4UA8A 4F29A 3VLVA 5A5XB 5IAIA 3IOVA 2O51A 3RGYA 2NUVA 3RY3A 5I56B 1M5BA 1QVSA 2OJTA 2QS4A 3TTMA 3H6VA 3U93A 2R6GE 1XS5A 3VFJA 3VXBA 2DXRA 2HXWA 3ILTB 3SERA 1B46A 2PBWA 3T66A 3G7WA 2ONRA 4POXA 4XTCQ 4NF8B 3U8QA 4PP0A 1MQJA 3MW0A 5FTIA 4F39A 2BJJX 1HSJA 2ALUA 2I6EA 1B32A 2AYSA 1R6ZA 2LAOA 2F36A 3H06B 2REJA 4ZS9A 4KD5A 4KFQA 1CB6A 2DOJA 3FXUA 4DDDA 1TFDA 1Q35A 2FA7A 4X1DA 3T9VA 3LC8A 3RNNA 1SD3A 1S50A 4R9FA 1Q1KA 5TPAB 1MQHA 1XT8A 3PU5A 1H43A 1WODA 3KBRA 3CG1A 2V84A 3MWBA 3PPRA 4OTEA 5CI5A 3V5AA 2Q2AA 2HAVA 4QF9A 3CFXA 4Q8RA 4LZ7A 3U1OA 4C0RA 3ZKLA 3S9MC 2XXVA 1M5FA 2ZYNA 3PGFA 4QFPA 1MXXA 1FQAA 1OIBA 1SW1A 5FTHA 2HAUA 4OESA 4E0WA 5I56A 1FTOA 2UYEA 1JEUA 1VFDA 4KCCA 3U72A 3KOSA 4KHZE 3MQ9A 1GV8A 5ITPA 3SDFA 2XXRA 4DXCA 1ZKBA 1T0KA 4ZEFA 3H6UA 1H45A 4RPNA 5K2YA 4THIA 2Q9TA 3A3CA 4YZZA 1ATGA 1S9TA 4GL0A 4ZEIA 5TU0A 2NVUB 1R9QA 1B7ZA 2HCAA 5DVIA 3FIRA 1ZTYA 4R9GA 1EZ9A 1FTLA 3O6GA 2O1MA 1MQIA 4M1VA 2Z8FA 4C1UA 1MDQA 1URSA 1MS7A 1MXYA 5BWJA 3SEWA 5KDTB 3PD9A 4C1TA 4YKPA 2RCAA 4UACA 1CE2A 3E9XA 2ZNSA 3QXMA 1MM6A 3MBPA 4R74A 3FJMA 4RK9A 4K3FA 3W15C 1XVXA 4FAJA 2XXHA 3W9WA 1J1NA 1N76A 1TWYA 4ZDMA 4NWCA 5CMKA 3PMXA 1Y20A 2P2AA 2XXXA 3MVXA 1JQFA 1LSTA 3RUMA 1MXWA 3KFMA 1SW2A 3ILUB 4OZ9A 4R6YA 4QHQA 1QW0A 5DTBA 3UK4A 3MJNA 1VFEA 4MLQA 1NH7A 1SQYA 1NNTA 2UVGA 4U23A 5FHMA 3VLUA 2FYIA 5HBCA 1NNKA 3B6WA 3K2DA 3C4MA 4G8HA 3MP6A 2Y7PA 2OCUA 4PETA 4JXIA 5JTYB 2DS9A 4GWOA 3FJGA 5FHOA 1B3HA 3K6WA 4AB6A 2UYFA 4F18A 4QFNA 1NL5A 3IOWA 1B1HA 1MY1A 3L6HA 3OO9A 4H0WA 3TODA 4MBPA 3I5OA 3N6TA 1IXCA 5DEXB 1LCFA 1FQEA 4GLIA 3HPIA 1OQGA 4Q0CA 5CBRA 4DE8A 5I84A 1MPBA 1A8FA 4M4GA 1LB8A 3K01A 3CRBA 2D5WA 4R2FA 1SVXB 4JSOA 4EUOA 2OWTA 4NE4A 4YB6A 3G3GA 1MY2A 1B7UA 2I0CA 3HN0A 1A8EA 3MPLA 3VLWA 2I3VA 1QKBA 2XXYA 3TQWA 5CC2A 3IJXB 5I2KB 5BUUA 4G2ZA 3Q27A 2RC9A 3FZVA 4IO2A 5I2NA 1B3EA 2ZYOA 1URGA 1USYH 3EN3A 3IR1A 1YCJA 1P1NA 3JV9A 3PV0E 1SI0A 3FV2A 1S7YA 2PYYA 4XKPA 4NEDA 1MY3A 1N7WA 4Z0IA 2QS1A 4PFUA 3CR9A 4NF4B 3N26A 3FUZA 4OERA 3IB2A 4N07A 4QRZA 1BTJA 5I57B 2F7BA 3CG3A 1D9YA 1WDNA 2O68A 4QSEA 4YKIA 3W9VA 3LR1A 4F2QA 3S9NC 1JVXA 5AA4A 4OETA 3PUWE 3M8UA 3OELA 4ZEBA 4KQPA 1HSEA 4LP2B 4IGRA 1B51A 5ELVA 5TP9B 4EQ7A 3OMBA 5CBSA 1P1QA 4R2BA 3HSTA 4PFTA 5H8HA 1MY0A 3RN8A 3RT8A 4H1XA 1OVTA 1EH3A 1URDA 5L8DA 3G3IA 3ZS6A 1H76A 3IO4A 3R7XA 3SEYA 4JDFA 3P7IA 3MUQA 3OEMA 2QPQA 2X7QA 2H4IA 3E13X 3HCQA 3O6IA 5EHMA 1FQBA 1N3WA 1PBQA 1QJMA 2XXTA 4BDQA 1DMBA 2XXWA 4ND9A 3PUVE 3SKPA 4LQ2A 3FXRA 3K02A 3MC2A 3S9LC 1JVYA 3K6XA 2XD3A 4AQ4A 3FV1A 4FEDA 2DVCA 3H7MA 2QMXA 2PX1A 4ESXA 1B9JA 4OFLA 1VR5A 4H67A 1IIWA 1MPCA 1XHYA 5AE4A 3K4UA 2FNCA 3RLFE 2HZKA 2GRVA 2I48A 2Y7RA 4IY6A 2DWHA 2DWJA 1B5IA 4OHNA 2YJPA 1B4ZA 3OENA 4TOZA 2VD2A 3GBBA 5I59A 5DEXA 4XKNA 1GVCA 4H5GA 5TPAA 4F2OA 4LVQA 3TUSA 3UGWA 2HEUA 4LUBA 1JETA 3KN7A 4X1BA 3MVYA 4DCYA 5B7DA 5L9OA 2OK2A 2W7YA 1M5CA 2I3WA 2PT2A 4F1YA 4LATA 4ZEKA 4QSDA 4ZE9A 2QJEA 4MFIA 2VOZA 4JWXA 4HCWA 2KLFA 3VDFA 5JEIA 2IEEA 5AA2D 4YB5A 3DP4A 2ZMBA 3KSXA 3MVZA 1GR2A 1UTHA 1II5A 2DSFA 2NOOA 3BBRA 2DQVA 3HHGA 4U4SA 3VV5A 2HFBA 2ZYKA 1D9VA 3HV1A 3BFTA 2V3UA 1B5JA 1PEBA 2B65A 3O9PA 3SESA 1FCKA 1SDXA 3A09A 5AA3A 4FEBA 5AA2B 2F78A 5ITOA 4BDRA 3IOTA 3FVKA 4QSCA 3MPKA 3EQ1A 5ICQA 1LBBA 3PUZE 3OD7A 4BDLA 1XVYA 1A40A 3FASA 1SW4A 1IXHA 1M5DA 2UVJA 5AA4B 1LBCA 1FTKA 1JEVA 2DE4A 5CMCA 3Q29A 4H6DA 3QUFA 1YTVA 4DCXA 5H8NB 2OLBA 1UTBA 1B0LA 2DVZA 4WKMA 4G77A 1IXIA 1B3FA 1I69A 2ANJA 2Y7KA 4DIGA 2F7CA 1H44A 1DTZA 2GH9A 1XC1A 2DYXA 2QS2A 4FECA 4QFOA 4NF8A 4YKJA 3IORA 3T9UA 3TTKA 4BDNA 4OVJA 3QYTA 2F35A 2O69A 4GL8A 5JK4A 4I1DA 1YAEA 4OFJA 3JZJA 4HCYA 3TKDA 1USYE 1BKAA 2NXOA 2DP8A 1FTJA 1OLAA 5H8FA 2VGQA 3Q25A 3QSLA 4XXUA 5DVJA 2DE3A 3PMVA 3WAFA 3CVGA 4IO6A 2XXIA 4RA1A 4OEUA 2H5YA 2I58A 3BFUA 3RT6B 4LA9A 1QUIA 4ZEDA 5ICTA 1ZLQA 1ZU0A 4PE5B 4U22A 4XIGQ 3VVEA 2IA4A 3FD3A 3H3GA 3KZGA 4FE8A 1AIVA 1QUJA 2X7PA 2XXPA 2ABHA 1MG1A 1LAXA 4X9TA 4TLMB 2CMOA 1UIVA 1OMPA 2AIXA 2R71A 1A55A 3K00A 4F3SA 1SYHA 1D3KA 5TP9A 4GVOA 2F8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIJ A;  3R26 A;  1P1O A;  3Q26 A;  4RK2 A;  3T9X B;  3KOT A;  1PC3 A;  3RQT A;  3LSW A;  5HM4 B;  4N13 A;  4MF3 A;  3I6V A;  4R6H A;  1A7L A;  2XX9 A;  1LFI A;  4E0X A;  2ZYM A;  4OEN A;  4F22 A;  5I58 A;  2DWI A;  3GZG A;  3IX1 A;  1IZ1 A;  2XHD A;  3MP8 A;  3C31 A;  4GXA A;  3D4C A;  3TPA A;  4RPO A;  1LLS A;  4EXL A;  4NMY A;  3K1P A;  5EHS A;  2YPN A;  3KGC A;  4JBZ A;  3C9H A;  3H6W A;  3DP6 A;  2OZZ A;  5I2K A;  2Q88 A;  1Y1Z A;  3T93 B;  1B58 A;  1ZBM A;  2F6G A;  2HZL A;  1Y4C A;  2Q89 A;  4U2R A;  3TMG A;  4X48 A;  1FW0 A;  1B1X A;  2X26 A;  4U4X A;  3TEL A;  1KWH A;  5HPQ A;  1B7H A;  2DWA A;  3N5L A;  5AA2 A;  3R6U A;  3F11 A;  1Y4T A;  1H3D A;  1I6A A;  4NF6 A;  1EZO A;  4NWD A;  2RC8 A;  3LSL A;  4YKK A;  4I62 A;  3VVF A;  1AH5 A;  4IO3 A;  5FHN A;  3B6T A;  4IO4 A;  5ISU A;  2M8C A;  5H8Q B;  1AL3 A;  3IK6 B;  1PB9 A;  2XX8 A;  3OXN A;  3VE1 B;  3WAE A;  1Z7M E;  5KCJ B;  1SI1 A;  3TEP A;  1B3L A;  4F3B A;  5F7V A;  3C32 A;  1DTG A;  5KCJ A;  2Z8E A;  1MPD A;  2XX7 A;  3OO8 A;  4OXV A;  3UA8 A;  1NKX A;  4ESW A;  1GGG A;  1MXZ A;  2QMW A;  4H65 A;  3IO6 A;  3QK6 A;  4G68 A;  5EYF A;  3IB1 A;  4YIC A;  3C33 A;  3TCG A;  4KPT A;  3MAM A;  4N6P A;  4OMB A;  3LSX A;  4RXL A;  1NFT A;  1ANF A;  2XD2 A;  5H8H B;  2O7U A;  5DT6 A;  3SET A;  5H8F B;  2P1S A;  4DLD A;  1D4N A;  1Y3N A;  1Y3Q A;  2D3I A;  3G3J A;  3MP1 A;  1JW4 A;  3G3K A;  3PD8 A;  4U21 A;  1FQD A;  2A5T A;  3HO7 A;  3IAZ A;  3PUY E;  4EQ9 A;  1B40 A;  1EU8 A;  1PB7 A;  2Y84 A;  4JB7 A;  2ZXT A;  4NF5 B;  2F34 A;  4QFL A;  5K2X A;  2F97 A;  3KN3 A;  4DXB A;  1JW5 A;  1BIY A;  1ZIU A;  2HQ0 A;  3OOA A;  4H8I A;  3TZA A;  4F1U A;  1IIT A;  2DXY A;  3G3H A;  4YAH X;  3TTL A;  4LZ8 A;  1LCT A;  4IGT A;  4R6K A;  3EF7 A;  3K6V A;  4G8N A;  3V89 B;  2WKY A;  1IUD A;  1UIU A;  5CM6 A;  5I2N B;  5I58 B;  3CSG A;  4NF5 A;  1AMF A;  4LQ5 A;  4GRK A;  2XXQ A;  3H6T A;  2I4C A;  3EHS A;  2AL5 A;  4ISU A;  4DZ1 A;  1B3G A;  3UIF A;  1N04 A;  3FAT A;  1HSL A;  2V3T A;  1B4H A;  3EHU A;  4F1V A;  2GHB A;  4MH5 A;  4ZZE A;  1MH4 A;  1Y3P A;  1DPP A;  1US5 A;  1R9L A;  4GXS B;  4H5F A;  1DSN A;  3BKI B;  1MRP A;  4WED A;  4L17 A;  1DOT A;  1N84 A;  1PB8 A;  4G68 B;  4PQJ A;  1POY 1;  3C34 A;  4RJZ A;  2RF1 A;  4RY1 A;  3E3K A;  2I49 A;  2VD3 A;  3FVN A;  3O66 A;  3ECR A;  2DE2 A;  4IO5 A;  4IY5 A;  4XKQ A;  2UVH A;  3TDJ A;  1QUL A;  1BP5 A;  1M5E A;  1R1N A;  4GFR A;  4O3C A;  4U1Z A;  3USD A;  4NF4 A;  2Z22 A;  1RYO A;  4JWY A;  1BLF A;  4G4P A;  4ONY A;  2A5S A;  1VE4 A;  1MY4 A;  1SYI A;  1MM7 A;  3TYH A;  1NNF A;  3K0V A;  2O84 X;  2Y7I A;  3OSR A;  4EXK A;  5L9S A;  1I6B A;  3OSQ A;  3TFL A;  1FQC A;  1POT A;  2H25 A;  3IJO B;  4XKR A;  4TQU Q;  3OO7 A;  1MQG A;  3O6H A;  4U1O A;  4MLV A;  3TAJ A;  3MZ9 A;  3PPP A;  1DPE A;  3UP9 A;  4EDP A;  1O7T A;  2RCB A;  3L6G A;  3G3F A;  1O64 A;  3PPN A;  3SEU A;  4YMA A;  3DLN A;  1O63 A;  1UTB B;  2CZL A;  2YLN A;  1US4 A;  4LON B;  5L9M A;  4F3P A;  4RNS A;  1P99 A;  4FAT A;  3EHT A;  1MXU A;  2H9B A;  1SBP A;  3LUY A;  3S2V A;  2PMS A;  3FJ7 A;  4GF8 A;  4RYA A;  3SEX A;  4BDO A;  5KZT A;  1PBP A;  4Q5T A;  3TCH A;  5J1D A;  3DEL B;  2V93 A;  4I9D A;  4R75 A;  1B2H A;  4G68 C;  4R72 A;  3RTW B;  4PFY A;  1OVB A;  1A99 A;  1N3X A;  1RKM A;  3PUX E;  3S9E A;  1F9B A;  2PVU A;  3QIM A;  2NWJ A;  3JYR A;  3S4U A;  4GOT A;  1I6Q A;  4FJP A;  2G93 A;  2PT1 A;  3CFZ A;  3GXA A;  4ZZA A;  5LOM A;  4OFO A;  2A5T B;  3PMW A;  1LFH A;  2F7A A;  4JSD A;  3LSF B;  1N0T A;  3N6U A;  4ELR A;  3CI8 A;  1NMU A;  2VHA A;  1N7X A;  4BLA A;  1SW5 A;  3QUJ A;  3O29 A;  3H4Z A;  3PPQ A;  4ELO A;  1P1U A;  4Z7E A;  1LAF E;  2OWS A;  3K1M A;  3RPW A;  3E4R A;  1P1W A;  1TXF A;  3M3K A;  4YB7 A;  3KG2 A;  1MXV A;  2QSX A;  1NH8 A;  4OQO A;  4R73 A;  3KJT A;  2GFE A;  3N94 A;  1QUK A;  3B6Q A;  3O97 A;  2AL4 A;  4GQO A;  3A3U A;  4OWD A;  3ZKK A;  1ELJ A;  1TFA A;  2RC7 A;  4F19 A;  4TLL B;  1IEJ A;  4ELQ A;  2Y7W A;  1FTM A;  5I57 A;  2XXU A;  5F1Q A;  3U94 A;  3O28 A;  5B70 A;  2THI A;  2ZNT A;  4QFK A;  4F3G A;  2Q8J A;  2RKM A;  1PDA A;  1MQD A;  4P11 A;  4ZE8 A;  3IOU A;  1XOC A;  3TCF A;  1Y9U A;  2B3B A;  4IB2 A;  4P0I A;  5H8S A;  3T96 B;  1LAG E;  4BDM A;  1MH3 A;  4NF6 B;  4OEV A;  4POW A;  5KDT A;  3B7D A;  3HHF A;  3ONM A;  3M3F A;  5IKB A;  2UVI A;  4NTL A;  2O6A A;  2QRY A;  4YMB A;  3FVG A;  4I8C A;  2I0B A;  2O1L A;  2UXA A;  4JWO A;  5H8N A;  2QL3 A;  3FVO A;  3OEK A;  4HS7 A;  1QKA A;  3IL1 B;  2QS3 A;  3I3V A;  4ECF A;  4KYS A;  1EZP A;  1B5H A;  3Q28 A;  4KCD A;  3SEV A;  1LGB C;  3PPO A;  2REG A;  3GLB A;  4P0G A;  4HTG A;  1UQW A;  3MZB A;  3T22 A;  3THI A;  4ELP A;  5H8Q A;  2Z8D A;  4EF2 A;  1ZJL A;  5JTY A;  4FOR A;  4KYD A;  5CMM A;  3UOR A;  1NNP A;  4F31 B;  2O7I A;  4OYV A;  1Z7N E;  3V8X B;  2ZNU A;  3VXC A;  2B3F A;  3K6U A;  3GBA A;  3KN8 A;  5M2V A;  1B0H A;  1OLC A;  4G8M A;  4PFW A;  5DVF A;  1YPN A;  2H99 A;  5A5X A;  2ESN A;  1OQH A;  3C36 A;  5CMB A;  1B6H A;  3IB0 A;  3KEI A;  2V25 A;  2E0S A;  2GHA A;  5CRY A;  1MDP 1;  1ZMG A;  2VP1 A;  2E1S A;  1GTK A;  1VSO A;  1JNF A;  2Z23 A;  3CFL A;  1UTH B;  1TT1 A;  2ONS A;  1B05 A;  3MVW A;  2V3Q A;  3H03 A;  1LB9 A;  3K1N A;  3O2A A;  1FQF A;  4H8J A;  3ODB A;  2ONK E;  4GD5 A;  3KSJ A;  1RYX A;  4WEP A;  4EQB A;  3QAX A;  3RTF B;  3VVD A;  2G29 A;  3M3L A;  4AB5 A;  5I59 B;  3D4G A;  2R9J A;  2F6P A;  4DXU A;  4FIM A;  1JW1 A;  4KI0 E;  4Q30 B;  4YU0 A;  1IXG A;  3ZSF A;  1A54 A;  1WVJ A;  2RIN A;  3FXQ A;  4GIZ A;  2H98 A;  3UN6 A;  4WXJ A;  4ZEC A;  3LBS A;  4LZ5 A;  3AXF A;  1AOV A;  4IO7 A;  4O3A A;  3EPE A;  1B52 A;  3DM0 A;  2I4B A;  1LAH E;  1L5T A;  3KJ7 A;  4KYE A;  2F5X A;  2P0S A;  3CSB A;  3MZ1 A;  3DP8 A;  3TTN A;  3FGS A;  3TTR A;  3V83 A;  3TQL A;  4EF1 A;  2Q2C A;  3T9H B;  1Y1M A;  1IQ7 A;  3C35 A;  5DYH A;  1LFG A;  4KR5 A;  5AA1 A;  3U92 A;  2D21 A;  2OBG A;  4HW8 A;  4O3B A;  3OO6 A;  4UA8 A;  4F29 A;  3VLV A;  5A5X B;  5IAI A;  3IOV A;  2O51 A;  3RGY A;  2NUV A;  3RY3 A;  5I56 B;  1M5B A;  1QVS A;  2OJT A;  2QS4 A;  3TTM A;  3H6V A;  3U93 A;  2R6G E;  1XS5 A;  3VFJ A;  3VXB A;  2DXR A;  2HXW A;  3ILT B;  3SER A;  1B46 A;  2PBW A;  3T66 A;  3G7W A;  2ONR A;  4POX A;  4XTC Q;  4NF8 B;  3U8Q A;  4PP0 A;  1MQJ A;  3MW0 A;  5FTI A;  4F39 A;  2BJJ X;  1HSJ A;  2ALU A;  2I6E A;  1B32 A;  2AYS A;  1R6Z A;  2LAO A;  2F36 A;  3H06 B;  2REJ A;  4ZS9 A;  4KD5 A;  4KFQ A;  1CB6 A;  2DOJ A;  3FXU A;  4DDD A;  1TFD A;  1Q35 A;  2FA7 A;  4X1D A;  3T9V A;  3LC8 A;  3RNN A;  1SD3 A;  1S50 A;  4R9F A;  1Q1K A;  5TPA B;  1MQH A;  1XT8 A;  3PU5 A;  1H43 A;  1WOD A;  3KBR A;  3CG1 A;  2V84 A;  3MWB A;  3PPR A;  4OTE A;  5CI5 A;  3V5A A;  2Q2A A;  2HAV A;  4QF9 A;  3CFX A;  4Q8R A;  4LZ7 A;  3U1O A;  4C0R A;  3ZKL A;  3S9M C;  2XXV A;  1M5F A;  2ZYN A;  3PGF A;  4QFP A;  1MXX A;  1FQA A;  1OIB A;  1SW1 A;  5FTH A;  2HAU A;  4OES A;  4E0W A;  5I56 A;  1FTO A;  2UYE A;  1JEU A;  1VFD A;  4KCC A;  3U72 A;  3KOS A;  4KHZ E;  3MQ9 A;  1GV8 A;  5ITP A;  3SDF A;  2XXR A;  4DXC A;  1ZKB A;  1T0K A;  4ZEF A;  3H6U A;  1H45 A;  4RPN A;  5K2Y A;  4THI A;  2Q9T A;  3A3C A;  4YZZ A;  1ATG A;  1S9T A;  4GL0 A;  4ZEI A;  5TU0 A;  2NVU B;  1R9Q A;  1B7Z A;  2HCA A;  5DVI A;  3FIR A;  1ZTY A;  4R9G A;  1EZ9 A;  1FTL A;  3O6G A;  2O1M A;  1MQI A;  4M1V A;  2Z8F A;  4C1U A;  1MDQ A;  1URS A;  1MS7 A;  1MXY A;  5BWJ A;  3SEW A;  5KDT B;  3PD9 A;  4C1T A;  4YKP A;  2RCA A;  4UAC A;  1CE2 A;  3E9X A;  2ZNS A;  3QXM A;  1MM6 A;  3MBP A;  4R74 A;  3FJM A;  4RK9 A;  4K3F A;  3W15 C;  1XVX A;  4FAJ A;  2XXH A;  3W9W A;  1J1N A;  1N76 A;  1TWY A;  4ZDM A;  4NWC A;  5CMK A;  3PMX A;  1Y20 A;  2P2A A;  2XXX A;  3MVX A;  1JQF A;  1LST A;  3RUM A;  1MXW A;  3KFM A;  1SW2 A;  3ILU B;  4OZ9 A;  4R6Y A;  4QHQ A;  1QW0 A;  5DTB A;  3UK4 A;  3MJN A;  1VFE A;  4MLQ A;  1NH7 A;  1SQY A;  1NNT A;  2UVG A;  4U23 A;  5FHM A;  3VLU A;  2FYI A;  5HBC A;  1NNK A;  3B6W A;  3K2D A;  3C4M A;  4G8H A;  3MP6 A;  2Y7P A;  2OCU A;  4PET A;  4JXI A;  5JTY B;  2DS9 A;  4GWO A;  3FJG A;  5FHO A;  1B3H A;  3K6W A;  4AB6 A;  2UYF A;  4F18 A;  4QFN A;  1NL5 A;  3IOW A;  1B1H A;  1MY1 A;  3L6H A;  3OO9 A;  4H0W A;  3TOD A;  4MBP A;  3I5O A;  3N6T A;  1IXC A;  5DEX B;  1LCF A;  1FQE A;  4GLI A;  3HPI A;  1OQG A;  4Q0C A;  5CBR A;  4DE8 A;  5I84 A;  1MPB A;  1A8F A;  4M4G A;  1LB8 A;  3K01 A;  3CRB A;  2D5W A;  4R2F A;  1SVX B;  4JSO A;  4EUO A;  2OWT A;  4NE4 A;  4YB6 A;  3G3G A;  1MY2 A;  1B7U A;  2I0C A;  3HN0 A;  1A8E A;  3MPL A;  3VLW A;  2I3V A;  1QKB A;  2XXY A;  3TQW A;  5CC2 A;  3IJX B;  5I2K B;  5BUU A;  4G2Z A;  3Q27 A;  2RC9 A;  3FZV A;  4IO2 A;  5I2N A;  1B3E A;  2ZYO A;  1URG A;  1USY H;  3EN3 A;  3IR1 A;  1YCJ A;  1P1N A;  3JV9 A;  3PV0 E;  1SI0 A;  3FV2 A;  1S7Y A;  2PYY A;  4XKP A;  4NED A;  1MY3 A;  1N7W A;  4Z0I A;  2QS1 A;  4PFU A;  3CR9 A;  4NF4 B;  3N26 A;  3FUZ A;  4OER A;  3IB2 A;  4N07 A;  4QRZ A;  1BTJ A;  5I57 B;  2F7B A;  3CG3 A;  1D9Y A;  1WDN A;  2O68 A;  4QSE A;  4YKI A;  3W9V A;  3LR1 A;  4F2Q A;  3S9N C;  1JVX A;  5AA4 A;  4OET A;  3PUW E;  3M8U A;  3OEL A;  4ZEB A;  4KQP A;  1HSE A;  4LP2 B;  4IGR A;  1B51 A;  5ELV A;  5TP9 B;  4EQ7 A;  3OMB A;  5CBS A;  1P1Q A;  4R2B A;  3HST A;  4PFT A;  5H8H A;  1MY0 A;  3RN8 A;  3RT8 A;  4H1X A;  1OVT A;  1EH3 A;  1URD A;  5L8D A;  3G3I A;  3ZS6 A;  1H76 A;  3IO4 A;  3R7X A;  3SEY A;  4JDF A;  3P7I A;  3MUQ A;  3OEM A;  2QPQ A;  2X7Q A;  2H4I A;  3E13 X;  3HCQ A;  3O6I A;  5EHM A;  1FQB A;  1N3W A;  1PBQ A;  1QJM A;  2XXT A;  4BDQ A;  1DMB A;  2XXW A;  4ND9 A;  3PUV E;  3SKP A;  4LQ2 A;  3FXR A;  3K02 A;  3MC2 A;  3S9L C;  1JVY A;  3K6X A;  2XD3 A;  4AQ4 A;  3FV1 A;  4FED A;  2DVC A;  3H7M A;  2QMX A;  2PX1 A;  4ESX A;  1B9J A;  4OFL A;  1VR5 A;  4H67 A;  1IIW A;  1MPC A;  1XHY A;  5AE4 A;  3K4U A;  2FNC A;  3RLF E;  2HZK A;  2GRV A;  2I48 A;  2Y7R A;  4IY6 A;  2DWH A;  2DWJ A;  1B5I A;  4OHN A;  2YJP A;  1B4Z A;  3OEN A;  4TOZ A;  2VD2 A;  3GBB A;  5I59 A;  5DEX A;  4XKN A;  1GVC A;  4H5G A;  5TPA A;  4F2O A;  4LVQ A;  3TUS A;  3UGW A;  2HEU A;  4LUB A;  1JET A;  3KN7 A;  4X1B A;  3MVY A;  4DCY A;  5B7D A;  5L9O A;  2OK2 A;  2W7Y A;  1M5C A;  2I3W A;  2PT2 A;  4F1Y A;  4LAT A;  4ZEK A;  4QSD A;  4ZE9 A;  2QJE A;  4MFI A;  2VOZ A;  4JWX A;  4HCW A;  2KLF A;  3VDF A;  5JEI A;  2IEE A;  5AA2 D;  4YB5 A;  3DP4 A;  2ZMB A;  3KSX A;  3MVZ A;  1GR2 A;  1UTH A;  1II5 A;  2DSF A;  2NOO A;  3BBR A;  2DQV A;  3HHG A;  4U4S A;  3VV5 A;  2HFB A;  2ZYK A;  1D9V A;  3HV1 A;  3BFT A;  2V3U A;  1B5J A;  1PEB A;  2B65 A;  3O9P A;  3SES A;  1FCK A;  1SDX A;  3A09 A;  5AA3 A;  4FEB A;  5AA2 B;  2F78 A;  5ITO A;  4BDR A;  3IOT A;  3FVK A;  4QSC A;  3MPK A;  3EQ1 A;  5ICQ A;  1LBB A;  3PUZ E;  3OD7 A;  4BDL A;  1XVY A;  1A40 A;  3FAS A;  1SW4 A;  1IXH A;  1M5D A;  2UVJ A;  5AA4 B;  1LBC A;  1FTK A;  1JEV A;  2DE4 A;  5CMC A;  3Q29 A;  4H6D A;  3QUF A;  1YTV A;  4DCX A;  5H8N B;  2OLB A;  1UTB A;  1B0L A;  2DVZ A;  4WKM A;  4G77 A;  1IXI A;  1B3F A;  1I69 A;  2ANJ A;  2Y7K A;  4DIG A;  2F7C A;  1H44 A;  1DTZ A;  2GH9 A;  1XC1 A;  2DYX A;  2QS2 A;  4FEC A;  4QFO A;  4NF8 A;  4YKJ A;  3IOR A;  3T9U A;  3TTK A;  4BDN A;  4OVJ A;  3QYT A;  2F35 A;  2O69 A;  4GL8 A;  5JK4 A;  4I1D A;  1YAE A;  4OFJ A;  3JZJ A;  4HCY A;  3TKD A;  1USY E;  1BKA A;  2NXO A;  2DP8 A;  1FTJ A;  1OLA A;  5H8F A;  2VGQ A;  3Q25 A;  3QSL A;  4XXU A;  5DVJ A;  2DE3 A;  3PMV A;  3WAF A;  3CVG A;  4IO6 A;  2XXI A;  4RA1 A;  4OEU A;  2H5Y A;  2I58 A;  3BFU A;  3RT6 B;  4LA9 A;  1QUI A;  4ZED A;  5ICT A;  1ZLQ A;  1ZU0 A;  4PE5 B;  4U22 A;  4XIG Q;  3VVE A;  2IA4 A;  3FD3 A;  3H3G A;  3KZG A;  4FE8 A;  1AIV A;  1QUJ A;  2X7P A;  2XXP A;  2ABH A;  1MG1 A;  1LAX A;  4X9T A;  4TLM B;  2CMO A;  1UIV A;  1OMP A;  2AIX A;  2R71 A;  1A55 A;  3K00 A;  4F3S A;  1SYH A;  1D3K A;  5TP9 A;  4GVO A;  2F8D A; 
#chains in the Genus database with same CATH topology
 1P1O A;  3KOT A;  3RQT A;  4F22 A;  4MMP A;  2ZYM A;  2EMH A;  1YFH A;  1A1I A;  1IZ1 A;  3IFC A;  4WX9 A;  1XNR E;  4RPO A;  2EOX A;  3HXL A;  4DV4 E;  4B3S E;  4JBZ A;  3C9H A;  3H6W A;  2EE8 A;  4PBH A;  5I2K A;  1Y1Z A;  4U2R A;  2F6G A;  4R2Q A;  1PKP A;  2LCE A;  1FBH A;  2EPR A;  4NF6 A;  1Y4T A;  3LSL A;  2DMI A;  5ISU A;  2M8C A;  1HR0 E;  5H8Q B;  3IK6 B;  4MNP A;  1SI1 A;  2EL6 A;  4O94 A;  3TEP A;  2V85 A;  1IME A;  1B3L A;  1EH7 A;  2XX7 A;  4GWX A;  3OO8 A;  2N8X A;  1NKX A;  1GGG A;  2LMZ A;  4JI3 E;  4KPT A;  2JXP A;  4N6P A;  4RXL A;  3C4B A;  5H8H B;  3SET A;  2FBP A;  2D3I A;  1Y3N A;  3MP1 A;  3G3K A;  1FQD A;  3HO7 A;  3IAZ A;  4EQ9 A;  4JB7 A;  2EMC A;  5K2X A;  4N15 A;  2HQ0 A;  4F1U A;  2YRK A;  3H09 A;  1FPL A;  2EOH A;  4R2C A;  1IUD A;  1FPK A;  1UIU A;  1EYJ A;  1AMF A;  2ENH A;  4GRK A;  3MHH C;  2LTS A;  2I4C A;  4ISU A;  2AL5 A;  4DZ1 A;  1B3G A;  3FAT A;  3EHU A;  4ZZE A;  3IWD A;  1MH4 A;  1DPP A;  3BKI B;  4LF8 E;  4FBP A;  1DOT A;  1PB8 A;  3C34 A;  1NV5 A;  1ZR9 A;  3C6K A;  2YU5 A;  2I49 A;  2VD3 A;  3FVN A;  2LUP B;  3ECR A;  1P47 A;  3O66 A;  3VHT B;  2CSH A;  4IJD A;  4GFR A;  4LU9 A;  3USD A;  2YTN A;  2Z22 A;  2YTG A;  3LML A;  1SYI A;  2NUE A;  2Y7I A;  5L9S A;  2Q8M A;  2EMG A;  1POT A;  3THN A;  4BC7 A;  3TAJ A;  1SR9 A;  1O7T A;  2RCB A;  4IS1 C;  3G3F A;  4YMA A;  2EOE A;  1O63 A;  5L9M A;  1US4 A;  1YZ9 A;  1P99 A;  3MHS C;  3EHT A;  4FK5 C;  2PMS A;  4RYA A;  2EM3 A;  4GKJ E;  1B69 A;  1PBP A;  3TCH A;  4DMI A;  2EMF A;  1B2H A;  4R72 A;  4PFY A;  1OVB A;  2G93 A;  3GXA A;  2A5T B;  1LFH A;  2F8B A;  4X65 E;  2EPU A;  1N0T A;  5ET7 A;  1SW5 A;  3QUJ A;  3O29 A;  3E4R A;  4YB7 A;  4PTK A;  3J81 C;  4AQY E;  3O97 A;  1QUK A;  3ZKK A;  1NV1 A;  1AAY A;  2AL4 A;  3A3U A;  4OWD A;  4DUZ E;  2Y7W A;  5F1Q A;  5B70 A;  2RKM A;  1HNX E;  4P11 A;  1PJS A;  2CEY A;  1LAG E;  4POW A;  2EZ6 A;  3HHF A;  4F9A B;  4YMB A;  2CZK A;  2I0B A;  2O1L A;  3I3V A;  1IBK E;  1EZP A;  1B5H A;  4KHP E;  3T22 A;  4ELP A;  5H8Q A;  5JTY A;  2R1F A;  4FOR A;  4NXN E;  4F31 B;  2LTR A;  4PDD A;  3V8X B;  3VXC A;  3K6U A;  4PFW A;  1CNQ A;  2H99 A;  5DVF A;  5A5X A;  2EPL X;  2RPC A;  4R2E A;  4LF9 E;  3IB0 A;  2GHA A;  1MDP 1;  2VP1 A;  4G61 A;  1GTK A;  1JNF A;  2Z23 A;  3CFL A;  4R2F A;  3MVW A;  1B05 A;  2V3Q A;  1LB9 A;  4Q35 B;  2L2N A;  4H8J A;  3ODB A;  2ONK E;  4GD5 A;  2GLI A;  3D4G A;  4FIM A;  1JW1 A;  3UN6 A;  3FXQ A;  4JVC A;  2H98 A;  1NV7 A;  3IWB A;  2HHH E;  3MST A;  2EPX A;  2EM8 A;  4DR5 E;  4BMJ A;  4KYE A;  3CSB A;  1WHN A;  3TTN A;  3OML A;  3FGS A;  4EF1 A;  2L3J A;  4K0K E;  3C35 A;  1IQ7 A;  4H46 A;  4F6N A;  2DLQ A;  2QVV A;  4HW8 A;  4P8B A;  2ADR A;  5IAI A;  3LV0 A;  2VQE E;  4DV3 E;  5I56 B;  2XWI A;  1QVS A;  3H6V A;  2R6G E;  3VXB A;  4DUY E;  2HXW A;  2RSI A;  1X48 A;  2ONR A;  1JP4 A;  4POX A;  4H45 A;  4NF8 B;  4XTC Q;  3U8Q A;  5FTI A;  3H06 B;  2ALU A;  1IMB A;  4KFQ A;  2DOJ A;  3FXU A;  4X1D A;  3AV0 A;  3RNN A;  1SD3 A;  5TPA B;  1MQH A;  3KBR A;  2M7Q A;  4QF9 A;  4C0R A;  2HAU A;  4OES A;  4BHC A;  3KOS A;  1GV8 A;  5ITP A;  1PJT A;  4ZEF A;  1JK2 A;  2Q9T A;  3A3C A;  4YZZ A;  4R03 A;  1G0H A;  1B7Z A;  2HCA A;  5DVI A;  4R9G A;  2EPK X;  2YTP A;  1BB8 A;  1URS A;  1MXY A;  5KDT B;  3SEW A;  4C1T A;  4YKP A;  2RCA A;  4UAC A;  3ISP A;  1I94 E;  4NF0 A;  3BIH A;  3FJM A;  4RK9 A;  1XVX A;  1EYK A;  1N76 A;  1LBV A;  2XXX A;  2ODR C;  2RS7 A;  1SW2 A;  2KQZ A;  1QW0 A;  5DTB A;  1X49 A;  1VFE A;  4BCA A;  3B6W A;  3K2D A;  1BK4 A;  3C4M A;  2DS9 A;  2EMB A;  3K6W A;  2LV2 A;  2PRT A;  5KL2 A;  1NL5 A;  4OAN A;  1FPI A;  5IZ1 A;  3I5O A;  3N6T A;  2EMI A;  1LCF A;  4F6M A;  4GLI A;  4O24 A;  2EMW A;  4AS4 A;  1A1K A;  3K01 A;  3CRB A;  2D5W A;  4YB6 A;  2MC5 A;  3G3G A;  1MY2 A;  3MPL A;  4N91 A;  4O43 A;  3SZP A;  3IJX B;  5I2K B;  1B3E A;  1USY H;  3IR1 A;  4PAF A;  3OTO E;  1SI0 A;  4MNC A;  3K6Q A;  4QRZ A;  4NF4 B;  3FUZ A;  3IB2 A;  3CG3 A;  3VK6 A;  4QSE A;  1RDX A;  4GWY A;  2K4V A;  1X3C A;  4EQ7 A;  1EH3 A;  3ZS6 A;  3G3I A;  3SEY A;  4JDF A;  4PFR A;  2OWZ A;  4BDQ A;  1PBQ A;  3C4T A;  2XXT A;  3PUV E;  4JI4 E;  3FXR A;  5A5L A;  2HGH A;  1G0I A;  1B9J A;  1VR5 A;  1IIW A;  4KZS A;  1MPC A;  4WYQ B;  5AE4 A;  2H36 X;  4YY3 E;  5A6B A;  2DWH A;  4JVD A;  1B5I A;  2PCR A;  1B4Z A;  1FPE A;  1QNT A;  4O7I A;  5B7D A;  1JET A;  5L9O A;  4ZYD A;  4R2S A;  2YTJ A;  1YYO A;  4HCW A;  4YB5 A;  2ZMB A;  3KSX A;  3VV5 A;  2CZI A;  2DQV A;  2EOM A;  2HFB A;  2ZYK A;  2EPZ A;  3HV1 A;  4DR2 E;  3BFT A;  1B5J A;  2B65 A;  1SDX A;  5AA2 B;  2F3B A;  5ITO A;  4IR8 A;  2EPN A;  2EOS A;  4OA4 A;  4QSC A;  3OD7 A;  4BDL A;  2JR1 A;  3HQ1 A;  5AA4 B;  1LBC A;  1JEV A;  2XXK A;  3QUF A;  2DVZ A;  5LL6 R;  1B3F A;  2Y7K A;  1YUJ A;  4DIG A;  2NAB A;  2DYX A;  1FKA E;  1KJK A;  4FEC A;  4PAK A;  4NF8 A;  3TTK A;  4BDN A;  4OVJ A;  4L8N A;  4GL8 A;  2GHF A;  1DBZ A;  4I1D A;  1YAE A;  5JK4 A;  4HCY A;  1USY E;  2EPA A;  3WAF A;  5FLX C;  3BFU A;  1DI2 A;  4LA9 A;  4ZED A;  1FBF A;  3VVE A;  2VQF E;  2G7H A;  2X7P A;  2ABH A;  1MG1 A;  4GWU A;  1A55 A;  1SYH A;  4JI2 E;  4LFC E;  1ZBT A;  3CIJ A;  3Q26 A;  3T9X B;  3LSW A;  5I58 A;  1A7L A;  4OEN A;  3GZG A;  2GPI A;  2XHD A;  3MP8 A;  3C31 A;  3D4C A;  2EOZ A;  3KGC A;  2UXD E;  5A6B D;  1F2I G;  1FBE A;  1B58 A;  2HZL A;  2LVH A;  1XMQ E;  4X62 E;  5EQ9 A;  4U4X A;  5AA2 A;  4GWZ A;  3F11 A;  1STU A;  4NWD A;  2RC8 A;  4I62 A;  2EM7 A;  3B6T A;  4IO4 A;  4PFI A;  4PGP A;  1AL3 A;  1ZAA C;  3TQM A;  4ESW A;  1IQS A;  1MXZ A;  2QMW A;  3QK6 A;  4G68 A;  4LF4 E;  4YIC A;  4DV2 E;  1ANF A;  2XD2 A;  4LFB E;  5H8F B;  4DLD A;  2N3H A;  3G3J A;  4U21 A;  4F3P A;  4DR4 E;  2A5T A;  3PUY E;  1EU8 A;  2Y84 A;  4GZN C;  2F34 A;  2F97 A;  2B4L A;  4P7D A;  1ZIU A;  2EMZ A;  3U65 A;  1IIT A;  4NAP A;  4IGT A;  4WSP A;  2WKY A;  3T1H E;  5CM6 A;  4NF5 A;  1RMD A;  5AE1 A;  1HSL A;  5IXM B;  2GHB A;  3ROJ A;  2EN4 A;  1US5 A;  4GXS B;  4H5F A;  4WED A;  4L17 A;  5LMU E;  2JOB A;  5A6J A;  4RJZ A;  3E3K A;  4HXV A;  4OOG C;  1BP5 A;  1MGT A;  1R1N A;  4NF4 A;  1RYO A;  4JWY A;  4G4P A;  1MY4 A;  3TYH A;  2O84 X;  1I6B A;  3OSQ A;  3TFL A;  2H25 A;  3IJO B;  4XKR A;  3O6H A;  4MLV A;  3PPP A;  1X6H A;  3L6G A;  1K9Y A;  5J16 A;  4OVS A;  2B7V A;  2CZL A;  2B7T A;  4LON B;  5KL6 A;  4BDO A;  2L2K B;  3FJ7 A;  4GF8 A;  5KZT A;  5J1D A;  3DEL B;  4R75 A;  4M9V C;  3S9E A;  1RKM A;  3PUX E;  4DR7 E;  1F9B A;  2BBG A;  3QIM A;  3J80 C;  3JYR A;  2NWJ A;  4DV5 E;  4ZZA A;  5IZ3 B;  5IT9 C;  5F24 A;  1TF3 A;  3PMW A;  1XNQ E;  3LSF B;  1NMU A;  2VHA A;  4BLA A;  4ELO A;  3H4Z A;  1P1U A;  3RPW A;  3M3K A;  3KG2 A;  1MXV A;  1NV4 A;  4OQO A;  4R73 A;  2Y5K A;  2EMY A;  4TLL B;  1FTM A;  5I57 A;  2XXU A;  3L00 A;  4LN5 A;  3O28 A;  2JWO A;  4NHR A;  2THI A;  2Q8J A;  1PDA A;  1J26 A;  3W9W A;  1XOC A;  1Y9U A;  4P0I A;  2LE2 A;  3T96 B;  1FPF A;  5KDT A;  5IKB A;  4R2R A;  4NTL A;  2UXA A;  3T0J A;  2QL3 A;  1UBD C;  3FVO A;  3OEK A;  2HJJ A;  4N6D A;  5AC4 A;  3SEV A;  1LGB C;  3PPO A;  2RQL A;  2WBB A;  2REG A;  4LF5 E;  4HTG A;  1UQW A;  2D9H A;  2MKN A;  2Z8D A;  2VF1 A;  1ZJL A;  2EML A;  4OYV A;  1Z7N E;  2ZNU A;  4XF5 A;  1DCU A;  1KA0 A;  4G8M A;  2ESN A;  1OQH A;  4O5G A;  4F9C B;  2R76 A;  1B6H A;  3KEI A;  3IWC A;  4I40 A;  1TT1 A;  3H03 A;  3K1N A;  1JK1 A;  4WEP A;  2XWO A;  2EQ1 A;  2R9J A;  5EYG A;  4KI0 E;  4NQ8 A;  1IXG A;  1A54 A;  1WVJ A;  4GIZ A;  4WXJ A;  1INP A;  3AXF A;  4O3A A;  1BBG A;  3DM0 A;  2I4B A;  1L5T A;  1FTA A;  4KXP A;  2UU9 E;  3RMP A;  2F5X A;  2F3D A;  2P0S A;  2IHR 1;  3MZ1 A;  4GWW A;  3TQL A;  3DJW A;  1MEY C;  2Q2C A;  3NOH A;  1Y1M A;  5AA1 A;  2D21 A;  2OBG A;  5LMN E;  2V88 A;  3OO6 A;  3VLV A;  5A5X B;  1UHZ A;  3IOV A;  2O51 A;  2OX3 A;  3RY3 A;  1M5B A;  3TTM A;  3VFJ A;  2WX9 A;  1XS5 A;  2DXR A;  3ILT B;  3EKI A;  3T66 A;  3G7W A;  2XA5 A;  2QVR A;  2ELY A;  3P1X A;  4PP0 A;  1MQJ A;  3MW0 A;  2BJJ X;  2I6E A;  2AYS A;  1NI9 A;  4B3T E;  2F36 A;  4ZS9 A;  4HE1 A;  4GX4 A;  1TFD A;  5TSE A;  3T9V A;  2A25 A;  4MAG A;  2L3C A;  1XT8 A;  4OTE A;  2EM4 A;  2Q2A A;  1AWB A;  3CFX A;  1FJG E;  4PF6 A;  4Q8R A;  3ZKL A;  1D9Q A;  1M5F A;  4XFE A;  2B4M A;  4QFP A;  1FQA A;  1SW1 A;  4E0W A;  5I56 A;  1FTO A;  4KHZ E;  1KA1 A;  3H6U A;  1H45 A;  4THI A;  1ATG A;  2NVU B;  4X66 E;  2WZO A;  1ZTY A;  1FTL A;  2LUQ A;  2CEX A;  2Z8F A;  4PF8 A;  3EPK A;  4X8W A;  1CE2 A;  3E9X A;  3QXM A;  1MM6 A;  3MBP A;  3W15 C;  2EOF A;  1J1N A;  4O7M A;  4ZDM A;  3PMX A;  1JQF A;  1LST A;  3RUM A;  2R8T A;  4OZ9 A;  3UK4 A;  4M2Z A;  2M9A A;  4MLQ A;  1NH7 A;  2UVG A;  1NNT A;  4U23 A;  3B50 A;  2OCU A;  5IGA A;  4PGN A;  5FHO A;  2DB2 A;  2JJK A;  1QU6 A;  4F18 A;  1FPD A;  4QFN A;  1G2D C;  3IOW A;  1B1H A;  2FHY A;  4MBP A;  2LT7 A;  1T39 A;  2J7J A;  1OQG A;  4Q0C A;  5I84 A;  2V86 A;  2EM9 A;  1MPB A;  4M4G A;  1LB8 A;  1N3G A;  1RQ0 A;  1UN6 B;  4JSO A;  4P9K A;  4NE4 A;  2I0C A;  1B7U A;  1A8E A;  4P3L A;  1FPB A;  3TQW A;  5CC2 A;  5BUU A;  3EN3 A;  1URG A;  3JV9 A;  5M2V A;  1A1F A;  1YCJ A;  4DR6 E;  4NED A;  1MY3 A;  1N7W A;  1YSA C;  3CR9 A;  5I57 B;  1TN9 A;  4N07 A;  4QXD A;  2O68 A;  3S9N C;  3T1Y E;  4YKI A;  5EYH A;  3MSW A;  1JVX A;  4GX3 A;  2P3N A;  5TP9 B;  3OMB A;  2EPM X;  3HST A;  1MY0 A;  2CTD A;  4H1X A;  2EN1 A;  5EQA A;  3P7I A;  2RS6 A;  3MUQ A;  3E13 X;  2X7Q A;  2H4I A;  3O6I A;  4MJO A;  1FQB A;  1Q9D A;  1QJM A;  3SKP A;  4LQ2 A;  4P56 A;  1JVY A;  4AQ4 A;  3H7M A;  2KR0 A;  2WEF A;  5FBP A;  4H67 A;  2MC6 A;  3RLF E;  2I48 A;  4IY6 A;  3KZY A;  2DWJ A;  2M4I A;  2VD2 A;  3GBB A;  4LTY A;  5DEX A;  1GVC A;  4H5G A;  4F2O A;  4LVQ A;  3UGW A;  2HEU A;  4X1B A;  3MVY A;  4F1Y A;  2I3W A;  2PT2 A;  4LAT A;  4RH8 A;  4X9J A;  4QSD A;  1YUI A;  2QJE A;  4MFI A;  4LF7 E;  1T4L B;  5AA2 D;  3DP4 A;  1GR2 A;  3HHG A;  2MKD A;  3BBG A;  4B3R E;  5AAS A;  2ENC A;  1D9V A;  1A1H A;  2V3U A;  1PEB A;  3O9P A;  2EL4 A;  5AA3 A;  2F78 A;  3IOT A;  1NEI A;  3MPK A;  1A40 A;  3FAS A;  1SW4 A;  1M5D A;  2P3V A;  3Q29 A;  1UTB A;  1B0L A;  4WKM A;  4G77 A;  1I69 A;  1H44 A;  4R2D A;  5A69 A;  2ZZV A;  5IWA E;  1XI6 A;  2QFL A;  2EOR A;  2NXO A;  5H8F A;  4XXU A;  5DVJ A;  2DE3 A;  3CVG A;  4IO6 A;  2XXI A;  4RA1 A;  3KWR A;  1YYZ A;  1QUI A;  5ICT A;  1ZU0 A;  4PE5 B;  4U22 A;  4DCX A;  3FD3 A;  2FIX A;  2V83 A;  2CPN A;  5I5P A;  2YWQ A;  4X9T A;  1L4S A;  4TLM B;  3BIG A;  1OMP A;  2R71 A;  1GQE A;  1DSN A;  1D3K A;  4R2P A;  4J8Z A;  4OVR A;  3R26 A;  4RK2 A;  5HM4 B;  3I6V A;  4R6H A;  4E0X A;  1LFI A;  3IX1 A;  4GXA A;  4I3E A;  3TPA A;  4EXL A;  4NMY A;  5EHS A;  4PCD A;  3DP6 A;  2OZZ A;  2Q88 A;  3T93 B;  2Q89 A;  1EH6 A;  1FBD A;  1B1X A;  1FW0 A;  2X26 A;  3IFA A;  5ET6 A;  1J5E E;  3TEL A;  2MDG A;  1KWH A;  5HPQ A;  2YU8 A;  4HE0 A;  3N5L A;  3R6U A;  1I6A A;  1EZO A;  3T1B A;  1AH5 A;  4IO3 A;  1X47 A;  1KZ8 A;  2XX8 A;  3OXN A;  3WAE A;  3KC0 A;  4F3B A;  5KCJ A;  2Z8E A;  3HFU A;  4H65 A;  5EYF A;  5AE2 A;  3TCG A;  3MAM A;  3LSX A;  4OVT A;  4N81 A;  1D4N A;  1Y3Q A;  2DMY A;  2EJ4 A;  4NXM E;  1B40 A;  4DXB A;  3KN3 A;  3OOA A;  2JPA A;  3TZA A;  4M30 A;  4YAH X;  3TTL A;  3FBP A;  3EF7 A;  3K6V A;  5I2N B;  4LQ5 A;  2XXQ A;  3EHS A;  3UIF A;  4F1V A;  1R9L A;  4BHB A;  3DF6 A;  4G68 B;  4RY1 A;  3EPH A;  2DE2 A;  2EQ0 A;  4O3C A;  4U1Z A;  2UXC E;  4RHB B;  1BLF A;  4OX9 E;  2KON A;  1VE4 A;  1MM7 A;  5A6K A;  3K0V A;  2WBU A;  4L5N C;  1G2F C;  4JI5 E;  2YTD A;  1YYW A;  4U1O A;  3UP9 A;  3HPS A;  3MZ9 A;  1DPE A;  3RYD A;  1O64 A;  2ZM6 E;  3DLN A;  1UTB B;  4FAT A;  1MXU A;  1SBP A;  3S2V A;  3SEX A;  4HE2 A;  4I9D A;  2V93 A;  3RTW B;  4G68 C;  1N3X A;  4ZYH A;  3S4U A;  2DSY A;  4GOT A;  4FJP A;  2PT1 A;  3CFZ A;  1IMD A;  2ZZW A;  1QGX A;  4JSD A;  1IBL E;  4O8M A;  4LF6 E;  4GEQ B;  1NUY A;  4Z7E A;  3K1M A;  4XEQ A;  1P1W A;  2EPP A;  1NH8 A;  2GFE A;  3N94 A;  4GQO A;  1ELJ A;  2EOJ A;  2RC7 A;  4F19 A;  4ELQ A;  2VPN A;  2B3T B;  4ZE8 A;  2B3B A;  5H8S A;  2EL5 A;  4ZYG A;  1MH3 A;  1UIL A;  3B7D A;  2PFZ A;  3LLH A;  4N4U A;  2UVI A;  2QRY A;  4I8C A;  1LBY A;  2EMK A;  1QKA A;  2QS3 A;  4ECF A;  5LDZ A;  3Q28 A;  4DKK A;  4KCD A;  2V87 A;  3GLB A;  4P0G A;  1N34 E;  4EF2 A;  4Q28 A;  4KYD A;  3UOR A;  1BBO A;  2HHM A;  1X6E A;  1YPN A;  3C36 A;  5CMB A;  2E1S A;  1X6F A;  1VSO A;  1UTH B;  4NX1 A;  2ONS A;  5L8D A;  4NZV A;  1FQF A;  3KSJ A;  1RYX A;  2HPG A;  3QAX A;  2G29 A;  3M3L A;  4AB5 A;  5DNY A;  3THO B;  1DGC A;  2F6P A;  4Q30 B;  2EMA A;  4YU0 A;  2RIN A;  4N8G A;  2FIE A;  3LBS A;  1AOV A;  5IM2 A;  3EPE A;  1B52 A;  2E72 A;  1LAH E;  4R8O A;  1XMO E;  3DP8 A;  3V83 A;  3TTR A;  3T9H B;  4MHF A;  5DYH A;  3B8B A;  4O3B A;  2LJH A;  2V4C A;  2QS4 A;  4MCO A;  4WXC A;  3FXB A;  3SER A;  2PBW A;  4F39 A;  4WXD A;  5A6A A;  1B32 A;  1FRP A;  2LAO A;  3GYY A;  5A2Q C;  4DV0 E;  4KD5 A;  1CB6 A;  4N4R B;  1Q35 A;  2FA7 A;  3LC8 A;  2MKZ A;  3PU5 A;  3E78 A;  1H43 A;  2JVA A;  3PPR A;  2XWK A;  5CI5 A;  3V5A A;  2HAV A;  4GWS A;  1EH8 A;  3U1O A;  3S9M C;  2XXV A;  2ZYN A;  1MXX A;  1OIB A;  5FTH A;  2UYE A;  5I7I A;  1JEU A;  4WPY A;  4KCC A;  3U72 A;  1RDZ A;  3A29 A;  3SDF A;  4DXC A;  1ZKB A;  2EN8 A;  4TUI A;  2YRM A;  2JYA A;  1WRJ A;  3FIR A;  1IMF A;  3O6G A;  5KL3 A;  4M1V A;  1TF6 A;  1MS7 A;  5BWJ A;  2JP9 A;  2FVZ A;  4LFA E;  2DIX A;  2NA2 A;  4DV6 E;  2ZNS A;  4K3F A;  4FAJ A;  5T6J A;  3PTY A;  2XXH A;  5CMK A;  4MX6 A;  1IBM E;  1LLM C;  2VT5 A;  1FBC A;  1MXW A;  4QBA A;  3KFM A;  3KBZ A;  3ILU B;  4R6Y A;  4QHQ A;  3MJN A;  4I3Y A;  1FJ6 A;  2FYI A;  1NNK A;  1FSA A;  4G8H A;  2Y7P A;  2EM2 A;  3FJG A;  1B3H A;  2UYF A;  3EPL A;  4PBQ A;  1VDW A;  2EPO A;  1MY1 A;  3OO9 A;  3QMF A;  4H0W A;  4NG7 A;  4HEI A;  2I13 A;  3HPI A;  5CBR A;  4DR1 E;  1A8F A;  1Z1B A;  2LRS A;  2OWT A;  3HN0 A;  1EYI A;  2I3V A;  3F6G A;  4NGU A;  4G2Z A;  5I2N A;  2RC9 A;  4IO2 A;  2E5L E;  3PV0 E;  4RPN A;  1IMU A;  3FV2 A;  1S7Y A;  2Q8U A;  4N8Y A;  4Z0I A;  4PFU A;  3N26 A;  4OER A;  1ZU1 A;  1BTJ A;  2F7B A;  4JI8 E;  2WYP A;  4F2Q A;  2WYK A;  3W9V A;  5AA4 A;  3PUW E;  4KQP A;  1HSE A;  4LP2 B;  4X04 A;  5CBS A;  1P1Q A;  3RN8 A;  4PFT A;  1OVT A;  1URD A;  2F4V E;  1H76 A;  1NUZ A;  3IO4 A;  3R7X A;  3HCQ A;  1NV3 A;  2QPQ A;  3BGH A;  4NHB A;  1N3W A;  2RSM A;  2XXW A;  2EM6 A;  5I3S A;  3K02 A;  4X8R A;  2XD3 A;  4M0V A;  4JI1 E;  3FV1 A;  4FED A;  2DVC A;  2QMX A;  2PX1 A;  3K4U A;  2FNC A;  4JI7 E;  4N6K A;  2Y7R A;  5ESY A;  2ENA A;  4GBW A;  2YJP A;  5I59 A;  4XKN A;  4DI3 D;  3M99 B;  4PE3 A;  3KN7 A;  2EQ3 A;  4DCY A;  1YYK A;  5DW8 A;  3VDF A;  2Q74 A;  5JEI A;  2NUG A;  1II5 A;  2NOO A;  2UUB E;  1RC7 A;  2B9D A;  4BDR A;  5KL7 A;  3KZZ A;  3PUZ E;  1XVY A;  4PDH A;  1FTK A;  2DE4 A;  1A1G A;  4H6D A;  5AE3 A;  1YTV A;  5H8N B;  1N33 E;  2QVU A;  1IXI A;  2ANJ A;  1XC1 A;  3T9U A;  2L2M A;  1GZ6 A;  2ODR D;  2O69 A;  2EM0 A;  5T3J A;  1FTJ A;  1OLA A;  2VGQ A;  2L8T A;  1NV0 A;  2WBD A;  3D1R A;  4OEU A;  2H5Y A;  2I58 A;  3RT6 B;  5CFF E;  4XIG Q;  3RPL A;  3H3G A;  3KZG A;  4FE8 A;  2XXP A;  2YTI A;  1LAX A;  2CMO A;  2AIX A;  5TP9 A;  1SPI A;  2F8D A;  2NUF A;  4GBV A;  1PC3 A;  2ZZX A;  4O4K A;  4N13 A;  4MF3 A;  3ADJ A;  2XX9 A;  2DWI A;  1EKZ A;  2JY9 A;  1SFE A;  1LLS A;  4PC9 A;  3K1P A;  2YPN A;  1X5W A;  4GKK E;  1ZBM A;  1Y4C A;  3TMG A;  4X48 A;  2EM5 A;  2EOY A;  1FJ9 A;  4R2A A;  2L92 A;  2EN7 A;  1B7H A;  2DWA A;  4BS9 A;  1H3D A;  4YKK A;  3VVF A;  5FHN A;  2YTO A;  1PB9 A;  5KCJ B;  3VE1 B;  1Z7M E;  5F7V A;  3C32 A;  1DTG A;  4ZYE A;  1MPD A;  4OXV A;  3UA8 A;  4JV5 E;  1DK4 A;  1LBX A;  2LJU A;  2EOI A;  3IO6 A;  1WHQ A;  3IB1 A;  3C33 A;  4OMB A;  2XWV A;  1NFT A;  1WXR A;  2O7U A;  5DT6 A;  2P1S A;  2FTX B;  3PD8 A;  3HPZ A;  1JW4 A;  4GVO A;  1PB7 A;  4ZEC A;  1NV6 A;  2ZXT A;  4NF5 B;  4QFL A;  1NV2 A;  1JW5 A;  1BIY A;  4JVI A;  4H8I A;  2DXY A;  5F3W A;  3G3H A;  2YSO A;  4LZ8 A;  1LCT A;  4R6K A;  2E1M A;  4G8N A;  4PAI A;  1IMC A;  3V89 B;  5I58 B;  3CSG A;  1NUX A;  3H6T A;  1N04 A;  2DLK A;  5KL4 A;  2V3T A;  1B4H A;  4MH5 A;  1Y3P A;  1MRP A;  1ZBQ A;  1N84 A;  4PQJ A;  1POY 1;  2RF1 A;  2MDR A;  3F6H A;  4IO5 A;  4IY5 A;  4XKQ A;  3TDJ A;  3JU0 A;  2UVH A;  1QUL A;  1M5E A;  4ONY A;  2A5S A;  4EXK A;  1NNF A;  3OSR A;  1KYQ A;  4GX6 A;  4UAB A;  1FQC A;  4TQU Q;  3OO7 A;  1MQG A;  4EDP A;  3PPN A;  3EPJ A;  1LBZ A;  2YLN A;  4RNS A;  2H9B A;  3LUY A;  1O0W A;  2JOX A;  2FV4 B;  4Q5T A;  2EN6 A;  1A99 A;  2PVU A;  1I6Q A;  5LOM A;  4OFO A;  2WCC 3;  2V8Q B;  4JYA E;  2F7A A;  4ELR A;  3N6U A;  3CI8 A;  1N7X A;  1FPG A;  3PPQ A;  1LAF E;  2OWS A;  2L5V A;  1TXF A;  2QSX A;  4KWY A;  3KJT A;  3B6Q A;  2FGG A;  1TFA A;  2EN2 A;  2KHX A;  1IMA A;  4PFB A;  3JTZ A;  3HTX A;  1IEJ A;  2HC5 A;  1FBG A;  3U94 A;  2L33 A;  2ZNT A;  3BID A;  4F3G A;  2CZH A;  4WFT A;  1MQD A;  3TCF A;  3IOU A;  4IB2 A;  4BDM A;  4NF6 B;  4OEV A;  4DV7 E;  3ONM A;  3M3F A;  5EQ7 A;  2YZT A;  1LEV A;  2O6A A;  3FVG A;  4JWO A;  2RTX A;  5H8N A;  4HS7 A;  4P47 A;  3IL1 B;  2EP3 A;  1WJP A;  3E79 A;  3MZB A;  3CHG A;  3THI A;  3ADL A;  5ADZ A;  5CMM A;  1NNP A;  2O7I A;  2B3F A;  1NUW A;  3GBA A;  3KN8 A;  1B0H A;  1OLC A;  2V25 A;  2E0S A;  4WSG A;  3J7Y p;  5CRY A;  1ZMG A;  3VLU A;  4GWO A;  4LZ7 A;  3O2A A;  4QFK A;  4EQB A;  5LTC A;  3RTF B;  3VVD A;  3AUZ A;  5I59 B;  4DV1 E;  1IQO A;  1YXI A;  4DXU A;  3ZSF A;  2YTQ A;  4LZ5 A;  4IO7 A;  4F2J C;  2BB8 A;  3KJ7 A;  4JI0 E;  5ET5 A;  4I8O A;  1LFG A;  4KR5 A;  3U92 A;  4UA8 A;  4F29 A;  3RGY A;  2NUV A;  5BR8 E;  2OJT A;  1RDY A;  3U93 A;  1B46 A;  4MEV A;  1DQ3 A;  1HSJ A;  1R6Z A;  2REJ A;  1T4O A;  2WBS A;  4MNI A;  4DDD A;  1S50 A;  4R9F A;  1Q1K A;  2EMX A;  2BJI A;  1WOD A;  3CG1 A;  2V89 A;  2V84 A;  3MWB A;  3VYY A;  1N32 E;  3PGF A;  1PJQ A;  3KC1 A;  4P1L A;  3LUZ A;  1VFD A;  1A1L A;  2I9I A;  1K9Z A;  3MQ9 A;  1T0K A;  2XXR A;  5K2Y A;  4ZEI A;  4GL0 A;  1S9T A;  5TU0 A;  2UUA E;  1R9Q A;  3FIG A;  4X64 E;  2UUC E;  1EZ9 A;  2PFY A;  1LBW A;  2O1M A;  5ET8 A;  1MQI A;  2LBS B;  4C1U A;  1MDQ A;  3PD9 A;  1T38 A;  1YZ0 A;  2KOU A;  4R74 A;  1A1J A;  1TWY A;  4NWC A;  2EOQ A;  1Y20 A;  2P2A A;  4NN3 A;  3MVX A;  4OVP A;  2VE7 C;  2YT4 A;  5FHM A;  1SQY A;  3ADG A;  2EN3 A;  5HBC A;  3MP6 A;  2YRH A;  4JXI A;  4PET A;  5JTY B;  4AB6 A;  4JI6 E;  3L6H A;  5IZZ A;  3TOD A;  3RPL B;  1IXC A;  5DEX B;  4MIJ A;  1FQE A;  4DE8 A;  2N3G A;  2UXB E;  1SVX B;  4EUO A;  3VLW A;  3J7A G;  4YHH E;  1QKB A;  2XXY A;  3C6M A;  2YTF A;  3Q27 A;  3FZV A;  2ZYO A;  3TKD A;  4P78 A;  1P1N A;  4XKP A;  2PYY A;  2QS1 A;  5KL5 A;  4N17 A;  4F54 A;  1HNZ E;  2EOO A;  1D9Y A;  1WDN A;  3LR1 A;  1FPJ A;  4OET A;  3M8U A;  3OEL A;  4ZEB A;  4IGR A;  3ADI A;  1B51 A;  5ELV A;  4R2B A;  5H8H A;  3RT8 A;  3ZOQ B;  3OEM A;  3QG5 C;  5EHM A;  3VYX A;  1DMB A;  4ND9 A;  4AS5 A;  3MC2 A;  1FBP A;  3S9L C;  3K6X A;  4ESX A;  2GQ1 A;  4OFL A;  2YSP A;  5EQ8 A;  1XHY A;  2ELZ A;  2HZK A;  2GRV A;  4OVQ A;  3MYU A;  4OHN A;  3OEN A;  4TOZ A;  5TPA A;  3TUS A;  4LUB A;  4F9B B;  2M1S A;  2OK2 A;  2W7Y A;  1M5C A;  4ZEK A;  2HXR A;  4ZE9 A;  2EPC A;  2VOZ A;  4JWX A;  2KLF A;  2IEE A;  4BBY A;  3MVZ A;  3BBR A;  1UTH A;  2DSF A;  4U4S A;  5LLQ A;  4DR3 E;  5AC5 A;  3UK3 C;  3SES A;  1FCK A;  3A09 A;  5IZ3 A;  4FEB A;  3FVK A;  5ICQ A;  3EQ1 A;  1T4N A;  1LBB A;  2VPO A;  1IXH A;  2UVJ A;  5CMC A;  4P1E A;  2EWL A;  2OLB A;  2L6M A;  2F7C A;  4QFO A;  1DTZ A;  2GH9 A;  4DI4 B;  2QS2 A;  4YKJ A;  3IOR A;  2DGC A;  2VRD A;  3QYT A;  2F35 A;  4OFJ A;  2DRP A;  3JZJ A;  3JAM C;  1BKA A;  2LO3 A;  2DP8 A;  1NCS A;  2CT1 A;  3Q25 A;  3QSL A;  3PMV A;  2DDK A;  2YTE A;  4BC9 A;  2Y5L A;  1ZLQ A;  2K7I A;  5IV8 B;  1N36 E;  2IA4 A;  3BF2 A;  1AIV A;  1QUJ A;  2WBT A;  4TUG A;  1HNW E;  1UIV A;  3K00 A;  4F3S A;  4KYS A;  4B3M E;  3SEU A; 
#chains in the Genus database with same CATH homology
 3CIJ A;  3R26 A;  1P1O A;  3Q26 A;  4RK2 A;  3T9X B;  3KOT A;  1PC3 A;  3RQT A;  3LSW A;  5HM4 B;  4N13 A;  4MF3 A;  3I6V A;  4R6H A;  1A7L A;  2XX9 A;  1LFI A;  4E0X A;  2ZYM A;  4OEN A;  4F22 A;  5I58 A;  2DWI A;  3GZG A;  3IX1 A;  1IZ1 A;  2XHD A;  3MP8 A;  3C31 A;  4GXA A;  3D4C A;  3TPA A;  4RPO A;  1LLS A;  4EXL A;  4NMY A;  3K1P A;  5EHS A;  2YPN A;  3KGC A;  4JBZ A;  3C9H A;  3H6W A;  3DP6 A;  2OZZ A;  5I2K A;  2Q88 A;  1Y1Z A;  3T93 B;  1B58 A;  1ZBM A;  2F6G A;  2HZL A;  1Y4C A;  2Q89 A;  4U2R A;  3TMG A;  4X48 A;  1FW0 A;  1B1X A;  2X26 A;  4U4X A;  3TEL A;  1KWH A;  5HPQ A;  1B7H A;  2DWA A;  3N5L A;  5AA2 A;  3R6U A;  3F11 A;  1Y4T A;  1H3D A;  1I6A A;  4NF6 A;  1EZO A;  4NWD A;  2RC8 A;  3LSL A;  4YKK A;  4I62 A;  3VVF A;  1AH5 A;  4IO3 A;  5FHN A;  3B6T A;  4IO4 A;  5ISU A;  2M8C A;  5H8Q B;  1AL3 A;  3IK6 B;  1PB9 A;  2XX8 A;  3OXN A;  3VE1 B;  3WAE A;  1Z7M E;  5KCJ B;  1SI1 A;  3TEP A;  1B3L A;  4F3B A;  5F7V A;  3C32 A;  1DTG A;  5KCJ A;  2Z8E A;  1MPD A;  2XX7 A;  3OO8 A;  4OXV A;  3UA8 A;  1NKX A;  4ESW A;  1GGG A;  1MXZ A;  2QMW A;  4H65 A;  3IO6 A;  3QK6 A;  4G68 A;  5EYF A;  3IB1 A;  4YIC A;  3C33 A;  3TCG A;  4KPT A;  3MAM A;  4N6P A;  4OMB A;  3LSX A;  4RXL A;  1NFT A;  1ANF A;  2XD2 A;  5H8H B;  2O7U A;  5DT6 A;  3SET A;  5H8F B;  2P1S A;  4DLD A;  1D4N A;  1Y3N A;  1Y3Q A;  2D3I A;  3G3J A;  3MP1 A;  1JW4 A;  3G3K A;  3PD8 A;  4U21 A;  1FQD A;  2A5T A;  3HO7 A;  3IAZ A;  3PUY E;  4EQ9 A;  1B40 A;  1EU8 A;  1PB7 A;  2Y84 A;  4JB7 A;  2ZXT A;  4NF5 B;  2F34 A;  4QFL A;  5K2X A;  2F97 A;  3KN3 A;  4DXB A;  1JW5 A;  1BIY A;  1ZIU A;  2HQ0 A;  3OOA A;  4H8I A;  3TZA A;  4F1U A;  1IIT A;  2DXY A;  3G3H A;  4YAH X;  3TTL A;  4LZ8 A;  1LCT A;  4IGT A;  4R6K A;  3EF7 A;  3K6V A;  4G8N A;  3V89 B;  2WKY A;  1IUD A;  1UIU A;  5CM6 A;  5I2N B;  5I58 B;  3CSG A;  4NF5 A;  1AMF A;  4LQ5 A;  4GRK A;  2XXQ A;  3H6T A;  2I4C A;  3EHS A;  2AL5 A;  4ISU A;  4DZ1 A;  1B3G A;  3UIF A;  1N04 A;  3FAT A;  1HSL A;  2V3T A;  1B4H A;  3EHU A;  4F1V A;  2GHB A;  4MH5 A;  4ZZE A;  1MH4 A;  1Y3P A;  1DPP A;  1US5 A;  1R9L A;  4GXS B;  4H5F A;  1DSN A;  3BKI B;  1MRP A;  4WED A;  4L17 A;  1DOT A;  1N84 A;  1PB8 A;  4G68 B;  4PQJ A;  1POY 1;  3C34 A;  4RJZ A;  2RF1 A;  4RY1 A;  3E3K A;  2I49 A;  2VD3 A;  3FVN A;  3O66 A;  3ECR A;  2DE2 A;  4IO5 A;  4IY5 A;  4XKQ A;  2UVH A;  3TDJ A;  1QUL A;  1BP5 A;  1M5E A;  1R1N A;  4GFR A;  4O3C A;  4U1Z A;  3USD A;  4NF4 A;  2Z22 A;  1RYO A;  4JWY A;  1BLF A;  4G4P A;  4ONY A;  2A5S A;  1VE4 A;  1MY4 A;  1SYI A;  1MM7 A;  3TYH A;  1NNF A;  3K0V A;  2O84 X;  2Y7I A;  3OSR A;  4EXK A;  5L9S A;  1I6B A;  3OSQ A;  3TFL A;  1FQC A;  1POT A;  2H25 A;  3IJO B;  4XKR A;  4TQU Q;  3OO7 A;  1MQG A;  3O6H A;  4U1O A;  4MLV A;  3TAJ A;  3MZ9 A;  3PPP A;  1DPE A;  3UP9 A;  4EDP A;  1O7T A;  2RCB A;  3L6G A;  3G3F A;  1O64 A;  3PPN A;  3SEU A;  4YMA A;  3DLN A;  1O63 A;  1UTB B;  2CZL A;  2YLN A;  1US4 A;  4LON B;  5L9M A;  4F3P A;  4RNS A;  1P99 A;  4FAT A;  3EHT A;  1MXU A;  2H9B A;  1SBP A;  3LUY A;  3S2V A;  2PMS A;  3FJ7 A;  4GF8 A;  4RYA A;  3SEX A;  4BDO A;  5KZT A;  1PBP A;  4Q5T A;  3TCH A;  5J1D A;  3DEL B;  2V93 A;  4I9D A;  4R75 A;  1B2H A;  4G68 C;  4R72 A;  3RTW B;  4PFY A;  1OVB A;  1A99 A;  1N3X A;  1RKM A;  3PUX E;  3S9E A;  1F9B A;  2PVU A;  3QIM A;  2NWJ A;  3JYR A;  3S4U A;  4GOT A;  1I6Q A;  4FJP A;  2G93 A;  2PT1 A;  3CFZ A;  3GXA A;  4ZZA A;  5LOM A;  4OFO A;  2A5T B;  3PMW A;  1LFH A;  2F7A A;  4JSD A;  3LSF B;  1N0T A;  3N6U A;  4ELR A;  3CI8 A;  1NMU A;  2VHA A;  1N7X A;  4BLA A;  1SW5 A;  3QUJ A;  3O29 A;  3H4Z A;  3PPQ A;  4ELO A;  1P1U A;  4Z7E A;  1LAF E;  2OWS A;  3K1M A;  3RPW A;  3E4R A;  1P1W A;  1TXF A;  3M3K A;  4YB7 A;  3KG2 A;  1MXV A;  2QSX A;  1NH8 A;  4OQO A;  4R73 A;  3KJT A;  2GFE A;  3N94 A;  1QUK A;  3B6Q A;  3O97 A;  2AL4 A;  4GQO A;  3A3U A;  4OWD A;  3ZKK A;  1ELJ A;  1TFA A;  2RC7 A;  4F19 A;  4TLL B;  1IEJ A;  4ELQ A;  2Y7W A;  1FTM A;  5I57 A;  2XXU A;  5F1Q A;  3U94 A;  3O28 A;  5B70 A;  2THI A;  2ZNT A;  4QFK A;  4F3G A;  2Q8J A;  2RKM A;  1PDA A;  1MQD A;  4P11 A;  4ZE8 A;  3IOU A;  1XOC A;  3TCF A;  1Y9U A;  2B3B A;  4IB2 A;  4P0I A;  5H8S A;  3T96 B;  1LAG E;  4BDM A;  1MH3 A;  4NF6 B;  4OEV A;  4POW A;  5KDT A;  3B7D A;  3HHF A;  3ONM A;  3M3F A;  5IKB A;  2UVI A;  4NTL A;  2O6A A;  2QRY A;  4YMB A;  3FVG A;  4I8C A;  2I0B A;  2O1L A;  2UXA A;  4JWO A;  5H8N A;  2QL3 A;  3FVO A;  3OEK A;  4HS7 A;  1QKA A;  3IL1 B;  2QS3 A;  3I3V A;  4ECF A;  4KYS A;  1EZP A;  1B5H A;  3Q28 A;  4KCD A;  3SEV A;  1LGB C;  3PPO A;  2REG A;  3GLB A;  4P0G A;  4HTG A;  1UQW A;  3MZB A;  3T22 A;  3THI A;  4ELP A;  5H8Q A;  2Z8D A;  4EF2 A;  1ZJL A;  5JTY A;  4FOR A;  4KYD A;  5CMM A;  3UOR A;  1NNP A;  4F31 B;  2O7I A;  4OYV A;  1Z7N E;  3V8X B;  2ZNU A;  3VXC A;  2B3F A;  3K6U A;  3GBA A;  3KN8 A;  5M2V A;  1B0H A;  1OLC A;  4G8M A;  4PFW A;  5DVF A;  1YPN A;  2H99 A;  5A5X A;  2ESN A;  1OQH A;  3C36 A;  5CMB A;  1B6H A;  3IB0 A;  3KEI A;  2V25 A;  2E0S A;  2GHA A;  5CRY A;  1MDP 1;  1ZMG A;  2VP1 A;  2E1S A;  1GTK A;  1VSO A;  1JNF A;  2Z23 A;  3CFL A;  1UTH B;  1TT1 A;  2ONS A;  1B05 A;  3MVW A;  2V3Q A;  3H03 A;  1LB9 A;  3K1N A;  3O2A A;  1FQF A;  4H8J A;  3ODB A;  2ONK E;  4GD5 A;  3KSJ A;  1RYX A;  4WEP A;  4EQB A;  3QAX A;  3RTF B;  3VVD A;  2G29 A;  3M3L A;  4AB5 A;  5I59 B;  3D4G A;  2R9J A;  2F6P A;  4DXU A;  4FIM A;  1JW1 A;  4KI0 E;  4Q30 B;  4YU0 A;  1IXG A;  3ZSF A;  1A54 A;  1WVJ A;  2RIN A;  3FXQ A;  4GIZ A;  2H98 A;  3UN6 A;  4WXJ A;  4ZEC A;  3LBS A;  4LZ5 A;  3AXF A;  1AOV A;  4IO7 A;  4O3A A;  3EPE A;  1B52 A;  3DM0 A;  2I4B A;  1LAH E;  1L5T A;  3KJ7 A;  4KYE A;  2F5X A;  2P0S A;  3CSB A;  3MZ1 A;  3DP8 A;  3TTN A;  3FGS A;  3TTR A;  3V83 A;  3TQL A;  4EF1 A;  2Q2C A;  3T9H B;  1Y1M A;  1IQ7 A;  3C35 A;  5DYH A;  1LFG A;  4KR5 A;  5AA1 A;  3U92 A;  2D21 A;  2OBG A;  4HW8 A;  4O3B A;  3OO6 A;  4UA8 A;  4F29 A;  3VLV A;  5A5X B;  5IAI A;  3IOV A;  2O51 A;  3RGY A;  2NUV A;  3RY3 A;  5I56 B;  1M5B A;  1QVS A;  2OJT A;  2QS4 A;  3TTM A;  3H6V A;  3U93 A;  2R6G E;  1XS5 A;  3VFJ A;  3VXB A;  2DXR A;  2HXW A;  3ILT B;  3SER A;  1B46 A;  2PBW A;  3T66 A;  3G7W A;  2ONR A;  4POX A;  4XTC Q;  4NF8 B;  3U8Q A;  4PP0 A;  1MQJ A;  3MW0 A;  5FTI A;  4F39 A;  2BJJ X;  1HSJ A;  2ALU A;  2I6E A;  1B32 A;  2AYS A;  1R6Z A;  2LAO A;  2F36 A;  3H06 B;  2REJ A;  4ZS9 A;  4KD5 A;  4KFQ A;  1CB6 A;  2DOJ A;  3FXU A;  4DDD A;  1TFD A;  1Q35 A;  2FA7 A;  4X1D A;  3T9V A;  3LC8 A;  3RNN A;  1SD3 A;  1S50 A;  4R9F A;  1Q1K A;  5TPA B;  1MQH A;  1XT8 A;  3PU5 A;  1H43 A;  1WOD A;  3KBR A;  3CG1 A;  2V84 A;  3MWB A;  3PPR A;  4OTE A;  5CI5 A;  3V5A A;  2Q2A A;  2HAV A;  4QF9 A;  3CFX A;  4Q8R A;  4LZ7 A;  3U1O A;  4C0R A;  3ZKL A;  3S9M C;  2XXV A;  1M5F A;  2ZYN A;  3PGF A;  4QFP A;  1MXX A;  1FQA A;  1OIB A;  1SW1 A;  5FTH A;  2HAU A;  4OES A;  4E0W A;  5I56 A;  1FTO A;  2UYE A;  1JEU A;  1VFD A;  4KCC A;  3U72 A;  3KOS A;  4KHZ E;  3MQ9 A;  1GV8 A;  5ITP A;  3SDF A;  2XXR A;  4DXC A;  1ZKB A;  1T0K A;  4ZEF A;  3H6U A;  1H45 A;  4RPN A;  5K2Y A;  4THI A;  2Q9T A;  3A3C A;  4YZZ A;  1ATG A;  1S9T A;  4GL0 A;  4ZEI A;  5TU0 A;  2NVU B;  1R9Q A;  1B7Z A;  2HCA A;  5DVI A;  3FIR A;  1ZTY A;  4R9G A;  1EZ9 A;  1FTL A;  3O6G A;  2O1M A;  1MQI A;  4M1V A;  2Z8F A;  4C1U A;  1MDQ A;  1URS A;  1MS7 A;  1MXY A;  5BWJ A;  3SEW A;  5KDT B;  3PD9 A;  4C1T A;  4YKP A;  2RCA A;  4UAC A;  1CE2 A;  3E9X A;  2ZNS A;  3QXM A;  1MM6 A;  3MBP A;  4R74 A;  3FJM A;  4RK9 A;  4K3F A;  3W15 C;  1XVX A;  4FAJ A;  2XXH A;  3W9W A;  1J1N A;  1N76 A;  1TWY A;  4ZDM A;  4NWC A;  5CMK A;  3PMX A;  1Y20 A;  2P2A A;  2XXX A;  3MVX A;  1JQF A;  1LST A;  3RUM A;  1MXW A;  3KFM A;  1SW2 A;  3ILU B;  4OZ9 A;  4R6Y A;  4QHQ A;  1QW0 A;  5DTB A;  3UK4 A;  3MJN A;  1VFE A;  4MLQ A;  1NH7 A;  1SQY A;  1NNT A;  2UVG A;  4U23 A;  5FHM A;  3VLU A;  2FYI A;  5HBC A;  1NNK A;  3B6W A;  3K2D A;  3C4M A;  4G8H A;  3MP6 A;  2Y7P A;  2OCU A;  4PET A;  4JXI A;  5JTY B;  2DS9 A;  4GWO A;  3FJG A;  5FHO A;  1B3H A;  3K6W A;  4AB6 A;  2UYF A;  4F18 A;  4QFN A;  1NL5 A;  3IOW A;  1B1H A;  1MY1 A;  3L6H A;  3OO9 A;  4H0W A;  3TOD A;  4MBP A;  3I5O A;  3N6T A;  1IXC A;  5DEX B;  1LCF A;  1FQE A;  4GLI A;  3HPI A;  1OQG A;  4Q0C A;  5CBR A;  4DE8 A;  5I84 A;  1MPB A;  1A8F A;  4M4G A;  1LB8 A;  3K01 A;  3CRB A;  2D5W A;  4R2F A;  1SVX B;  4JSO A;  4EUO A;  2OWT A;  4NE4 A;  4YB6 A;  3G3G A;  1MY2 A;  1B7U A;  2I0C A;  3HN0 A;  1A8E A;  3MPL A;  3VLW A;  2I3V A;  1QKB A;  2XXY A;  3TQW A;  5CC2 A;  3IJX B;  5I2K B;  5BUU A;  4G2Z A;  3Q27 A;  2RC9 A;  3FZV A;  4IO2 A;  5I2N A;  1B3E A;  2ZYO A;  1URG A;  1USY H;  3EN3 A;  3IR1 A;  1YCJ A;  1P1N A;  3JV9 A;  3PV0 E;  1SI0 A;  3FV2 A;  1S7Y A;  2PYY A;  4XKP A;  4NED A;  1MY3 A;  1N7W A;  4Z0I A;  2QS1 A;  4PFU A;  3CR9 A;  4NF4 B;  3N26 A;  3FUZ A;  4OER A;  3IB2 A;  4N07 A;  4QRZ A;  1BTJ A;  5I57 B;  2F7B A;  3CG3 A;  1D9Y A;  1WDN A;  2O68 A;  4QSE A;  4YKI A;  3W9V A;  3LR1 A;  4F2Q A;  3S9N C;  1JVX A;  5AA4 A;  4OET A;  3PUW E;  3M8U A;  3OEL A;  4ZEB A;  4KQP A;  1HSE A;  4LP2 B;  4IGR A;  1B51 A;  5ELV A;  5TP9 B;  4EQ7 A;  3OMB A;  5CBS A;  1P1Q A;  4R2B A;  3HST A;  4PFT A;  5H8H A;  1MY0 A;  3RN8 A;  3RT8 A;  4H1X A;  1OVT A;  1EH3 A;  1URD A;  5L8D A;  3G3I A;  3ZS6 A;  1H76 A;  3IO4 A;  3R7X A;  3SEY A;  4JDF A;  3P7I A;  3MUQ A;  3OEM A;  2QPQ A;  2X7Q A;  2H4I A;  3E13 X;  3HCQ A;  3O6I A;  5EHM A;  1FQB A;  1N3W A;  1PBQ A;  1QJM A;  2XXT A;  4BDQ A;  1DMB A;  2XXW A;  4ND9 A;  3PUV E;  3SKP A;  4LQ2 A;  3FXR A;  3K02 A;  3MC2 A;  3S9L C;  1JVY A;  3K6X A;  2XD3 A;  4AQ4 A;  3FV1 A;  4FED A;  2DVC A;  3H7M A;  2QMX A;  2PX1 A;  4ESX A;  1B9J A;  4OFL A;  1VR5 A;  4H67 A;  1IIW A;  1MPC A;  1XHY A;  5AE4 A;  3K4U A;  2FNC A;  3RLF E;  2HZK A;  2GRV A;  2I48 A;  2Y7R A;  4IY6 A;  2DWH A;  2DWJ A;  1B5I A;  4OHN A;  2YJP A;  1B4Z A;  3OEN A;  4TOZ A;  2VD2 A;  3GBB A;  5I59 A;  5DEX A;  4XKN A;  1GVC A;  4H5G A;  5TPA A;  4F2O A;  4LVQ A;  3TUS A;  3UGW A;  2HEU A;  4LUB A;  1JET A;  3KN7 A;  4X1B A;  3MVY A;  4DCY A;  5B7D A;  5L9O A;  2OK2 A;  2W7Y A;  1M5C A;  2I3W A;  2PT2 A;  4F1Y A;  4LAT A;  4ZEK A;  4QSD A;  4ZE9 A;  2QJE A;  4MFI A;  2VOZ A;  4JWX A;  4HCW A;  2KLF A;  3VDF A;  5JEI A;  2IEE A;  5AA2 D;  4YB5 A;  3DP4 A;  2ZMB A;  3KSX A;  3MVZ A;  1GR2 A;  1UTH A;  1II5 A;  2DSF A;  2NOO A;  3BBR A;  2DQV A;  3HHG A;  4U4S A;  3VV5 A;  2HFB A;  2ZYK A;  1D9V A;  3HV1 A;  3BFT A;  2V3U A;  1B5J A;  1PEB A;  2B65 A;  3O9P A;  3SES A;  1FCK A;  1SDX A;  3A09 A;  5AA3 A;  4FEB A;  5AA2 B;  2F78 A;  5ITO A;  4BDR A;  3IOT A;  3FVK A;  4QSC A;  3MPK A;  3EQ1 A;  5ICQ A;  1LBB A;  3PUZ E;  3OD7 A;  4BDL A;  1XVY A;  1A40 A;  3FAS A;  1SW4 A;  1IXH A;  1M5D A;  2UVJ A;  5AA4 B;  1LBC A;  1FTK A;  1JEV A;  2DE4 A;  5CMC A;  3Q29 A;  4H6D A;  3QUF A;  1YTV A;  4DCX A;  5H8N B;  2OLB A;  1UTB A;  1B0L A;  2DVZ A;  4WKM A;  4G77 A;  1IXI A;  1B3F A;  1I69 A;  2ANJ A;  2Y7K A;  4DIG A;  2F7C A;  1H44 A;  1DTZ A;  2GH9 A;  1XC1 A;  2DYX A;  2QS2 A;  4FEC A;  4QFO A;  4NF8 A;  4YKJ A;  3IOR A;  3T9U A;  3TTK A;  4BDN A;  4OVJ A;  3QYT A;  2F35 A;  2O69 A;  4GL8 A;  5JK4 A;  4I1D A;  1YAE A;  4OFJ A;  3JZJ A;  4HCY A;  3TKD A;  1USY E;  1BKA A;  2NXO A;  2DP8 A;  1FTJ A;  1OLA A;  5H8F A;  2VGQ A;  3Q25 A;  3QSL A;  4XXU A;  5DVJ A;  2DE3 A;  3PMV A;  3WAF A;  3CVG A;  4IO6 A;  2XXI A;  4RA1 A;  4OEU A;  2H5Y A;  2I58 A;  3BFU A;  3RT6 B;  4LA9 A;  1QUI A;  4ZED A;  5ICT A;  1ZLQ A;  1ZU0 A;  4PE5 B;  4U22 A;  4XIG Q;  3VVE A;  2IA4 A;  3FD3 A;  3H3G A;  3KZG A;  4FE8 A;  1AIV A;  1QUJ A;  2X7P A;  2XXP A;  2ABH A;  1MG1 A;  1LAX A;  4X9T A;  4TLM B;  2CMO A;  1UIV A;  1OMP A;  2AIX A;  2R71 A;  1A55 A;  3K00 A;  4F3S A;  1SYH A;  1D3K A;  5TP9 A;  4GVO A;  2F8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...