4MLVA

Crystal structure of bacillus megaterium porphobilinogen deaminase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
290
Chain Sequence
SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKLLIDRVKEELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porphobilinogen deaminase
publication title Structural evidence for the partially oxidized dipyrromethene and dipyrromethanone forms of the cofactor of porphobilinogen deaminase: structures of the Bacillus megaterium enzyme at near-atomic resolution.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transferase
total genus 102
structure length 290
sequence length 311
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 4mlvA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA02
4YB6A 3K1PA 3TCGA 5JTYA 2NVUB 3OSQA 3MP6A 4OFOA 4H5FA 2P2AA 2NUVA 2QS2A 3FD3A 1MQJA 3KSXA 4F2QA 3D4CA 4QF9A 3U92A 1VR5A 3M3LA 5DVJA 4AB6A 2D3IA 5FHOA 1JNFA 2UYEA 5H8NB 1AMFA 4YMBA 1QUIA 4H8JA 2F36A 3C32A 1UTBB 3E13X 4BDMA 2IA4A 1FTLA 3PV0E 3TTRA 2DOJA 3DELB 5I2KB 3TODA 1MY1A 4GL0A 3FATA 5HBCA 1IXIA 3DP4A 2VD2A 2XX9A 1MM6A 1B3EA 3FZVA 4TQUQ 3CRBA 1O7TA 1JEUA 3CSBA 2DE4A 1GGGA 1EZPA 1QW0A 1LAFE 4XKRA 3OMBA 4ESXA 4YKIA 3T9VA 3T9HB 4FATA 3IOVA 3PUXE 1H76A 2YJPA 3L6GA 3FGSA 1JW1A 1P1QA 4RK2A 2CMOA 1KWHA 3FV1A 1BTJA 5KDTB 3UA8A 3K6VA 3UORA 3OEKA 3EQ1A 2F6GA 4R9FA 4XIGQ 4OTEA 4KR5A 2H98A 1MXVA 5HPQA 3VXBA 3HPIA 3TTNA 4AB5A 4RK9A 1LB9A 3WAEA 4RJZA 4XKQA 1EZOA 4PFWA 4XXUA 1VSOA 4R6HA 5H8FA 4MH5A 2O84X 1N7WA 5FHNA 2HEUA 1B52A 2I58A 3UIFA 4FORA 3C33A 2I0BA 3BKIB 1MPCA 1B2HA 4GL8A 4OENA 3CI8A 1SYHA 2RKMA 4ZEFA 2VD3A 4H0WA 4DXCA 3H6WA 3ILTB 4FIMA 3W15C 4F29A 3B7DA 1HSEA 2ESNA 4KQPA 4NF5A 3K2DA 3B6QA 4DZ1A 3D4GA 3GBBA 4G8NA 5CC2A 3F11A 3K1NA 3U94A 2F7CA 2ONSA 4QFNA 3OOAA 1NNKA 4P0IA 3KSJA 2P1SA 1NNPA 3SEXA 3MVYA 3QXMA 2RC9A 2F35A 3K01A 3RTFB 1MQGA 2B3BA 1DMBA 3FXQA 3ECRA 3QSLA 2LAOA 2D21A 2I48A 3E3KA 3PMVA 4H5GA 1B1XA 3I3VA 4ZEKA 4HS7A 4PP0A 5I2NB 3CG3A 4I1DA 1VE4A 1MXXA 3A09A 1F9BA 2FNCA 3TAJA 2F78A 5A5XA 3RPWA 1B3LA 1VFEA 2PYYA 3MVZA 4PFUA 3G3FA 2THIA 3KOSA 5TPAA 5I57A 2XXWA 1ZTYA 1OMPA 4NF4A 1UTHA 4NF6A 4X1DA 3CVGA 3FUZA 3FVKA 3FVOA 1MQIA 4YKPA 4IO2A 4ELOA 1P99A 3TTKA 3H6VA 2GHBA 3OO6A 2XXHA 1BLFA 2ZNSA 1ZIUA 2R9JA 4KCCA 3V8XB 4DXBA 1FTMA 3PUZE 1Y3QA 2ONRA 5AA4A 1LFGA 5I56A 2Y7PA 1OIBA 3MUQA 5JK4A 2RC8A 1A8FA 3LR1A 4ELQA 3T96B 1Y20A 3O9PA 4G2ZA 1XHYA 1FQDA 3SEUA 3LSXA 5JEIA 2F6PA 3KOTA 4U1OA 1PBPA 1DPPA 4JSDA 3H06B 1B3HA 3HHFA 1QJMA 1TFDA 4H6DA 3H4ZA 2Q8JA 3VE1B 4NE4A 2QS3A 1WDNA 3MVXA 1USYH 4R73A 1P1UA 3SEVA 4N07A 2ZNUA 2HAVA 4QSDA 5AA3A 3KJ7A 1EH3A 3LSWA 4POXA 4RYAA 4ZE9A 3C31A 4X1BA 5IKBA 4BLAA 1M5DA 2RCBA 2O68A 4LZ5A 1SBPA 4GXAA 3TCHA 3M3KA 1FQCA 3S2VA 2V3QA 4NTLA 3ODBA 5I59A 1GTKA 3QUJA 3TPAA 4FAJA 1OLCA 2HQ0A 4NF8B 3ILUB 3B6TA 5KCJA 2X26A 2QJEA 3IORA 1XT8A 3FVGA 2R71A 3PPQA 5H8HB 1IIWA 1II5A 3CSGA 4GLIA 2Q88A 3FASA 3S9NC 1O64A 1XVYA 2A5TB 2DP8A 2E1SA 1B4HA 2DS9A 2DE2A 4ZZEA 5L8DA 4YICA 1PBQA 4Q8RA 2OJTA 2Q89A 4JWXA 3S9MC 1B0HA 3PMWA 1XS5A 2AIXA 3DLNA 3DM0A 3BFUA 4BDNA 1Y1MA 3N94A 1FQAA 4THIA 3K00A 4EQ9A 4E0XA 3SEYA 2I6EA 4LZ7A 2VOZA 1FTKA 3M3FA 3DP8A 2Z8DA 2HAUA 1B7UA 4I62A 3RY3A 3Q26A 4LQ2A 1RYOA 4U1ZA 4H67A 2I49A 4ZDMA 3IOUA 3RGYA 5CMBA 5LOMA 4ECFA 3PD8A 1Z7NE 3FXRA 1B7ZA 3CFZA 4KYSA 4GF8A 4P0GA 4QFLA 2V93A 3L6HA 2ZXTA 1PEBA 3FIRA 4TLMB 4ZE8A 1D9VA 4KHZE 1NNFA 3A3CA 3R7XA 1SDXA 1FTOA 1QUKA 1NNTA 1H45A 1MXZA 4IO5A 1J1NA 1US5A 3VDFA 1N0TA 3LUYA 1M5CA 1MY2A 3C35A 3MP8A 2DXYA 4GWOA 4JBZA 1A55A 1AL3A 1BP5A 4GRKA 4UA8A 4BDLA 1FQFA 3PUYE 4Z0IA 3S9EA 1YPNA 1JETA 4DXUA 4O3AA 4YB7A 4QHQA 3KFMA 3RUMA 2G93A 3RLFE 4G77A 5TP9A 3GZGA 1QKBA 4KCDA 1I69A 1OVTA 1B51A 5TU0A 2QMXA 1Y3PA 3QIMA 1NMUA 3VXCA 4M4GA 4N6PA 3PMXA 3OELA 1JW5A 2REJA 3G7WA 4UACA 3K6WA 3PPPA 1JEVA 5BUUA 1A99A 1NL5A 4XTCQ 4JDFA 4HTGA 2ZYNA 2GH9A 2Q2CA 3GXAA 2XXPA 1EZ9A 3U93A 3TEPA 5AA2B 1SW4A 3H7MA 1MY3A 4FJPA 2XXIA 4GFRA 2NOOA 5M2VA 2VGQA 4OQOA 4O3CA 4FECA 2DWHA 3RT6B 4XKPA 5ICTA 3E4RA 3QAXA 1LFHA 1D4NA 4IO3A 2RF1A 3CR9A 3OENA 4QSEA 4PE5B 4EQ7A 4RXLA 5JTYB 1B6HA 3T9XB 1PC3A 1ZLQA 4KI0E 2DWAA 3UP9A 2H25A 1Y9UA 2OK2A 4F3BA 1LAXA 4XKNA 3ZKLA 1YAEA 3R26A 4DDDA 3T93B 4I8CA 1NH7A 4U2RA 5IAIA 2O1LA 3KN8A 2OZZA 2Z8FA 3G3HA 4F3SA 1WODA 1JVYA 1B9JA 1B05A 1P1WA 2ANJA 2DWJA 3KG2A 1URSA 3O6GA 4ZECA 1ZMGA 2H99A 2VP1A 5H8QA 3PUWE 2XHDA 1MH3A 2Z23A 3T22A 3W9WA 4KYDA 2YPNA 3IK6B 4U23A 5DEXA 1DTZA 3FJMA 3VVDA 1QVSA 5DYHA 1Q1KA 2UYFA 4OZ9A 3EHUA 1S9TA 1TXFA 1MQHA 2F8DA 1B5JA 5I58A 3A3UA 3V5AA 2Y84A 3K02A 3O2AA 1A8EA 2REGA 2RINA 2XXRA 1ZJLA 2QS1A 4F3GA 4YU0A 2F7AA 4LQ5A 4H1XA 4ZEIA 2B3FA 2QSXA 1OLAA 1MDP1 4RPNA 2XX8A 4R74A 5HM4B 5H8FB 5B7DA 3R6UA 5H8SA 4RNSA 2O7UA 5AA1A 3MZ1A 4C1TA 1B0LA 5F7VA 5CMCA 4MFIA 3KEIA 5K2YA 2HFBA 1B32A 2KLFA 1D3KA 1VFDA 1Y4TA 4U4SA 2PVUA 2H4IA 2XD3A 4KFQA 2DWIA 1B5IA 3B6WA 2HXWA 3Q29A 4NF5B 3HHGA 1MS7A 4OMBA 1SD3A 3N26A 5EHMA 2OWTA 4R2FA 4LVQA 1AOVA 1P1NA 4G68C 3IX1A 3HSTA 1MY0A 2XXYA 2Q2AA 3G3KA 3N5LA 3HO7A 4F18A 1YTVA 4G68A 1LSTA 2P0SA 4EF1A 1GR2A 4YZZA 4K3FA 2OLBA 4NMYA 4L17A 4ELPA 1TFAA 4ISUA 1IZ1A 3O6IA 3MJNA 4EXKA 1CB6A 2AL5A 3V89B 1I6BA 2X7QA 3SETA 4LP2B 3TFLA 4IGTA 4G8HA 3TQLA 4WEPA 1HSJA 5CM6A 3T66A 2HZLA 3SERA 3H6TA 1JW4A 1H3DA 4LA9A 3WAFA 3K0VA 5I57B 3U72A 3PPOA 4U21A 3IR1A 1LGBC 3KJTA 4WEDA 4NF4B 4NF6B 5ITPA 1I6AA 1XOCA 2XXTA 1MPBA 3G3GA 4FEDA 1IXHA 3O66A 2PT1A 3MAMA 1FQBA 4QFPA 1PB8A 5AA4B 4YMAA 2NWJA 1B3FA 5I56B 3V83A 4F31B 3MWBA 3VFJA 1B1HA 3KGCA 2HZKA 1QKAA 2DXRA 3DP6A 4ZZAA 2DVCA 2QL3A 2DQVA 3OXNA 1JQFA 2QMWA 3OSRA 2PMSA 4EUOA 3IJOB 3JYRA 1Q35A 4I9DA 2ZNTA 3VLUA 1SVXB 3MZBA 3MBPA 4HCWA 2O6AA 5FTIA 3TDJA 3FXUA 2Z8EA 4N13A 5H8NA 4LATA 4F3PA 4OEVA 4TOZA 1M5FA 1UTBA 4F1VA 1Y4CA 1XC1A 3I5OA 3N6TA 1O63A 3S4UA 3O6HA 1AH5A 1R1NA 4GOTA 1MG1A 2ZMBA 4G8MA 5I2KA 1ZBMA 1A40A 1FTJA 2XXUA 2I4BA 1NKXA 3OO9A 4AQ4A 4GXSB 3CG1A 1GVCA 3EHSA 1RYXA 3OO7A 2UXAA 4GD5A 3C34A 3Q28A 3LBSA 5B70A 2I4CA 5I84A 4ESWA 5J1DA 1LBBA 5I59B 3IO4A 4OETA 5KDTA 4RY1A 1SI0A 5KCJB 1P1OA 3PPRA 3QK6A 3O28A 1PDAA 2UVGA 4QRZA 5CMKA 3IJXB 3QUFA 2M8CA 3KN3A 4R75A 4EF2A 1UIUA 3VVFA 3P7IA 1IXGA 1B5HA 4ELRA 3IB2A 1PB7A 5EHSA 5DVIA 2F7BA 5F1QA 3CFLA 4IY6A 3IL1B 1LB8A 4EQBA 5CBRA 1EU8A 1TWYA 3BFTA 1B58A 3TELA 2DVZA 2Q9TA 3LSFB 1YCJA 3O29A 2Y7WA 1LAGE 1SW1A 1MH4A 3U1OA 3RT8A 4O3BA 4OHNA 2XXQA 2GHAA 1H44A 4MF3A 1M5EA 1TT1A 1B46A 3Q27A 2YLNA 5L9SA 2X7PA 5ELVA 1DOTA 4IGRA 4OFJA 2H9BA 4WKMA 4GQOA 1URGA 4TLLB 3QYTA 4OERA 1B4ZA 1LLSA 5KZTA 4YKJA 1N3WA 3BBRA 1R9LA 2A5SA 2ALUA 3CIJA 2F97A 3HCQA 1POTA 1LCFA 1QUJA 1B3GA 1N84A 4HW8A 1IITA 1FW0A 1QULA 3IB1A 3MP1A 4NEDA 5EYFA 4R72A 1Z7ME 2F5XA 4DE8A 4E0WA 1R6ZA 2ONKE 1MXWA 1B40A 4OFLA 5FTHA 5CRYA 5L9MA 4FEBA 5DVFA 2ABHA 3O97A 2Y7KA 4G4PA 2XD2A 5ICQA 1N3XA 3FJGA 1PB9A 5I2NA 4BDQA 3UGWA 4LUBA 4BDRA 1N04A 4OYVA 3IB0A 3VLVA 1S7YA 3EN3A 3IAZA 2OCUA 5BWJA 3H3GA 1HSLA 1URDA 3C4MA 2V3TA 1Y1ZA 2UVIA 2W7YA 4U4XA 4F39A 4YAHX 5TP9B 3SEWA 1AIVA 4F2OA 2E0SA 4WXJA 1ELJA 4F1UA 3HV1A 5ISUA 1WVJA 2GFEA 3ZS6A 1US4A 3TCFA 1SW5A 2ZYKA 2PBWA 2G29A 4P11A 5CI5A 2R6GE 3SKPA 4PETA 3PPNA 1MY4A 2RCAA 3G3IA 3KN7A 5CBSA 1LFIA 2CZLA 1A7LA 2VHAA 4C0RA 4EDPA 2XX7A 3EHTA 2XXVA 3PD9A 5ITOA 3VLWA 4KD5A 2B65A 1ZKBA 2FA7A 3MC2A 2UVHA 2V3UA 4LZ8A 3MPLA 4JSOA 1IQ7A 2HCAA 4F1YA 2Y7RA 4PFYA 2O7IA 4YB5A 4JB7A 1ANFA 2BJJX 4ZS9A 1FCKA 1MQDA 4GVOA 3KBRA 1IXCA 4QSCA 4F22A 3I6VA 3TKDA 2D5WA 3T9UA 1OVBA 5H8QB 4EXLA 3TZAA 3TTLA 2I0CA 4GIZA 2I3WA 3IOTA 4PFTA 4ONYA 3K6XA 4PQJA 1MPDA 2WKYA 3SESA 3N6UA 5DEXB 4U22A 3USDA 4LONB 2V25A 4NWDA 3HN0A 4OWDA 3PUVE 2QS4A 2IEEA 3OEMA 2OBGA 3TMGA 5I58B 3UK4A 4NF8A 3PU5A 4ND9A 5H8HA 4DLDA 1MXYA 1GV8A 1USYE 3C9HA 1D9YA 4Q0CA 3ZSFA 3RNNA 3GBAA 2F34A 3OO8A 1L5TA 3EF7A 1JVXA 2A5TA 2PT2A 1IEJA 2NXOA 3TUSA 2AL4A 1M5BA 4M1VA 3RTWB 4DCXA 2QRYA 4IB2A 1N7XA 3LC8A 3ONMA 2AYSA 5A5XB 4DIGA 2V84A 4OESA 1MDQA 3FV2A 1SI1A 2OWSA 1NH8A 5TPAB 5AE4A 1IUDA 2PX1A 4R6YA 4YKKA 2I3VA 1N76A 1UTHB 3MW0A 1ATGA 4JWOA 1UIVA 3UN6A 3H03A 3THIA 3LSLA 4X48A 4OEUA 1LCTA 3PGFA 4X9TA 1OQGA 3MZ9A 2O1MA 4RA1A 4BDOA 3MVWA 1DTGA 5K2XA 2UVJA 2O51A 1CE2A 3VVEA 4H8IA 4QFOA 1OQHA 3K1MA 1A54A 4NWCA 4MBPA 1Y3NA 2QPQA 2ZYOA 3C36A 4R2BA 4QFKA 4G68B 3RQTA 4C1UA 2RC7A 5DT6A 4OXVA 4Q5TA 1BIYA 1R9QA 2DYXA 4IY5A 1POY1 4ZEDA 2Z22A 4JXIA 4MLVA 3MQ9A 1MM7A 2XXXA 3CFXA 3M8UA 3MPKA 3AXFA 3K4UA 5DTBA 4IO7A 4KYEA 4KPTA 4FE8A 3ZKKA 1XVXA 1MRPA 1LBCA 1T0KA 4POWA 1SYIA 3SDFA 1FQEA 4Q30B 1RKMA 2DE3A 2FYIA 3E9XA 1DSNA 3H6UA 1UQWA 1H43A 3U8QA 2DSFA 3IOWA 5L9OA 1LAHE 4MLQA 3JZJA 5CMMA 4Z7EA 4OVJA 3JV9A 2H5YA 1MXUA 3TTMA 3W9VA 1ZU0A 4H65A 4IO4A 4IO6A 1BKAA 3K6UA 2GRVA 4F19A 4R6KA 3FVNA 3TYHA 1SQYA 3IO6A 3TQWA 5AA2A 2ZYMA 4R9GA 1B7HA 3VV5A 1I6QA 1S50A 3GLBA 1SW2A 3OD7A 3RN8A 1DPEA 2O69A 3S9LC 5FHMA 4HCYA 1NFTA 4DCYA 3G3JA 3Q25A 3FJ7A 4ZEBA 3KZGA 2Y7IA 4RPOA 4JWYA 5AA2D 3EPEA
chains in the Genus database with same CATH superfamily
2FV4B 4YB6A 3K1PA 2YRHA 3TCGA 2Y5KA 5JTYA 2NVUB 4P7DA 3OSQA 4J8ZA 3MP6A 2LBSB 4OFOA 4H5FA 2P2AA 3AUZA 2FGGA 2NUVA 2QS2A 3BBGA 3FD3A 2WX9A 1MQJA 3KSXA 4F2QA 1FTAA 3IFCA 3D4CA 4QF9A 4JYAE 3ADGA 3U92A 1VR5A 3M3LA 5DVJA 4AB6A 2D3IA 5FHOA 1JNFA 2UYEA 5H8NB 4R2CA 1AMFA 4YMBA 1QUIA 4H8JA 2F36A 3DJWA 2EMXA 3C32A 1UTBB 2EM6A 4DKKA 3E13X 4BDMA 2IA4A 1FTLA 4DR7E 2FHYA 3PV0E 2EMLA 3TTRA 3MHSC 2DOJA 1NUZA 4DI4B 4I8OA 3DELB 1XI6A 5I2KB 3TODA 4PDDA 1MY1A 4GL0A 3FATA 3IWCA 2YTJA 5HBCA 1IXIA 3DP4A 4WX9A 2VD2A 2XX9A 1MM6A 4MJOA 1B3EA 3FZVA 4TQUQ 5EQ7A 3CRBA 1O7TA 2JY9A 1JEUA 3CSBA 2VPOA 4OOGC 1A1HA 2DE4A 1GGGA 1EZPA 1QW0A 1LAFE 4XKRA 4BC9A 2R8TA 4PDHA 1HNZE 3OMBA 4ESXA 4YKIA 3T9VA 3T9HB 4FATA 3RPLB 4MHFA 3IOVA 2V83A 3PUXE 4HEIA 3EPJA 1H76A 2YJPA 3L6GA 4LF5E 2PCRA 3FGSA 1JW1A 1P1QA 4RK2A 2CMOA 1KWHA 1X49A 3FV1A 1BTJA 5KDTB 4B3SE 4FK5C 3UA8A 4M0VA 2GQ1A 1QGXA 1XNQE 3K6VA 2EOFA 1YZ9A 3UORA 2XWIA 4JV5E 3OEKA 1XMQE 4NZVA 3EQ1A 5EQ9A 2Q8UA 3ADIA 2F6GA 2QFLA 5CFFE 3HXLA 4DV0E 4LFCE 4PFBA 3J7AG 4R9FA 4XIGQ 1FPIA 4O24A 4BBYA 1YUIA 2NUGA 4GBWA 4OTEA 4KR5A 2H98A 1MXVA 5HPQA 3VXBA 3HPIA 1X6EA 3TTNA 4RK9A 4AB5A 1LB9A 5A2QC 3WAEA 4RJZA 4XKQA 1EZOA 4PFWA 4XXUA 1VSOA 4R6HA 5H8FA 4MH5A 2P3NA 2O84X 1N7WA 5FHNA 2HEUA 1B52A 4MMPA 4XEQA 2I58A 3UIFA 4FORA 3C33A 1SR9A 2I0BA 2HPGA 1RC7A 3BKIB 1ZR9A 2EORA 1BK4A 1MPCA 1B2HA 3KC1A 2FIXA 4GL8A 4OENA 5IWAE 3CI8A 1SYHA 2DMIA 2EM7A 2RKMA 4K0KE 4GWYA 4ZEFA 4RH8A 2VD3A 4H0WA 4DXCA 3H6WA 3ILTB 2L2NA 1RDXA 4FIMA 5IZ1A 3W15C 4JI6E 4F29A 3B7DA 1HSEA 4WSPA 3HFUA 2JP9A 2G7HA 1FPDA 2ESNA 2R76A 2DGCA 2L3CA 4DR3E 1T4OA 4KQPA 4NF5A 3K2DA 3B6QA 4DZ1A 3AV0A 3D4GA 3GBBA 4G8NA 5CC2A 3F11A 3KC0A 3K1NA 3U94A 2F7CA 2ONSA 2EZ6A 4QFNA 3OOAA 1GZ6A 1NNKA 4P0IA 3KSJA 1EH6A 2V86A 4R2QA 2P1SA 1NNPA 3MVYA 3SEXA 3QXMA 2RC9A 3ADLA 2YTQA 2F35A 4LFBE 3K01A 3PTYA 3RTFB 2ZZWA 1MQGA 5IZ3A 2B3BA 1DMBA 3FXQA 3ECRA 5IXMB 3J7Yp 3QSLA 4X04A 2RSMA 1PJTA 1IMAA 2LAOA 2D21A 1F2IG 2I48A 3E3KA 3PMVA 4H5GA 1B1XA 3I3VA 5ET8A 4ZEKA 2UUCE 4YY3E 4LF7E 4HS7A 3ZOQB 4DV6E 4H46A 4PP0A 4UABA 5I2NB 3CG3A 2HHMA 4I1DA 1VE4A 2ENHA 1MXXA 3A09A 3BIDA 1F9BA 2EWLA 2EOQA 2FNCA 3TAJA 2F78A 2ZZVA 5A5XA 3RPWA 1B3LA 1VFEA 2PYYA 3MVZA 4PFUA 3G3FA 2THIA 4WSGA 3HTXA 3KOSA 5TPAA 5AC5A 5I57A 1JK2A 2B7VA 2EOYA 1ZU1A 2XXWA 1ZTYA 4P56A 1IMDA 1OMPA 4NF4A 1UTHA 4NF6A 4X1DA 1EKZA 3CVGA 3FUZA 2EOHA 2EN7A 3FVKA 3FVOA 1MQIA 4YKPA 4IO2A 4PGPA 2EQ0A 4ELOA 4DR5E 4PF8A 1P99A 3TTKA 4LFAE 3H6VA 2GHBA 3OO6A 5IGAA 2XXHA 1BLFA 2ZNSA 1ZIUA 2R9JA 4KCCA 2HGHA 3V8XB 4DXBA 1FTMA 3PUZE 1Y3QA 4DUZE 2EJ4A 2EQ3A 2ONRA 5AA4A 2YTNA 1LFGA 5I56A 2Y7PA 1NV7A 1OIBA 2KR0A 1X47A 3MUQA 3FBPA 4JI0E 5JK4A 3T0JA 2RC8A 1A1KA 1A8FA 3LR1A 4N4RB 4ELQA 5IM2A 3T96B 3K6QA 1Y20A 3O9PA 4G2ZA 4LN5A 1XHYA 1YZ0A 1FQDA 2H36X 5I5PA 3SEUA 3LSXA 5JEIA 2F6PA 3KOTA 4U1OA 2XWKA 2LCEA 1PBPA 1DPPA 4JSDA 2DB2A 3H06B 1B3HA 3HHFA 4R03A 1QJMA 1TFDA 4H6DA 4MNCA 2EN4A 3H4ZA 1JK1A 4O8MA 2Q8JA 3VE1B 4IS1C 2ZZXA 4NE4A 2QS3A 1WDNA 3MVXA 1RDYA 5T3JA 3RYDA 1USYH 4I3EA 4R73A 1P1UA 2YZTA 3SEVA 4N07A 4H45A 2ZNUA 2JVAA 2HAVA 4M30A 3JTZA 4QSDA 1XMOE 3SZPA 5AA3A 5I7IA 1LBYA 3KJ7A 1EH3A 1FPLA 3LSWA 4POXA 2EMBA 4RYAA 3OMLA 2ELYA 4ZE9A 1NV6A 3C31A 2QVVA 4X1BA 5IKBA 4BLAA 3T1YE 1PJQA 1M5DA 2RCBA 2O68A 4LZ5A 1SBPA 4O5GA 4DI3D 4HE0A 4GXAA 3TCHA 3M3KA 1FQCA 3S2VA 4R2RA 1PJSA 2V3QA 2XWVA 4NTLA 3ODBA 5LL6R 5I59A 1GTKA 3QUJA 3TPAA 4FAJA 1OLCA 2HQ0A 2NUEA 2FIEA 3F6GA 3BIHA 1QU6A 4NF8B 3ILUB 3B6TA 5KCJA 2X26A 2QJEA 3IORA 5F24A 1XT8A 3FVGA 2R71A 3PPQA 2EMHA 5H8HB 1IIWA 1II5A 5IV8B 1UILA 4PCDA 3CSGA 4I40A 2LJHA 3ROJA 4N6DA 4GLIA 2Q88A 2EL5A 3FASA 4KXPA 2L92A 1UN6B 2F3DA 4OANA 4DV7E 3S9NC 1O64A 5ET5A 1XVYA 2A5TB 2DP8A 2E1SA 1N33E 1B4HA 2DS9A 2DE2A 4DR1E 4ZZEA 1EH7A 5L8DA 4MNIA 4YICA 1PBQA 5EQ8A 4Q8RA 4PF6A 2OJTA 3C6MA 2UXDE 2Q89A 4IR8A 1JP4A 4JWXA 3S9MC 1B0HA 3PMWA 1KZ8A 1RMDA 1XS5A 2AIXA 4ZYDA 1WJPA 3DLNA 3DM0A 4BC7A 3BFUA 4BDNA 2BBGA 2EQ1A 2EPPA 1Y1MA 3N94A 4R2DA 1FPKA 1FQAA 4THIA 3K00A 4EQ9A 4E0XA 3SEYA 2I6EA 4LZ7A 2VOZA 1FTKA 3M3FA 4N17A 1EYIA 1J26A 2GHFA 2HXRA 3DP8A 2Z8DA 2HAUA 1B7UA 1FKAE 4I62A 3RY3A 3Q26A 2Q74A 4LQ2A 1RYOA 3B50A 2MDGA 2JR1A 4H67A 4U1ZA 2I49A 4HXVA 4DV1E 4NGUA 4ZDMA 4FBPA 3IOUA 3RGYA 5EQAA 2WCC3 5CMBA 2JOBA 2VQEE 5LOMA 4MIJA 4ECFA 2NUFA 3PD8A 1Z7NE 3FXRA 1B7ZA 2GLIA 3CFZA 4KYSA 2E5LE 4GF8A 4P0GA 4QFLA 2V93A 3L6HA 2ZXTA 2JYAA 1PEBA 2M4IA 3FIRA 4TLMB 4ZE8A 2GPIA 1D9VA 4F6NA 4KHZE 3LLHA 1NNFA 3A3CA 3R7XA 1SDXA 1FTOA 1QUKA 2RSIA 1LBZA 1NNTA 1H45A 1MXZA 4IO5A 1A1FA 1J1NA 1US5A 3VDFA 1N0TA 2WBBA 3LUYA 1M5CA 1MY2A 3FIGA 3C35A 4X8RA 3MP8A 4BCAA 2DXYA 4GWOA 1CNQA 4JBZA 2YSOA 1A55A 1AL3A 1BP5A 1IMUA 2RPCA 4MNPA 2OX3A 4GRKA 4UA8A 2BB8A 4BDLA 2MKNA 1FQFA 3PUYE 4Z0IA 3S9EA 1YPNA 1JETA 4DXUA 4O3AA 4YB7A 2KOUA 4QHQA 3KFMA 5IZZA 3QG5C 1ZBQA 4MX6A 1IQSA 3RUMA 2G93A 5KL7A 1HR0E 2IHR1 3RLFE 4G77A 5TP9A 3GZGA 2M1SA 1QKBA 4KCDA 1I69A 1OVTA 1B51A 2XA5A 5TU0A 2QMXA 1Y3PA 3QIMA 1NMUA 3VXCA 4M4GA 4N6PA 2LTSA 1SPIA 4F9AB 1FPGA 3PMXA 2JWOA 3OELA 1JW5A 2REJA 3G7WA 4N4UA 3C4TA 4UACA 3K6WA 3PPPA 1JEVA 1J5EE 5BUUA 1NV2A 1A99A 1NL5A 4XTCQ 4JDFA 4HTGA 2ZYNA 2GH9A 2Q2CA 3IFAA 3GXAA 1BBOA 2XXPA 1EZ9A 3U93A 4R2PA 3TEPA 1XNRE 5AA2B 1SW4A 1T39A 3H7MA 1MY3A 4F2JC 4FJPA 2XXIA 1NV5A 4GFRA 3A29A 1TF3A 2NOOA 5M2VA 2VGQA 2KHXA 4DV3E 2CPNA 4OQOA 4O3CA 2EM9A 4FECA 2DWHA 3RT6B 4XKPA 5ICTA 5LDZA 3E4RA 3QAXA 2PRTA 2VT5A 4N8YA 1LFHA 1D4NA 4OVQA 4NXNE 4GWSA 4IO3A 2RF1A 4PC9A 2CSHA 2MDRA 2Y5LA 3CR9A 3OENA 4QSEA 4PE5B 4AS5A 1DQ3A 4EQ7A 4RXLA 1T38A 5JTYB 1N34E 2HC5A 1B6HA 3T9XB 2EPLX 1PC3A 1O0WA 1ZLQA 3IWDA 4KI0E 2DWAA 3UP9A 2H25A 1Y9UA 2OK2A 1N3GA 4F3BA 1IQOA 1LAXA 2QVRA 3EPLA 4XKNA 3ZKLA 1YAEA 3R26A 4DDDA 4I3YA 4LF9E 3T93B 2LT7A 4I8CA 1NH7A 1G2FC 4U2RA 5IAIA 2O1LA 3KN8A 2OZZA 1LEVA 2Z8FA 3G3HA 4F3SA 1WODA 1JVYA 1STUA 1B9JA 5A6AA 3BGHA 1B05A 1A1LA 1P1WA 2ANJA 2DWJA 1INPA 4BHBA 4X65E 3KG2A 2N3GA 1URSA 2L5VA 1FBHA 3O6GA 4ZECA 1ZMGA 2H99A 2VP1A 5H8QA 4ZYEA 3PUWE 1YSAC 2EM2A 4P1EA 2XHDA 1MH3A 4O7IA 2Z23A 3T22A 3W9WA 4KYDA 1B69A 2YPNA 4XF5A 3IK6B 4U23A 5DEXA 4OVRA 4AS4A 4DR6E 1DTZA 3FJMA 3VVDA 3J80C 1QVSA 3U65A 4JVIA 1SFEA 5DW8A 5DYHA 2F8BA 1A1JA 3MYUA 1Q1KA 2UYFA 4OZ9A 1FRPA 1NV1A 3EHUA 1S9TA 1TXFA 1MQHA 4BS9A 3FXBA 2F8DA 1B5JA 5I58A 3NOHA 3A3UA 4TUGA 3V5AA 2Y84A 3K02A 3O2AA 1HNXE 1A8EA 2REGA 2RINA 3IWBA 2MC5A 2XXRA 2EOIA 2EMIA 1YUJA 1ZJLA 2EMCA 4OVTA 2QS1A 2MKZA 4F3GA 4YU0A 2LVHA 2F7AA 4LQ5A 1K9ZA 2YTOA 2CEXA 4H1XA 4ZEIA 1RDZA 2B3FA 2QSXA 2DDKA 5AE2A 1OLAA 1MDP1 2WZOA 4XFEA 5KL4A 1DI2A 4M9VC 2YTGA 4RPNA 2XX8A 2N3HA 4R74A 5HM4B 1G2DC 5A6BA 4ZYGA 2EN2A 5H8FB 5B7DA 1FBDA 1TN9A 1WXRA 2VRDA 3R6UA 4KZSA 4GBVA 1X6FA 5H8SA 4RNSA 2O7UA 5AA1A 1RQ0A 1MEYC 1YYZA 3MZ1A 4C1TA 1B0LA 5F7VA 5CMCA 1G0IA 4MFIA 5ET6A 3KEIA 4PAKA 4DMIA 4B3TE 2EPKX 5K2YA 2HFBA 1YFHA 1B32A 2KLFA 1D3KA 1VFDA 1Y4TA 5KL3A 1N36E 4U4SA 4JI2E 2PVUA 5A6BD 2YWQA 2H4IA 2XD3A 4KFQA 5KL5A 1X5WA 2DWIA 1YYWA 1B5IA 3B6WA 2EM0A 2HXWA 3Q29A 4NF5B 2V89A 2EPOA 3HHGA 1MS7A 4OMBA 1SD3A 2VE7C 3N26A 5EHMA 2OWTA 4R2FA 4LVQA 1AOVA 1P1NA 4G68C 3IX1A 3HSTA 4NG7A 1MY0A 1UBDC 2XXYA 2Q2AA 3G3KA 2CZIA 3N5LA 2EOJA 3HO7A 3QMFA 1YTVA 4F18A 4G68A 1LSTA 2P0SA 4EF1A 1GR2A 4MEVA 3VYYA 4YZZA 4K3FA 2OLBA 2EL6A 4NMYA 2OWZA 4L17A 4ELPA 2B4MA 1TFAA 1IMCA 4ZYHA 5T6JA 4ISUA 5J16A 1IZ1A 3O6IA 4KHPE 3MJNA 4JI7E 4WXCA 2YU5A 2EN3A 4EXKA 2EPRA 1CB6A 2AL5A 2B3TB 3V89B 1I6BA 2X7QA 3SETA 4LP2B 3TFLA 4IGTA 4G8HA 3TQLA 3HPSA 1LBVA 1HSJA 4WEPA 5CM6A 4MAGA 3T66A 2HZLA 3SERA 3H6TA 1JW4A 1N32E 2EOOA 5LMUE 1FJGE 1H3DA 4N15A 4LA9A 4P3LA 3WAFA 3K0VA 5I57B 3U72A 3PPOA 4U21A 4DR4E 4N8GA 3IR1A 2EPXA 1LGBC 3KJTA 4WEDA 4NF4B 4NF6B 5ITPA 1I6AA 4F54A 1XOCA 2XXTA 1NUYA 1MPBA 3G3GA 4GX6A 4JVCA 4FEDA 1IXHA 2Q8MA 2KONA 4DV4E 2V88A 3O66A 4YHHE 3H09A 2PT1A 3MAMA 2EP3A 1FPEA 1FQBA 4QFPA 2M9AA 4R2AA 1PB8A 4O7MA 5AA4B 2LE2A 4PGNA 4YMAA 2NWJA 1B3FA 5I56B 1PKPA 5LTCA 3V83A 4F31B 1T4NA 3MWBA 3VFJA 1B1HA 2HHHE 3KGCA 2HZKA 2EOEA 1QKAA 2YT4A 2DXRA 4NQ8A 2VQFE 3DP6A 4ZZAA 2MKDA 2CT1A 2LTRA 2DVCA 2QL3A 4GKJE 2B9DA 2EMYA 2DQVA 3OXNA 1NUXA 1JQFA 2QMWA 3OSRA 2YTIA 4P78A 2PMSA 4EUOA 2V8QB 3IJOB 1KA1A 1IBME 3JYRA 1Q35A 4I9DA 2ZNTA 3VLUA 1SVXB 2WEFA 3MZBA 3BF2A 2EMKA 4F6MA 3EPKA 3MBPA 4HCWA 2O6AA 5TSEA 5FTIA 2I13A 1NCSA 4M2ZA 3TDJA 3FXUA 2Z8EA 4N13A 5H8NA 4LATA 4F3PA 4OEVA 4TOZA 1M5FA 1EYJA 1UTBA 2EE8A 4F1VA 2L8TA 1AWBA 1Y4CA 1XC1A 2WBUA 3KBZA 3I5OA 4RHBB 3N6TA 1O63A 3S4UA 3O6HA 1AH5A 1R1NA 2K4VA 4GOTA 1MG1A 2ZMBA 4G8MA 5I2KA 1ZBMA 1A40A 2YTDA 3C4BA 1NV4A 1FTJA 2XXUA 2I4BA 4NAPA 1NKXA 2JXPA 3OO9A 4AQ4A 4GXSB 3CG1A 1GVCA 5AE3A 3EHSA 2ADRA 3LUZA 1RYXA 3OO7A 2UXAA 4GD5A 3C34A 1YYOA 3Q28A 3LBSA 1L4SA 2BJIA 2ODRC 1FPBA 1IBKE 1FBFA 2I4CA 2P3VA 5B70A 5I84A 3RPLA 4ESWA 5J1DA 1FSAA 1LBBA 1NV3A 2M7QA 5I59B 2EPCA 3IO4A 4O94A 4OETA 5KDTA 2RS6A 3B8BA 4RY1A 4LF8E 1SI0A 5KCJB 1P1OA 3PPRA 3QK6A 3O28A 1I94E 2EOXA 1PDAA 2UVGA 4QRZA 1IMFA 5CMKA 3IJXB 3QUFA 2M8CA 3KN3A 4R75A 4EF2A 2EMWA 2YTFA 1UIUA 3P7IA 3VVFA 4B3RE 1IXGA 1NUWA 5ESYA 4PE3A 1B5HA 4ELRA 5ADZA 4Q28A 3IB2A 1KJKA 1PB7A 5EHSA 1FBCA 5DVIA 2F7BA 1BBGA 1DGCA 5F1QA 3CFLA 2ODRD 4IY6A 3IL1B 1LB8A 4EQBA 5CBRA 1EU8A 1TWYA 2N8XA 3BFTA 1B58A 3TELA 2DVZA 2Q9TA 3LSFB 1YCJA 3O29A 1FPFA 4P9KA 2Y7WA 2WBTA 5DNYA 4R8OA 2EMZA 1LAGE 1SW1A 4P1LA 1MH4A 3U1OA 2CEYA 3RT8A 3D1RA 2DMYA 4O3BA 4OHNA 2XXQA 3MSTA 1DCUA 2WBDA 2GHAA 4AQYE 1H44A 4MF3A 1M5EA 1TT1A 1B46A 3Q27A 2YLNA 3RMPA 5L9SA 1Z1BA 2X7PA 4PAIA 1FBPA 5ELVA 4F9BB 2YTPA 2UXCE 1DOTA 4IGRA 4OFJA 5LLQA 2H9BA 4WKMA 4GQOA 1URGA 2JPAA 2KQZA 4TLLB 3QYTA 3JU0A 3LV0A 4OERA 1B4ZA 1LLSA 5KZTA 1FJ6A 4YKJA 1N3WA 4JI1E 3BBRA 4NXME 1R9LA 2A5SA 4GEQB 2ALUA 2MC6A 3CIJA 4Q35B 2F97A 1WHQA 3HCQA 2EMAA 1POTA 1LCFA 1QUJA 2YSPA 5F3WA 2HJJA 1N84A 2XXKA 4HW8A 1IITA 2YU8A 1FW0A 4N91A 1QULA 3IB1A 3MP1A 2E72A 2ENAA 4NEDA 2EM5A 5EYFA 4R72A 1Z7ME 2F5XA 4DE8A 2LUPB 4E0WA 2EPAA 3BIGA 1R6ZA 4WYQB 2RQLA 2ONKE 2DSYA 1MXWA 1B40A 2R1FA 2L2MA 4OFLA 5FTHA 2ELZA 5AC4A 5CRYA 5L9MA 4FEBA 5DVFA 1FBGA 4HE2A 2ABHA 4WFTA 3O97A 2Y7KA 1UHZA 3HPZA 4G4PA 2XD2A 5ICQA 1N3XA 3FJGA 4GZNC 1PB9A 5I2NA 4BDQA 4PTKA 1EH8A 1A1GA 3UGWA 4LUBA 4BDRA 1N04A 4OYVA 3IB0A 3VLVA 4JI8E 4X8WA 1S7YA 4BHCA 3EPEA 3EN3A 2LUQA 3IAZA 2OCUA 3E78A 5BWJA 5EYHA 3H3GA 1HSLA 1URDA 3C4MA 2V3TA 2V85A 1Y1ZA 2UVIA 2W7YA 5FLXC 4U4XA 4F39A 1G0HA 1LBWA 1FPJA 4YAHX 5TP9B 4F9CB 3SEWA 1AIVA 2FBPA 4F2OA 2E0SA 4WXJA 1ELJA 1A1IA 4GWWA 3HV1A 4F1UA 5ISUA 4NF0A 1WVJA 2YTEA 4MCOA 4WPYA 1IMBA 3M99B 2GFEA 3ZS6A 1US4A 5AASA 2EPNA 1LBXA 3TCFA 2L3JA 1SW5A 2ZYKA 2PBWA 2XWOA 2EN8A 4HE1A 2G29A 4P11A 2EOZA 2FTXB 4BMJA 3L00A 4GWZA 5CI5A 2QVUA 2R6GE 3SKPA 4PETA 2EOMA 3PPNA 1MGTA 1MY4A 5IT9C 1X6HA 3VYXA 2RCAA 3G3IA 3KN7A 5CBSA 4DV5E 1LFIA 2CZLA 4IJDA 2A25A 1FBEA 1A7LA 2VHAA 4C0RA 4EDPA 5BR8E 2XX7A 3EHTA 4DV2E 2XXVA 3PD9A 5ITOA 2RTXA 3VLWA 4X66E 4KD5A 2B65A 4O4KA 1T4LB 1ZKBA 2FA7A 3MC2A 1X48A 1BB8A 2UVHA 2DRPA 2V3UA 4GWXA 2RS7A 4LZ8A 2UUAE 3MPLA 3OTOE 4PBHA 1NV0A 4PAFA 4JSOA 4L5NC 4NHBA 2L2KB 5AE1A 1IQ7A 2HCAA 4F1YA 2VPNA 3VHTB 4LF6E 4DUYE 1ZBTA 2Y7RA 4PFYA 2O7IA 4YB5A 4JB7A 1ANFA 2BJJX 2V4CA 2LRSA 1FCKA 4ZS9A 4R2SA 2PFZA 1MQDA 3E79A 3KBRA 4GVOA 2DLQA 3DF6A 1IXCA 4X62E 4QSCA 1Q9DA 4OVPA 4F22A 3I6VA 4P47A 2DLKA 4KWYA 3P1XA 3TKDA 2LO3A 2D5WA 2FVZA 3T9UA 1OVBA 5H8QB 4EXLA 3TZAA 3TTLA 2I0CA 4GIZA 2EPMX 2I3WA 3IOTA 1QNTA 4PFTA 3MHHC 4ONYA 2EPZA 3K6XA 4PQJA 1MPDA 2WKYA 3SESA 1FJ9A 4GX3A 3N6UA 5DEXB 1GQEA 2L6MA 4U22A 1TF6A 3USDA 3THOB 4LONB 2V25A 3ADJA 4NWDA 3HN0A 4OWDA 3PUVE 2QS4A 2IEEA 3OEMA 2OBGA 2VF1A 1P47A 3TMGA 5I58B 4NHRA 3UK4A 3T1HE 4NF8A 1IBLE 2JJKA 5IZ3B 1D9QA 3PU5A 2UUBE 4X64E 1HNWE 5LMNE 4ND9A 5H8HA 2L33A 3MSWA 2EN6A 4DLDA 1MXYA 1GV8A 1USYE 3C9HA 4PFIA 4O43A 1D9YA 4Q0CA 1LLMC 3ZSFA 3RNNA 5KL2A 5A6KA 3GBAA 2YRMA 2F34A 3OO8A 3C6KA 1L5TA 3EF7A 2V87A 3VK6A 1JVXA 2A5TA 3CHGA 2PT2A 2ENCA 1IEJA 1X3CA 2PFYA 2NXOA 2B4LA 5KL6A 3TUSA 2AL4A 1M5BA 4M1VA 3RTWB 4DCXA 2QRYA 3HQ1A 4IB2A 1N7XA 2ZM6E 3LC8A 3ONMA 5ET7A 3EKIA 5I3SA 2AYSA 5A5XB 4LF4E 4DIGA 2V84A 2EOSA 4OESA 1MDQA 2WYKA 3GYYA 4G61A 3FV2A 1SI1A 2OWSA 3ISPA 2J7JA 1NH8A 5TPAB 5FBPA 3EPHA 5AE4A 1IUDA 2PX1A 4R6YA 4YKKA 2E1MA 2EMFA 2CZKA 2I3VA 1N76A 1IMEA 4PBQA 2WBSA 1UTHB 3MW0A 1ATGA 4JWOA 1UIVA 4N81A 3UN6A 3H03A 3THIA 2EM3A 3LSLA 1DK4A 4X48A 4OEUA 1LCTA 2NA2A 3PGFA 4X9TA 1OQGA 3MZ9A 2O1MA 4RA1A 4LTYA 2B7TA 3KZZA 4BDOA 2EL4A 3MVWA 4OX9E 1DTGA 5K2XA 2CZHA 5EYGA 3TQMA 2UVJA 2O51A 3LMLA 1CE2A 3VVEA 4H8IA 3KZYA 2K7IA 3J81C 2YRKA 1KA0A 4QFOA 4GX4A 1OQHA 1VDWA 3K1MA 1A54A 4NWCA 4MBPA 1Y3NA 2QPQA 4JI4E 2ZYOA 1NEIA 1AAYA 3C36A 4R2BA 1KYQA 4QFKA 4G68B 1YXIA 3F6HA 3RQTA 4C1UA 2RC7A 5DT6A 4OXVA 4Q5TA 3T1BA 1BIYA 1R9QA 2DYXA 4IY5A 1WRJA 2I9IA 2F3BA 1POY1 4ZEDA 2Z22A 2LV2A 2EMGA 4JXIA 4MLVA 3MQ9A 1MM7A 4TUIA 4DR2E 2XXXA 4N6KA 4X9JA 3CFXA 3M8UA 3MPKA 4OA4A 3AXFA 3K4UA 5DTBA 4IO7A 4KYEA 4KPTA 4FE8A 2EM8A 3ZKKA 3THNA 1DBZA 4WXDA 4QXDA 4GKKE 1XVXA 1MRPA 2EM4A 2D9HA 1LBCA 1EYKA 1T0KA 4POWA 1SYIA 3SDFA 1FQEA 4Q30B 1RKMA 2WYPA 2DE3A 3KWRA 2FYIA 3E9XA 1DSNA 4P8BA 3H6UA 1UQWA 5A69A 1H43A 3U8QA 2DSFA 2EN1A 4JI3E 3IOWA 2DIXA 5A6JA 5A5LA 4LU9A 2NABA 1K9YA 5L9OA 1LAHE 4R2EA 4MLQA 3JZJA 5CMMA 4Z7EA 4OVJA 3JV9A 2H5YA 1MXUA 2EPUA 3TTMA 3W9VA 2UU9E 1ZU0A 4H65A 4QBAA 4IO4A 4IO6A 1BKAA 3K6UA 2GRVA 4F19A 4R6KA 3FVNA 3TYHA 1SQYA 3IO6A 1NI9A 3TQWA 5AA2A 4B3ME 2UXBE 2ZYMA 4R9GA 1B7HA 3VV5A 1I6QA 1YYKA 1S50A 3GLBA 1WHNA 1SW2A 3OD7A 3RN8A 1DPEA 2F4VE 3JAMC 1ZAAC 3UK3C 4NX1A 2LMZA 4JVDA 4JI5E 2CTDA 2O69A 3S9LC 5FHMA 4HCYA 1NFTA 4PFRA 4L8NA 4DCYA 3G3JA 3Q25A 3FJ7A 2JOXA 2LJUA 3KZGA 4ZEBA 2Y7IA 4NN3A 4RPOA 4OVSA 4GWUA 4JWYA 5AA2D 1B3GA
chains in the Genus database with same CATH topology
4YB6A 3K1PA 3TCGA 5JTYA 2NVUB 3OSQA 3MP6A 4OFOA 4H5FA 2P2AA 2NUVA 2QS2A 3FD3A 1MQJA 3KSXA 4F2QA 3D4CA 4QF9A 3U92A 1VR5A 3M3LA 5DVJA 4AB6A 2D3IA 5FHOA 1JNFA 2UYEA 5H8NB 1AMFA 4YMBA 1QUIA 4H8JA 2F36A 3C32A 1UTBB 3E13X 4BDMA 2IA4A 1FTLA 3PV0E 3TTRA 2DOJA 3DELB 5I2KB 3TODA 1MY1A 4GL0A 3FATA 5HBCA 1IXIA 3DP4A 2VD2A 2XX9A 1MM6A 1B3EA 3FZVA 4TQUQ 3CRBA 1O7TA 1JEUA 3CSBA 2DE4A 1GGGA 1EZPA 1QW0A 1LAFE 4XKRA 3OMBA 4ESXA 4YKIA 3T9VA 3T9HB 4FATA 3IOVA 3PUXE 1H76A 2YJPA 3L6GA 3FGSA 1JW1A 1P1QA 4RK2A 2CMOA 1KWHA 3FV1A 1BTJA 5KDTB 3UA8A 3K6VA 3UORA 3OEKA 3EQ1A 2F6GA 4R9FA 4XIGQ 4OTEA 4KR5A 2H98A 1MXVA 5HPQA 3VXBA 3HPIA 3TTNA 4AB5A 4RK9A 1LB9A 3WAEA 4RJZA 4XKQA 1EZOA 4PFWA 4XXUA 1VSOA 4R6HA 5H8FA 4MH5A 2O84X 1N7WA 5FHNA 2HEUA 1B52A 2I58A 3UIFA 4FORA 3C33A 2I0BA 3BKIB 1MPCA 1B2HA 4GL8A 4OENA 3CI8A 1SYHA 2RKMA 4ZEFA 2VD3A 4H0WA 4DXCA 3H6WA 3ILTB 4FIMA 3W15C 4F29A 3B7DA 1HSEA 2ESNA 4KQPA 4NF5A 3K2DA 3B6QA 4DZ1A 3D4GA 3GBBA 4G8NA 5CC2A 3F11A 3K1NA 3U94A 2F7CA 2ONSA 4QFNA 3OOAA 1NNKA 4P0IA 3KSJA 2P1SA 1NNPA 3SEXA 3MVYA 3QXMA 2RC9A 2F35A 3K01A 3RTFB 1MQGA 2B3BA 1DMBA 3FXQA 3ECRA 3QSLA 2LAOA 2D21A 2I48A 3E3KA 3PMVA 4H5GA 1B1XA 3I3VA 4ZEKA 4HS7A 4PP0A 5I2NB 3CG3A 4I1DA 1VE4A 1MXXA 3A09A 1F9BA 2FNCA 3TAJA 2F78A 5A5XA 3RPWA 1B3LA 1VFEA 2PYYA 3MVZA 4PFUA 3G3FA 2THIA 3KOSA 5TPAA 5I57A 2XXWA 1ZTYA 1OMPA 4NF4A 1UTHA 4NF6A 4X1DA 3CVGA 3FUZA 3FVKA 3FVOA 1MQIA 4YKPA 4IO2A 4ELOA 1P99A 3TTKA 3H6VA 2GHBA 3OO6A 2XXHA 1BLFA 2ZNSA 1ZIUA 2R9JA 4KCCA 3V8XB 4DXBA 1FTMA 3PUZE 1Y3QA 2ONRA 5AA4A 1LFGA 5I56A 2Y7PA 1OIBA 3MUQA 5JK4A 2RC8A 1A8FA 3LR1A 4ELQA 3T96B 1Y20A 3O9PA 4G2ZA 1XHYA 1FQDA 3SEUA 3LSXA 5JEIA 2F6PA 3KOTA 4U1OA 1PBPA 1DPPA 4JSDA 3H06B 1B3HA 3HHFA 1QJMA 1TFDA 4H6DA 3H4ZA 2Q8JA 3VE1B 4NE4A 2QS3A 1WDNA 3MVXA 1USYH 4R73A 1P1UA 3SEVA 4N07A 2ZNUA 2HAVA 4QSDA 5AA3A 3KJ7A 1EH3A 3LSWA 4POXA 4RYAA 4ZE9A 3C31A 4X1BA 5IKBA 4BLAA 1M5DA 2RCBA 2O68A 4LZ5A 1SBPA 4GXAA 3TCHA 3M3KA 1FQCA 3S2VA 2V3QA 4NTLA 3ODBA 5I59A 1GTKA 3QUJA 3TPAA 4FAJA 1OLCA 2HQ0A 4NF8B 3ILUB 3B6TA 5KCJA 2X26A 2QJEA 3IORA 1XT8A 3FVGA 2R71A 3PPQA 5H8HB 1IIWA 1II5A 3CSGA 4GLIA 2Q88A 3FASA 3S9NC 1O64A 1XVYA 2A5TB 2DP8A 2E1SA 1B4HA 2DS9A 2DE2A 4ZZEA 5L8DA 4YICA 1PBQA 4Q8RA 2OJTA 2Q89A 4JWXA 3S9MC 1B0HA 3PMWA 1XS5A 2AIXA 3DLNA 3DM0A 3BFUA 4BDNA 1Y1MA 3N94A 1FQAA 4THIA 3K00A 4EQ9A 4E0XA 3SEYA 2I6EA 4LZ7A 2VOZA 1FTKA 3M3FA 3DP8A 2Z8DA 2HAUA 1B7UA 4I62A 3RY3A 3Q26A 4LQ2A 1RYOA 4U1ZA 4H67A 2I49A 4ZDMA 3IOUA 3RGYA 5CMBA 5LOMA 4ECFA 3PD8A 1Z7NE 3FXRA 1B7ZA 3CFZA 4KYSA 4GF8A 4P0GA 4QFLA 2V93A 3L6HA 2ZXTA 1PEBA 3FIRA 4TLMB 4ZE8A 1D9VA 4KHZE 1NNFA 3A3CA 3R7XA 1SDXA 1FTOA 1QUKA 1NNTA 1H45A 1MXZA 4IO5A 1J1NA 1US5A 3VDFA 1N0TA 3LUYA 1M5CA 1MY2A 3C35A 3MP8A 2DXYA 4GWOA 4JBZA 1A55A 1AL3A 1BP5A 4GRKA 4UA8A 4BDLA 1FQFA 3PUYE 4Z0IA 3S9EA 1YPNA 1JETA 4DXUA 4O3AA 4YB7A 4QHQA 3KFMA 3RUMA 2G93A 3RLFE 4G77A 5TP9A 3GZGA 1QKBA 4KCDA 1I69A 1OVTA 1B51A 5TU0A 2QMXA 1Y3PA 3QIMA 1NMUA 3VXCA 4M4GA 4N6PA 3PMXA 3OELA 1JW5A 2REJA 3G7WA 4UACA 3K6WA 3PPPA 1JEVA 5BUUA 1A99A 1NL5A 4XTCQ 4JDFA 4HTGA 2ZYNA 2GH9A 2Q2CA 3GXAA 2XXPA 1EZ9A 3U93A 3TEPA 5AA2B 1SW4A 3H7MA 1MY3A 4FJPA 2XXIA 4GFRA 2NOOA 5M2VA 2VGQA 4OQOA 4O3CA 4FECA 2DWHA 3RT6B 4XKPA 5ICTA 3E4RA 3QAXA 1LFHA 1D4NA 4IO3A 2RF1A 3CR9A 3OENA 4QSEA 4PE5B 4EQ7A 4RXLA 5JTYB 1B6HA 3T9XB 1PC3A 1ZLQA 4KI0E 2DWAA 3UP9A 2H25A 1Y9UA 2OK2A 4F3BA 1LAXA 4XKNA 3ZKLA 1YAEA 3R26A 4DDDA 3T93B 4I8CA 1NH7A 4U2RA 5IAIA 2O1LA 3KN8A 2OZZA 2Z8FA 3G3HA 4F3SA 1WODA 1JVYA 1B9JA 1B05A 1P1WA 2ANJA 2DWJA 3KG2A 1URSA 3O6GA 4ZECA 1ZMGA 2H99A 2VP1A 5H8QA 3PUWE 2XHDA 1MH3A 2Z23A 3T22A 3W9WA 4KYDA 2YPNA 3IK6B 4U23A 5DEXA 1DTZA 3FJMA 3VVDA 1QVSA 5DYHA 1Q1KA 2UYFA 4OZ9A 3EHUA 1S9TA 1TXFA 1MQHA 2F8DA 1B5JA 5I58A 3A3UA 3V5AA 2Y84A 3K02A 3O2AA 1A8EA 2REGA 2RINA 2XXRA 1ZJLA 2QS1A 4F3GA 4YU0A 2F7AA 4LQ5A 4H1XA 4ZEIA 2B3FA 2QSXA 1OLAA 1MDP1 4RPNA 2XX8A 4R74A 5HM4B 5H8FB 5B7DA 3R6UA 5H8SA 4RNSA 2O7UA 5AA1A 3MZ1A 4C1TA 1B0LA 5F7VA 5CMCA 4MFIA 3KEIA 5K2YA 2HFBA 1B32A 2KLFA 1D3KA 1VFDA 1Y4TA 4U4SA 2PVUA 2H4IA 2XD3A 4KFQA 2DWIA 1B5IA 3B6WA 2HXWA 3Q29A 4NF5B 3HHGA 1MS7A 4OMBA 1SD3A 3N26A 5EHMA 2OWTA 4R2FA 4LVQA 1AOVA 1P1NA 4G68C 3IX1A 3HSTA 1MY0A 2XXYA 2Q2AA 3G3KA 3N5LA 3HO7A 4F18A 1YTVA 4G68A 1LSTA 2P0SA 4EF1A 1GR2A 4YZZA 4K3FA 2OLBA 4NMYA 4L17A 4ELPA 1TFAA 4ISUA 1IZ1A 3O6IA 3MJNA 4EXKA 1CB6A 2AL5A 3V89B 1I6BA 2X7QA 3SETA 4LP2B 3TFLA 4IGTA 4G8HA 3TQLA 4WEPA 1HSJA 5CM6A 3T66A 2HZLA 3SERA 3H6TA 1JW4A 1H3DA 4LA9A 3WAFA 3K0VA 5I57B 3U72A 3PPOA 4U21A 3IR1A 1LGBC 3KJTA 4WEDA 4NF4B 4NF6B 5ITPA 1I6AA 1XOCA 2XXTA 1MPBA 3G3GA 4FEDA 1IXHA 3O66A 2PT1A 3MAMA 1FQBA 4QFPA 1PB8A 5AA4B 4YMAA 2NWJA 1B3FA 5I56B 3V83A 4F31B 3MWBA 3VFJA 1B1HA 3KGCA 2HZKA 1QKAA 2DXRA 3DP6A 4ZZAA 2DVCA 2QL3A 2DQVA 3OXNA 1JQFA 2QMWA 3OSRA 2PMSA 4EUOA 3IJOB 3JYRA 1Q35A 4I9DA 2ZNTA 3VLUA 1SVXB 3MZBA 3MBPA 4HCWA 2O6AA 5FTIA 3TDJA 3FXUA 2Z8EA 4N13A 5H8NA 4LATA 4F3PA 4OEVA 4TOZA 1M5FA 1UTBA 4F1VA 1Y4CA 1XC1A 3I5OA 3N6TA 1O63A 3S4UA 3O6HA 1AH5A 1R1NA 4GOTA 1MG1A 2ZMBA 4G8MA 5I2KA 1ZBMA 1A40A 1FTJA 2XXUA 2I4BA 1NKXA 3OO9A 4AQ4A 4GXSB 3CG1A 1GVCA 3EHSA 1RYXA 3OO7A 2UXAA 4GD5A 3C34A 3Q28A 3LBSA 5B70A 2I4CA 5I84A 4ESWA 5J1DA 1LBBA 5I59B 3IO4A 4OETA 5KDTA 4RY1A 1SI0A 5KCJB 1P1OA 3PPRA 3QK6A 3O28A 1PDAA 2UVGA 4QRZA 5CMKA 3IJXB 3QUFA 2M8CA 3KN3A 4R75A 4EF2A 1UIUA 3VVFA 3P7IA 1IXGA 1B5HA 4ELRA 3IB2A 1PB7A 5EHSA 5DVIA 2F7BA 5F1QA 3CFLA 4IY6A 3IL1B 1LB8A 4EQBA 5CBRA 1EU8A 1TWYA 3BFTA 1B58A 3TELA 2DVZA 2Q9TA 3LSFB 1YCJA 3O29A 2Y7WA 1LAGE 1SW1A 1MH4A 3U1OA 3RT8A 4O3BA 4OHNA 2XXQA 2GHAA 1H44A 4MF3A 1M5EA 1TT1A 1B46A 3Q27A 2YLNA 5L9SA 2X7PA 5ELVA 1DOTA 4IGRA 4OFJA 2H9BA 4WKMA 4GQOA 1URGA 4TLLB 3QYTA 4OERA 1B4ZA 1LLSA 5KZTA 4YKJA 1N3WA 3BBRA 1R9LA 2A5SA 2ALUA 3CIJA 2F97A 3HCQA 1POTA 1LCFA 1QUJA 1B3GA 1N84A 4HW8A 1IITA 1FW0A 1QULA 3IB1A 3MP1A 4NEDA 5EYFA 4R72A 1Z7ME 2F5XA 4DE8A 4E0WA 1R6ZA 2ONKE 1MXWA 1B40A 4OFLA 5FTHA 5CRYA 5L9MA 4FEBA 5DVFA 2ABHA 3O97A 2Y7KA 4G4PA 2XD2A 5ICQA 1N3XA 3FJGA 1PB9A 5I2NA 4BDQA 3UGWA 4LUBA 4BDRA 1N04A 4OYVA 3IB0A 3VLVA 1S7YA 3EN3A 3IAZA 2OCUA 5BWJA 3H3GA 1HSLA 1URDA 3C4MA 2V3TA 1Y1ZA 2UVIA 2W7YA 4U4XA 4F39A 4YAHX 5TP9B 3SEWA 1AIVA 4F2OA 2E0SA 4WXJA 1ELJA 4F1UA 3HV1A 5ISUA 1WVJA 2GFEA 3ZS6A 1US4A 3TCFA 1SW5A 2ZYKA 2PBWA 2G29A 4P11A 5CI5A 2R6GE 3SKPA 4PETA 3PPNA 1MY4A 2RCAA 3G3IA 3KN7A 5CBSA 1LFIA 2CZLA 1A7LA 2VHAA 4C0RA 4EDPA 2XX7A 3EHTA 2XXVA 3PD9A 5ITOA 3VLWA 4KD5A 2B65A 1ZKBA 2FA7A 3MC2A 2UVHA 2V3UA 4LZ8A 3MPLA 4JSOA 1IQ7A 2HCAA 4F1YA 2Y7RA 4PFYA 2O7IA 4YB5A 4JB7A 1ANFA 2BJJX 4ZS9A 1FCKA 1MQDA 4GVOA 3KBRA 1IXCA 4QSCA 4F22A 3I6VA 3TKDA 2D5WA 3T9UA 1OVBA 5H8QB 4EXLA 3TZAA 3TTLA 2I0CA 4GIZA 2I3WA 3IOTA 4PFTA 4ONYA 3K6XA 4PQJA 1MPDA 2WKYA 3SESA 3N6UA 5DEXB 4U22A 3USDA 4LONB 2V25A 4NWDA 3HN0A 4OWDA 3PUVE 2QS4A 2IEEA 3OEMA 2OBGA 3TMGA 5I58B 3UK4A 4NF8A 3PU5A 4ND9A 5H8HA 4DLDA 1MXYA 1GV8A 1USYE 3C9HA 1D9YA 4Q0CA 3ZSFA 3RNNA 3GBAA 2F34A 3OO8A 1L5TA 3EF7A 1JVXA 2A5TA 2PT2A 1IEJA 2NXOA 3TUSA 2AL4A 1M5BA 4M1VA 3RTWB 4DCXA 2QRYA 4IB2A 1N7XA 3LC8A 3ONMA 2AYSA 5A5XB 4DIGA 2V84A 4OESA 1MDQA 3FV2A 1SI1A 2OWSA 1NH8A 5TPAB 5AE4A 1IUDA 2PX1A 4R6YA 4YKKA 2I3VA 1N76A 1UTHB 3MW0A 1ATGA 4JWOA 1UIVA 3UN6A 3H03A 3THIA 3LSLA 4X48A 4OEUA 1LCTA 3PGFA 4X9TA 1OQGA 3MZ9A 2O1MA 4RA1A 4BDOA 3MVWA 1DTGA 5K2XA 2UVJA 2O51A 1CE2A 3VVEA 4H8IA 4QFOA 1OQHA 3K1MA 1A54A 4NWCA 4MBPA 1Y3NA 2QPQA 2ZYOA 3C36A 4R2BA 4QFKA 4G68B 3RQTA 4C1UA 2RC7A 5DT6A 4OXVA 4Q5TA 1BIYA 1R9QA 2DYXA 4IY5A 1POY1 4ZEDA 2Z22A 4JXIA 4MLVA 3MQ9A 1MM7A 2XXXA 3CFXA 3M8UA 3MPKA 3AXFA 3K4UA 5DTBA 4IO7A 4KYEA 4KPTA 4FE8A 3ZKKA 1XVXA 1MRPA 1LBCA 1T0KA 4POWA 1SYIA 3SDFA 1FQEA 4Q30B 1RKMA 2DE3A 2FYIA 3E9XA 1DSNA 3H6UA 1UQWA 1H43A 3U8QA 2DSFA 3IOWA 5L9OA 1LAHE 4MLQA 3JZJA 5CMMA 4Z7EA 4OVJA 3JV9A 2H5YA 1MXUA 3TTMA 3W9VA 1ZU0A 4H65A 4IO4A 4IO6A 1BKAA 3K6UA 2GRVA 4F19A 4R6KA 3FVNA 3TYHA 1SQYA 3IO6A 3TQWA 5AA2A 2ZYMA 4R9GA 1B7HA 3VV5A 1I6QA 1S50A 3GLBA 1SW2A 3OD7A 3RN8A 1DPEA 2O69A 3S9LC 5FHMA 4HCYA 1NFTA 4DCYA 3G3JA 3Q25A 3FJ7A 4ZEBA 3KZGA 2Y7IA 4RPOA 4JWYA 5AA2D 3EPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YB6 A;  3K1P A;  3TCG A;  5JTY A;  2NVU B;  3OSQ A;  3MP6 A;  4OFO A;  4H5F A;  2P2A A;  2NUV A;  2QS2 A;  3FD3 A;  1MQJ A;  3KSX A;  4F2Q A;  3D4C A;  4QF9 A;  3U92 A;  1VR5 A;  3M3L A;  5DVJ A;  4AB6 A;  2D3I A;  5FHO A;  1JNF A;  2UYE A;  5H8N B;  1AMF A;  4YMB A;  1QUI A;  4H8J A;  2F36 A;  3C32 A;  1UTB B;  3E13 X;  4BDM A;  2IA4 A;  1FTL A;  3PV0 E;  3TTR A;  2DOJ A;  3DEL B;  5I2K B;  3TOD A;  1MY1 A;  4GL0 A;  3FAT A;  5HBC A;  1IXI A;  3DP4 A;  2VD2 A;  2XX9 A;  1MM6 A;  1B3E A;  3FZV A;  4TQU Q;  3CRB A;  1O7T A;  1JEU A;  3CSB A;  2DE4 A;  1GGG A;  1EZP A;  1QW0 A;  1LAF E;  4XKR A;  3OMB A;  4ESX A;  4YKI A;  3T9V A;  3T9H B;  4FAT A;  3IOV A;  3PUX E;  1H76 A;  2YJP A;  3L6G A;  3FGS A;  1JW1 A;  1P1Q A;  4RK2 A;  2CMO A;  1KWH A;  3FV1 A;  1BTJ A;  5KDT B;  3UA8 A;  3K6V A;  3UOR A;  3OEK A;  3EQ1 A;  2F6G A;  4R9F A;  4XIG Q;  4OTE A;  4KR5 A;  2H98 A;  1MXV A;  5HPQ A;  3VXB A;  3HPI A;  3TTN A;  4AB5 A;  4RK9 A;  1LB9 A;  3WAE A;  4RJZ A;  4XKQ A;  1EZO A;  4PFW A;  4XXU A;  1VSO A;  4R6H A;  5H8F A;  4MH5 A;  2O84 X;  1N7W A;  5FHN A;  2HEU A;  1B52 A;  2I58 A;  3UIF A;  4FOR A;  3C33 A;  2I0B A;  3BKI B;  1MPC A;  1B2H A;  4GL8 A;  4OEN A;  3CI8 A;  1SYH A;  2RKM A;  4ZEF A;  2VD3 A;  4H0W A;  4DXC A;  3H6W A;  3ILT B;  4FIM A;  3W15 C;  4F29 A;  3B7D A;  1HSE A;  2ESN A;  4KQP A;  4NF5 A;  3K2D A;  3B6Q A;  4DZ1 A;  3D4G A;  3GBB A;  4G8N A;  5CC2 A;  3F11 A;  3K1N A;  3U94 A;  2F7C A;  2ONS A;  4QFN A;  3OOA A;  1NNK A;  4P0I A;  3KSJ A;  2P1S A;  1NNP A;  3SEX A;  3MVY A;  3QXM A;  2RC9 A;  2F35 A;  3K01 A;  3RTF B;  1MQG A;  2B3B A;  1DMB A;  3FXQ A;  3ECR A;  3QSL A;  2LAO A;  2D21 A;  2I48 A;  3E3K A;  3PMV A;  4H5G A;  1B1X A;  3I3V A;  4ZEK A;  4HS7 A;  4PP0 A;  5I2N B;  3CG3 A;  4I1D A;  1VE4 A;  1MXX A;  3A09 A;  1F9B A;  2FNC A;  3TAJ A;  2F78 A;  5A5X A;  3RPW A;  1B3L A;  1VFE A;  2PYY A;  3MVZ A;  4PFU A;  3G3F A;  2THI A;  3KOS A;  5TPA A;  5I57 A;  2XXW A;  1ZTY A;  1OMP A;  4NF4 A;  1UTH A;  4NF6 A;  4X1D A;  3CVG A;  3FUZ A;  3FVK A;  3FVO A;  1MQI A;  4YKP A;  4IO2 A;  4ELO A;  1P99 A;  3TTK A;  3H6V A;  2GHB A;  3OO6 A;  2XXH A;  1BLF A;  2ZNS A;  1ZIU A;  2R9J A;  4KCC A;  3V8X B;  4DXB A;  1FTM A;  3PUZ E;  1Y3Q A;  2ONR A;  5AA4 A;  1LFG A;  5I56 A;  2Y7P A;  1OIB A;  3MUQ A;  5JK4 A;  2RC8 A;  1A8F A;  3LR1 A;  4ELQ A;  3T96 B;  1Y20 A;  3O9P A;  4G2Z A;  1XHY A;  1FQD A;  3SEU A;  3LSX A;  5JEI A;  2F6P A;  3KOT A;  4U1O A;  1PBP A;  1DPP A;  4JSD A;  3H06 B;  1B3H A;  3HHF A;  1QJM A;  1TFD A;  4H6D A;  3H4Z A;  2Q8J A;  3VE1 B;  4NE4 A;  2QS3 A;  1WDN A;  3MVX A;  1USY H;  4R73 A;  1P1U A;  3SEV A;  4N07 A;  2ZNU A;  2HAV A;  4QSD A;  5AA3 A;  3KJ7 A;  1EH3 A;  3LSW A;  4POX A;  4RYA A;  4ZE9 A;  3C31 A;  4X1B A;  5IKB A;  4BLA A;  1M5D A;  2RCB A;  2O68 A;  4LZ5 A;  1SBP A;  4GXA A;  3TCH A;  3M3K A;  1FQC A;  3S2V A;  2V3Q A;  4NTL A;  3ODB A;  5I59 A;  1GTK A;  3QUJ A;  3TPA A;  4FAJ A;  1OLC A;  2HQ0 A;  4NF8 B;  3ILU B;  3B6T A;  5KCJ A;  2X26 A;  2QJE A;  3IOR A;  1XT8 A;  3FVG A;  2R71 A;  3PPQ A;  5H8H B;  1IIW A;  1II5 A;  3CSG A;  4GLI A;  2Q88 A;  3FAS A;  3S9N C;  1O64 A;  1XVY A;  2A5T B;  2DP8 A;  2E1S A;  1B4H A;  2DS9 A;  2DE2 A;  4ZZE A;  5L8D A;  4YIC A;  1PBQ A;  4Q8R A;  2OJT A;  2Q89 A;  4JWX A;  3S9M C;  1B0H A;  3PMW A;  1XS5 A;  2AIX A;  3DLN A;  3DM0 A;  3BFU A;  4BDN A;  1Y1M A;  3N94 A;  1FQA A;  4THI A;  3K00 A;  4EQ9 A;  4E0X A;  3SEY A;  2I6E A;  4LZ7 A;  2VOZ A;  1FTK A;  3M3F A;  3DP8 A;  2Z8D A;  2HAU A;  1B7U A;  4I62 A;  3RY3 A;  3Q26 A;  4LQ2 A;  1RYO A;  4U1Z A;  4H67 A;  2I49 A;  4ZDM A;  3IOU A;  3RGY A;  5CMB A;  5LOM A;  4ECF A;  3PD8 A;  1Z7N E;  3FXR A;  1B7Z A;  3CFZ A;  4KYS A;  4GF8 A;  4P0G A;  4QFL A;  2V93 A;  3L6H A;  2ZXT A;  1PEB A;  3FIR A;  4TLM B;  4ZE8 A;  1D9V A;  4KHZ E;  1NNF A;  3A3C A;  3R7X A;  1SDX A;  1FTO A;  1QUK A;  1NNT A;  1H45 A;  1MXZ A;  4IO5 A;  1J1N A;  1US5 A;  3VDF A;  1N0T A;  3LUY A;  1M5C A;  1MY2 A;  3C35 A;  3MP8 A;  2DXY A;  4GWO A;  4JBZ A;  1A55 A;  1AL3 A;  1BP5 A;  4GRK A;  4UA8 A;  4BDL A;  1FQF A;  3PUY E;  4Z0I A;  3S9E A;  1YPN A;  1JET A;  4DXU A;  4O3A A;  4YB7 A;  4QHQ A;  3KFM A;  3RUM A;  2G93 A;  3RLF E;  4G77 A;  5TP9 A;  3GZG A;  1QKB A;  4KCD A;  1I69 A;  1OVT A;  1B51 A;  5TU0 A;  2QMX A;  1Y3P A;  3QIM A;  1NMU A;  3VXC A;  4M4G A;  4N6P A;  3PMX A;  3OEL A;  1JW5 A;  2REJ A;  3G7W A;  4UAC A;  3K6W A;  3PPP A;  1JEV A;  5BUU A;  1A99 A;  1NL5 A;  4XTC Q;  4JDF A;  4HTG A;  2ZYN A;  2GH9 A;  2Q2C A;  3GXA A;  2XXP A;  1EZ9 A;  3U93 A;  3TEP A;  5AA2 B;  1SW4 A;  3H7M A;  1MY3 A;  4FJP A;  2XXI A;  4GFR A;  2NOO A;  5M2V A;  2VGQ A;  4OQO A;  4O3C A;  4FEC A;  2DWH A;  3RT6 B;  4XKP A;  5ICT A;  3E4R A;  3QAX A;  1LFH A;  1D4N A;  4IO3 A;  2RF1 A;  3CR9 A;  3OEN A;  4QSE A;  4PE5 B;  4EQ7 A;  4RXL A;  5JTY B;  1B6H A;  3T9X B;  1PC3 A;  1ZLQ A;  4KI0 E;  2DWA A;  3UP9 A;  2H25 A;  1Y9U A;  2OK2 A;  4F3B A;  1LAX A;  4XKN A;  3ZKL A;  1YAE A;  3R26 A;  4DDD A;  3T93 B;  4I8C A;  1NH7 A;  4U2R A;  5IAI A;  2O1L A;  3KN8 A;  2OZZ A;  2Z8F A;  3G3H A;  4F3S A;  1WOD A;  1JVY A;  1B9J A;  1B05 A;  1P1W A;  2ANJ A;  2DWJ A;  3KG2 A;  1URS A;  3O6G A;  4ZEC A;  1ZMG A;  2H99 A;  2VP1 A;  5H8Q A;  3PUW E;  2XHD A;  1MH3 A;  2Z23 A;  3T22 A;  3W9W A;  4KYD A;  2YPN A;  3IK6 B;  4U23 A;  5DEX A;  1DTZ A;  3FJM A;  3VVD A;  1QVS A;  5DYH A;  1Q1K A;  2UYF A;  4OZ9 A;  3EHU A;  1S9T A;  1TXF A;  1MQH A;  2F8D A;  1B5J A;  5I58 A;  3A3U A;  3V5A A;  2Y84 A;  3K02 A;  3O2A A;  1A8E A;  2REG A;  2RIN A;  2XXR A;  1ZJL A;  2QS1 A;  4F3G A;  4YU0 A;  2F7A A;  4LQ5 A;  4H1X A;  4ZEI A;  2B3F A;  2QSX A;  1OLA A;  1MDP 1;  4RPN A;  2XX8 A;  4R74 A;  5HM4 B;  5H8F B;  5B7D A;  3R6U A;  5H8S A;  4RNS A;  2O7U A;  5AA1 A;  3MZ1 A;  4C1T A;  1B0L A;  5F7V A;  5CMC A;  4MFI A;  3KEI A;  5K2Y A;  2HFB A;  1B32 A;  2KLF A;  1D3K A;  1VFD A;  1Y4T A;  4U4S A;  2PVU A;  2H4I A;  2XD3 A;  4KFQ A;  2DWI A;  1B5I A;  3B6W A;  2HXW A;  3Q29 A;  4NF5 B;  3HHG A;  1MS7 A;  4OMB A;  1SD3 A;  3N26 A;  5EHM A;  2OWT A;  4R2F A;  4LVQ A;  1AOV A;  1P1N A;  4G68 C;  3IX1 A;  3HST A;  1MY0 A;  2XXY A;  2Q2A A;  3G3K A;  3N5L A;  3HO7 A;  4F18 A;  1YTV A;  4G68 A;  1LST A;  2P0S A;  4EF1 A;  1GR2 A;  4YZZ A;  4K3F A;  2OLB A;  4NMY A;  4L17 A;  4ELP A;  1TFA A;  4ISU A;  1IZ1 A;  3O6I A;  3MJN A;  4EXK A;  1CB6 A;  2AL5 A;  3V89 B;  1I6B A;  2X7Q A;  3SET A;  4LP2 B;  3TFL A;  4IGT A;  4G8H A;  3TQL A;  4WEP A;  1HSJ A;  5CM6 A;  3T66 A;  2HZL A;  3SER A;  3H6T A;  1JW4 A;  1H3D A;  4LA9 A;  3WAF A;  3K0V A;  5I57 B;  3U72 A;  3PPO A;  4U21 A;  3IR1 A;  1LGB C;  3KJT A;  4WED A;  4NF4 B;  4NF6 B;  5ITP A;  1I6A A;  1XOC A;  2XXT A;  1MPB A;  3G3G A;  4FED A;  1IXH A;  3O66 A;  2PT1 A;  3MAM A;  1FQB A;  4QFP A;  1PB8 A;  5AA4 B;  4YMA A;  2NWJ A;  1B3F A;  5I56 B;  3V83 A;  4F31 B;  3MWB A;  3VFJ A;  1B1H A;  3KGC A;  2HZK A;  1QKA A;  2DXR A;  3DP6 A;  4ZZA A;  2DVC A;  2QL3 A;  2DQV A;  3OXN A;  1JQF A;  2QMW A;  3OSR A;  2PMS A;  4EUO A;  3IJO B;  3JYR A;  1Q35 A;  4I9D A;  2ZNT A;  3VLU A;  1SVX B;  3MZB A;  3MBP A;  4HCW A;  2O6A A;  5FTI A;  3TDJ A;  3FXU A;  2Z8E A;  4N13 A;  5H8N A;  4LAT A;  4F3P A;  4OEV A;  4TOZ A;  1M5F A;  1UTB A;  4F1V A;  1Y4C A;  1XC1 A;  3I5O A;  3N6T A;  1O63 A;  3S4U A;  3O6H A;  1AH5 A;  1R1N A;  4GOT A;  1MG1 A;  2ZMB A;  4G8M A;  5I2K A;  1ZBM A;  1A40 A;  1FTJ A;  2XXU A;  2I4B A;  1NKX A;  3OO9 A;  4AQ4 A;  4GXS B;  3CG1 A;  1GVC A;  3EHS A;  1RYX A;  3OO7 A;  2UXA A;  4GD5 A;  3C34 A;  3Q28 A;  3LBS A;  5B70 A;  2I4C A;  5I84 A;  4ESW A;  5J1D A;  1LBB A;  5I59 B;  3IO4 A;  4OET A;  5KDT A;  4RY1 A;  1SI0 A;  5KCJ B;  1P1O A;  3PPR A;  3QK6 A;  3O28 A;  1PDA A;  2UVG A;  4QRZ A;  5CMK A;  3IJX B;  3QUF A;  2M8C A;  3KN3 A;  4R75 A;  4EF2 A;  1UIU A;  3VVF A;  3P7I A;  1IXG A;  1B5H A;  4ELR A;  3IB2 A;  1PB7 A;  5EHS A;  5DVI A;  2F7B A;  5F1Q A;  3CFL A;  4IY6 A;  3IL1 B;  1LB8 A;  4EQB A;  5CBR A;  1EU8 A;  1TWY A;  3BFT A;  1B58 A;  3TEL A;  2DVZ A;  2Q9T A;  3LSF B;  1YCJ A;  3O29 A;  2Y7W A;  1LAG E;  1SW1 A;  1MH4 A;  3U1O A;  3RT8 A;  4O3B A;  4OHN A;  2XXQ A;  2GHA A;  1H44 A;  4MF3 A;  1M5E A;  1TT1 A;  1B46 A;  3Q27 A;  2YLN A;  5L9S A;  2X7P A;  5ELV A;  1DOT A;  4IGR A;  4OFJ A;  2H9B A;  4WKM A;  4GQO A;  1URG A;  4TLL B;  3QYT A;  4OER A;  1B4Z A;  1LLS A;  5KZT A;  4YKJ A;  1N3W A;  3BBR A;  1R9L A;  2A5S A;  2ALU A;  3CIJ A;  2F97 A;  3HCQ A;  1POT A;  1LCF A;  1QUJ A;  1B3G A;  1N84 A;  4HW8 A;  1IIT A;  1FW0 A;  1QUL A;  3IB1 A;  3MP1 A;  4NED A;  5EYF A;  4R72 A;  1Z7M E;  2F5X A;  4DE8 A;  4E0W A;  1R6Z A;  2ONK E;  1MXW A;  1B40 A;  4OFL A;  5FTH A;  5CRY A;  5L9M A;  4FEB A;  5DVF A;  2ABH A;  3O97 A;  2Y7K A;  4G4P A;  2XD2 A;  5ICQ A;  1N3X A;  3FJG A;  1PB9 A;  5I2N A;  4BDQ A;  3UGW A;  4LUB A;  4BDR A;  1N04 A;  4OYV A;  3IB0 A;  3VLV A;  1S7Y A;  3EN3 A;  3IAZ A;  2OCU A;  5BWJ A;  3H3G A;  1HSL A;  1URD A;  3C4M A;  2V3T A;  1Y1Z A;  2UVI A;  2W7Y A;  4U4X A;  4F39 A;  4YAH X;  5TP9 B;  3SEW A;  1AIV A;  4F2O A;  2E0S A;  4WXJ A;  1ELJ A;  4F1U A;  3HV1 A;  5ISU A;  1WVJ A;  2GFE A;  3ZS6 A;  1US4 A;  3TCF A;  1SW5 A;  2ZYK A;  2PBW A;  2G29 A;  4P11 A;  5CI5 A;  2R6G E;  3SKP A;  4PET A;  3PPN A;  1MY4 A;  2RCA A;  3G3I A;  3KN7 A;  5CBS A;  1LFI A;  2CZL A;  1A7L A;  2VHA A;  4C0R A;  4EDP A;  2XX7 A;  3EHT A;  2XXV A;  3PD9 A;  5ITO A;  3VLW A;  4KD5 A;  2B65 A;  1ZKB A;  2FA7 A;  3MC2 A;  2UVH A;  2V3U A;  4LZ8 A;  3MPL A;  4JSO A;  1IQ7 A;  2HCA A;  4F1Y A;  2Y7R A;  4PFY A;  2O7I A;  4YB5 A;  4JB7 A;  1ANF A;  2BJJ X;  4ZS9 A;  1FCK A;  1MQD A;  4GVO A;  3KBR A;  1IXC A;  4QSC A;  4F22 A;  3I6V A;  3TKD A;  2D5W A;  3T9U A;  1OVB A;  5H8Q B;  4EXL A;  3TZA A;  3TTL A;  2I0C A;  4GIZ A;  2I3W A;  3IOT A;  4PFT A;  4ONY A;  3K6X A;  4PQJ A;  1MPD A;  2WKY A;  3SES A;  3N6U A;  5DEX B;  4U22 A;  3USD A;  4LON B;  2V25 A;  4NWD A;  3HN0 A;  4OWD A;  3PUV E;  2QS4 A;  2IEE A;  3OEM A;  2OBG A;  3TMG A;  5I58 B;  3UK4 A;  4NF8 A;  3PU5 A;  4ND9 A;  5H8H A;  4DLD A;  1MXY A;  1GV8 A;  1USY E;  3C9H A;  1D9Y A;  4Q0C A;  3ZSF A;  3RNN A;  3GBA A;  2F34 A;  3OO8 A;  1L5T A;  3EF7 A;  1JVX A;  2A5T A;  2PT2 A;  1IEJ A;  2NXO A;  3TUS A;  2AL4 A;  1M5B A;  4M1V A;  3RTW B;  4DCX A;  2QRY A;  4IB2 A;  1N7X A;  3LC8 A;  3ONM A;  2AYS A;  5A5X B;  4DIG A;  2V84 A;  4OES A;  1MDQ A;  3FV2 A;  1SI1 A;  2OWS A;  1NH8 A;  5TPA B;  5AE4 A;  1IUD A;  2PX1 A;  4R6Y A;  4YKK A;  2I3V A;  1N76 A;  1UTH B;  3MW0 A;  1ATG A;  4JWO A;  1UIV A;  3UN6 A;  3H03 A;  3THI A;  3LSL A;  4X48 A;  4OEU A;  1LCT A;  3PGF A;  4X9T A;  1OQG A;  3MZ9 A;  2O1M A;  4RA1 A;  4BDO A;  3MVW A;  1DTG A;  5K2X A;  2UVJ A;  2O51 A;  1CE2 A;  3VVE A;  4H8I A;  4QFO A;  1OQH A;  3K1M A;  1A54 A;  4NWC A;  4MBP A;  1Y3N A;  2QPQ A;  2ZYO A;  3C36 A;  4R2B A;  4QFK A;  4G68 B;  3RQT A;  4C1U A;  2RC7 A;  5DT6 A;  4OXV A;  4Q5T A;  1BIY A;  1R9Q A;  2DYX A;  4IY5 A;  1POY 1;  4ZED A;  2Z22 A;  4JXI A;  4MLV A;  3MQ9 A;  1MM7 A;  2XXX A;  3CFX A;  3M8U A;  3MPK A;  3AXF A;  3K4U A;  5DTB A;  4IO7 A;  4KYE A;  4KPT A;  4FE8 A;  3ZKK A;  1XVX A;  1MRP A;  1LBC A;  1T0K A;  4POW A;  1SYI A;  3SDF A;  1FQE A;  4Q30 B;  1RKM A;  2DE3 A;  2FYI A;  3E9X A;  1DSN A;  3H6U A;  1UQW A;  1H43 A;  3U8Q A;  2DSF A;  3IOW A;  5L9O A;  1LAH E;  4MLQ A;  3JZJ A;  5CMM A;  4Z7E A;  4OVJ A;  3JV9 A;  2H5Y A;  1MXU A;  3TTM A;  3W9V A;  1ZU0 A;  4H65 A;  4IO4 A;  4IO6 A;  1BKA A;  3K6U A;  2GRV A;  4F19 A;  4R6K A;  3FVN A;  3TYH A;  1SQY A;  3IO6 A;  3TQW A;  5AA2 A;  2ZYM A;  4R9G A;  1B7H A;  3VV5 A;  1I6Q A;  1S50 A;  3GLB A;  1SW2 A;  3OD7 A;  3RN8 A;  1DPE A;  2O69 A;  3S9L C;  5FHM A;  4HCY A;  1NFT A;  4DCY A;  3G3J A;  3Q25 A;  3FJ7 A;  4ZEB A;  3KZG A;  2Y7I A;  4RPO A;  4JWY A;  5AA2 D;  3EPE A; 
#chains in the Genus database with same CATH topology
 2FV4 B;  4YB6 A;  3K1P A;  2YRH A;  3TCG A;  2Y5K A;  5JTY A;  2NVU B;  4P7D A;  3OSQ A;  4J8Z A;  3MP6 A;  2LBS B;  4OFO A;  4H5F A;  2P2A A;  3AUZ A;  2FGG A;  2NUV A;  2QS2 A;  3BBG A;  3FD3 A;  2WX9 A;  1MQJ A;  3KSX A;  4F2Q A;  1FTA A;  3IFC A;  3D4C A;  4QF9 A;  4JYA E;  3ADG A;  3U92 A;  1VR5 A;  3M3L A;  5DVJ A;  4AB6 A;  2D3I A;  5FHO A;  1JNF A;  2UYE A;  5H8N B;  4R2C A;  1AMF A;  4YMB A;  1QUI A;  4H8J A;  2F36 A;  3DJW A;  2EMX A;  3C32 A;  1UTB B;  2EM6 A;  4DKK A;  3E13 X;  4BDM A;  2IA4 A;  1FTL A;  4DR7 E;  2FHY A;  3PV0 E;  2EML A;  3TTR A;  3MHS C;  2DOJ A;  1NUZ A;  4DI4 B;  4I8O A;  3DEL B;  1XI6 A;  5I2K B;  3TOD A;  4PDD A;  1MY1 A;  4GL0 A;  3FAT A;  3IWC A;  2YTJ A;  5HBC A;  1IXI A;  3DP4 A;  4WX9 A;  2VD2 A;  2XX9 A;  1MM6 A;  4MJO A;  1B3E A;  3FZV A;  4TQU Q;  5EQ7 A;  3CRB A;  1O7T A;  2JY9 A;  1JEU A;  3CSB A;  2VPO A;  4OOG C;  1A1H A;  2DE4 A;  1GGG A;  1EZP A;  1QW0 A;  1LAF E;  4XKR A;  4BC9 A;  2R8T A;  4PDH A;  1HNZ E;  3OMB A;  4ESX A;  4YKI A;  3T9V A;  3T9H B;  4FAT A;  3RPL B;  4MHF A;  3IOV A;  2V83 A;  3PUX E;  4HEI A;  3EPJ A;  1H76 A;  2YJP A;  3L6G A;  4LF5 E;  2PCR A;  3FGS A;  1JW1 A;  1P1Q A;  4RK2 A;  2CMO A;  1KWH A;  1X49 A;  3FV1 A;  1BTJ A;  5KDT B;  4B3S E;  4FK5 C;  3UA8 A;  4M0V A;  2GQ1 A;  1QGX A;  1XNQ E;  3K6V A;  2EOF A;  1YZ9 A;  3UOR A;  2XWI A;  4JV5 E;  3OEK A;  1XMQ E;  4NZV A;  3EQ1 A;  5EQ9 A;  2Q8U A;  3ADI A;  2F6G A;  2QFL A;  5CFF E;  3HXL A;  4DV0 E;  4LFC E;  4PFB A;  3J7A G;  4R9F A;  4XIG Q;  1FPI A;  4O24 A;  4BBY A;  1YUI A;  2NUG A;  4GBW A;  4OTE A;  4KR5 A;  2H98 A;  1MXV A;  5HPQ A;  3VXB A;  3HPI A;  1X6E A;  3TTN A;  4RK9 A;  4AB5 A;  1LB9 A;  5A2Q C;  3WAE A;  4RJZ A;  4XKQ A;  1EZO A;  4PFW A;  4XXU A;  1VSO A;  4R6H A;  5H8F A;  4MH5 A;  2P3N A;  2O84 X;  1N7W A;  5FHN A;  2HEU A;  1B52 A;  4MMP A;  4XEQ A;  2I58 A;  3UIF A;  4FOR A;  3C33 A;  1SR9 A;  2I0B A;  2HPG A;  1RC7 A;  3BKI B;  1ZR9 A;  2EOR A;  1BK4 A;  1MPC A;  1B2H A;  3KC1 A;  2FIX A;  4GL8 A;  4OEN A;  5IWA E;  3CI8 A;  1SYH A;  2DMI A;  2EM7 A;  2RKM A;  4K0K E;  4GWY A;  4ZEF A;  4RH8 A;  2VD3 A;  4H0W A;  4DXC A;  3H6W A;  3ILT B;  2L2N A;  1RDX A;  4FIM A;  5IZ1 A;  3W15 C;  4JI6 E;  4F29 A;  3B7D A;  1HSE A;  4WSP A;  3HFU A;  2JP9 A;  2G7H A;  1FPD A;  2ESN A;  2R76 A;  2DGC A;  2L3C A;  4DR3 E;  1T4O A;  4KQP A;  4NF5 A;  3K2D A;  3B6Q A;  4DZ1 A;  3AV0 A;  3D4G A;  3GBB A;  4G8N A;  5CC2 A;  3F11 A;  3KC0 A;  3K1N A;  3U94 A;  2F7C A;  2ONS A;  2EZ6 A;  4QFN A;  3OOA A;  1GZ6 A;  1NNK A;  4P0I A;  3KSJ A;  1EH6 A;  2V86 A;  4R2Q A;  2P1S A;  1NNP A;  3MVY A;  3SEX A;  3QXM A;  2RC9 A;  3ADL A;  2YTQ A;  2F35 A;  4LFB E;  3K01 A;  3PTY A;  3RTF B;  2ZZW A;  1MQG A;  5IZ3 A;  2B3B A;  1DMB A;  3FXQ A;  3ECR A;  5IXM B;  3J7Y p;  3QSL A;  4X04 A;  2RSM A;  1PJT A;  1IMA A;  2LAO A;  2D21 A;  1F2I G;  2I48 A;  3E3K A;  3PMV A;  4H5G A;  1B1X A;  3I3V A;  5ET8 A;  4ZEK A;  2UUC E;  4YY3 E;  4LF7 E;  4HS7 A;  3ZOQ B;  4DV6 E;  4H46 A;  4PP0 A;  4UAB A;  5I2N B;  3CG3 A;  2HHM A;  4I1D A;  1VE4 A;  2ENH A;  1MXX A;  3A09 A;  3BID A;  1F9B A;  2EWL A;  2EOQ A;  2FNC A;  3TAJ A;  2F78 A;  2ZZV A;  5A5X A;  3RPW A;  1B3L A;  1VFE A;  2PYY A;  3MVZ A;  4PFU A;  3G3F A;  2THI A;  4WSG A;  3HTX A;  3KOS A;  5TPA A;  5AC5 A;  5I57 A;  1JK2 A;  2B7V A;  2EOY A;  1ZU1 A;  2XXW A;  1ZTY A;  4P56 A;  1IMD A;  1OMP A;  4NF4 A;  1UTH A;  4NF6 A;  4X1D A;  1EKZ A;  3CVG A;  3FUZ A;  2EOH A;  2EN7 A;  3FVK A;  3FVO A;  1MQI A;  4YKP A;  4IO2 A;  4PGP A;  2EQ0 A;  4ELO A;  4DR5 E;  4PF8 A;  1P99 A;  3TTK A;  4LFA E;  3H6V A;  2GHB A;  3OO6 A;  5IGA A;  2XXH A;  1BLF A;  2ZNS A;  1ZIU A;  2R9J A;  4KCC A;  2HGH A;  3V8X B;  4DXB A;  1FTM A;  3PUZ E;  1Y3Q A;  4DUZ E;  2EJ4 A;  2EQ3 A;  2ONR A;  5AA4 A;  2YTN A;  1LFG A;  5I56 A;  2Y7P A;  1NV7 A;  1OIB A;  2KR0 A;  1X47 A;  3MUQ A;  3FBP A;  4JI0 E;  5JK4 A;  3T0J A;  2RC8 A;  1A1K A;  1A8F A;  3LR1 A;  4N4R B;  4ELQ A;  5IM2 A;  3T96 B;  3K6Q A;  1Y20 A;  3O9P A;  4G2Z A;  4LN5 A;  1XHY A;  1YZ0 A;  1FQD A;  2H36 X;  5I5P A;  3SEU A;  3LSX A;  5JEI A;  2F6P A;  3KOT A;  4U1O A;  2XWK A;  2LCE A;  1PBP A;  1DPP A;  4JSD A;  2DB2 A;  3H06 B;  1B3H A;  3HHF A;  4R03 A;  1QJM A;  1TFD A;  4H6D A;  4MNC A;  2EN4 A;  3H4Z A;  1JK1 A;  4O8M A;  2Q8J A;  3VE1 B;  4IS1 C;  2ZZX A;  4NE4 A;  2QS3 A;  1WDN A;  3MVX A;  1RDY A;  5T3J A;  3RYD A;  1USY H;  4I3E A;  4R73 A;  1P1U A;  2YZT A;  3SEV A;  4N07 A;  4H45 A;  2ZNU A;  2JVA A;  2HAV A;  4M30 A;  3JTZ A;  4QSD A;  1XMO E;  3SZP A;  5AA3 A;  5I7I A;  1LBY A;  3KJ7 A;  1EH3 A;  1FPL A;  3LSW A;  4POX A;  2EMB A;  4RYA A;  3OML A;  2ELY A;  4ZE9 A;  1NV6 A;  3C31 A;  2QVV A;  4X1B A;  5IKB A;  4BLA A;  3T1Y E;  1PJQ A;  1M5D A;  2RCB A;  2O68 A;  4LZ5 A;  1SBP A;  4O5G A;  4DI3 D;  4HE0 A;  4GXA A;  3TCH A;  3M3K A;  1FQC A;  3S2V A;  4R2R A;  1PJS A;  2V3Q A;  2XWV A;  4NTL A;  3ODB A;  5LL6 R;  5I59 A;  1GTK A;  3QUJ A;  3TPA A;  4FAJ A;  1OLC A;  2HQ0 A;  2NUE A;  2FIE A;  3F6G A;  3BIH A;  1QU6 A;  4NF8 B;  3ILU B;  3B6T A;  5KCJ A;  2X26 A;  2QJE A;  3IOR A;  5F24 A;  1XT8 A;  3FVG A;  2R71 A;  3PPQ A;  2EMH A;  5H8H B;  1IIW A;  1II5 A;  5IV8 B;  1UIL A;  4PCD A;  3CSG A;  4I40 A;  2LJH A;  3ROJ A;  4N6D A;  4GLI A;  2Q88 A;  2EL5 A;  3FAS A;  4KXP A;  2L92 A;  1UN6 B;  2F3D A;  4OAN A;  4DV7 E;  3S9N C;  1O64 A;  5ET5 A;  1XVY A;  2A5T B;  2DP8 A;  2E1S A;  1N33 E;  1B4H A;  2DS9 A;  2DE2 A;  4DR1 E;  4ZZE A;  1EH7 A;  5L8D A;  4MNI A;  4YIC A;  1PBQ A;  5EQ8 A;  4Q8R A;  4PF6 A;  2OJT A;  3C6M A;  2UXD E;  2Q89 A;  4IR8 A;  1JP4 A;  4JWX A;  3S9M C;  1B0H A;  3PMW A;  1KZ8 A;  1RMD A;  1XS5 A;  2AIX A;  4ZYD A;  1WJP A;  3DLN A;  3DM0 A;  4BC7 A;  3BFU A;  4BDN A;  2BBG A;  2EQ1 A;  2EPP A;  1Y1M A;  3N94 A;  4R2D A;  1FPK A;  1FQA A;  4THI A;  3K00 A;  4EQ9 A;  4E0X A;  3SEY A;  2I6E A;  4LZ7 A;  2VOZ A;  1FTK A;  3M3F A;  4N17 A;  1EYI A;  1J26 A;  2GHF A;  2HXR A;  3DP8 A;  2Z8D A;  2HAU A;  1B7U A;  1FKA E;  4I62 A;  3RY3 A;  3Q26 A;  2Q74 A;  4LQ2 A;  1RYO A;  3B50 A;  2MDG A;  2JR1 A;  4H67 A;  4U1Z A;  2I49 A;  4HXV A;  4DV1 E;  4NGU A;  4ZDM A;  4FBP A;  3IOU A;  3RGY A;  5EQA A;  2WCC 3;  5CMB A;  2JOB A;  2VQE E;  5LOM A;  4MIJ A;  4ECF A;  2NUF A;  3PD8 A;  1Z7N E;  3FXR A;  1B7Z A;  2GLI A;  3CFZ A;  4KYS A;  2E5L E;  4GF8 A;  4P0G A;  4QFL A;  2V93 A;  3L6H A;  2ZXT A;  2JYA A;  1PEB A;  2M4I A;  3FIR A;  4TLM B;  4ZE8 A;  2GPI A;  1D9V A;  4F6N A;  4KHZ E;  3LLH A;  1NNF A;  3A3C A;  3R7X A;  1SDX A;  1FTO A;  1QUK A;  2RSI A;  1LBZ A;  1NNT A;  1H45 A;  1MXZ A;  4IO5 A;  1A1F A;  1J1N A;  1US5 A;  3VDF A;  1N0T A;  2WBB A;  3LUY A;  1M5C A;  1MY2 A;  3FIG A;  3C35 A;  4X8R A;  3MP8 A;  4BCA A;  2DXY A;  4GWO A;  1CNQ A;  4JBZ A;  2YSO A;  1A55 A;  1AL3 A;  1BP5 A;  1IMU A;  2RPC A;  4MNP A;  2OX3 A;  4GRK A;  4UA8 A;  2BB8 A;  4BDL A;  2MKN A;  1FQF A;  3PUY E;  4Z0I A;  3S9E A;  1YPN A;  1JET A;  4DXU A;  4O3A A;  4YB7 A;  2KOU A;  4QHQ A;  3KFM A;  5IZZ A;  3QG5 C;  1ZBQ A;  4MX6 A;  1IQS A;  3RUM A;  2G93 A;  5KL7 A;  1HR0 E;  2IHR 1;  3RLF E;  4G77 A;  5TP9 A;  3GZG A;  2M1S A;  1QKB A;  4KCD A;  1I69 A;  1OVT A;  1B51 A;  2XA5 A;  5TU0 A;  2QMX A;  1Y3P A;  3QIM A;  1NMU A;  3VXC A;  4M4G A;  4N6P A;  2LTS A;  1SPI A;  4F9A B;  1FPG A;  3PMX A;  2JWO A;  3OEL A;  1JW5 A;  2REJ A;  3G7W A;  4N4U A;  3C4T A;  4UAC A;  3K6W A;  3PPP A;  1JEV A;  1J5E E;  5BUU A;  1NV2 A;  1A99 A;  1NL5 A;  4XTC Q;  4JDF A;  4HTG A;  2ZYN A;  2GH9 A;  2Q2C A;  3IFA A;  3GXA A;  1BBO A;  2XXP A;  1EZ9 A;  3U93 A;  4R2P A;  3TEP A;  1XNR E;  5AA2 B;  1SW4 A;  1T39 A;  3H7M A;  1MY3 A;  4F2J C;  4FJP A;  2XXI A;  1NV5 A;  4GFR A;  3A29 A;  1TF3 A;  2NOO A;  5M2V A;  2VGQ A;  2KHX A;  4DV3 E;  2CPN A;  4OQO A;  4O3C A;  2EM9 A;  4FEC A;  2DWH A;  3RT6 B;  4XKP A;  5ICT A;  5LDZ A;  3E4R A;  3QAX A;  2PRT A;  2VT5 A;  4N8Y A;  1LFH A;  1D4N A;  4OVQ A;  4NXN E;  4GWS A;  4IO3 A;  2RF1 A;  4PC9 A;  2CSH A;  2MDR A;  2Y5L A;  3CR9 A;  3OEN A;  4QSE A;  4PE5 B;  4AS5 A;  1DQ3 A;  4EQ7 A;  4RXL A;  1T38 A;  5JTY B;  1N34 E;  2HC5 A;  1B6H A;  3T9X B;  2EPL X;  1PC3 A;  1O0W A;  1ZLQ A;  3IWD A;  4KI0 E;  2DWA A;  3UP9 A;  2H25 A;  1Y9U A;  2OK2 A;  1N3G A;  4F3B A;  1IQO A;  1LAX A;  2QVR A;  3EPL A;  4XKN A;  3ZKL A;  1YAE A;  3R26 A;  4DDD A;  4I3Y A;  4LF9 E;  3T93 B;  2LT7 A;  4I8C A;  1NH7 A;  1G2F C;  4U2R A;  5IAI A;  2O1L A;  3KN8 A;  2OZZ A;  1LEV A;  2Z8F A;  3G3H A;  4F3S A;  1WOD A;  1JVY A;  1STU A;  1B9J A;  5A6A A;  3BGH A;  1B05 A;  1A1L A;  1P1W A;  2ANJ A;  2DWJ A;  1INP A;  4BHB A;  4X65 E;  3KG2 A;  2N3G A;  1URS A;  2L5V A;  1FBH A;  3O6G A;  4ZEC A;  1ZMG A;  2H99 A;  2VP1 A;  5H8Q A;  4ZYE A;  3PUW E;  1YSA C;  2EM2 A;  4P1E A;  2XHD A;  1MH3 A;  4O7I A;  2Z23 A;  3T22 A;  3W9W A;  4KYD A;  1B69 A;  2YPN A;  4XF5 A;  3IK6 B;  4U23 A;  5DEX A;  4OVR A;  4AS4 A;  4DR6 E;  1DTZ A;  3FJM A;  3VVD A;  3J80 C;  1QVS A;  3U65 A;  4JVI A;  1SFE A;  5DW8 A;  5DYH A;  2F8B A;  1A1J A;  3MYU A;  1Q1K A;  2UYF A;  4OZ9 A;  1FRP A;  1NV1 A;  3EHU A;  1S9T A;  1TXF A;  1MQH A;  4BS9 A;  3FXB A;  2F8D A;  1B5J A;  5I58 A;  3NOH A;  3A3U A;  4TUG A;  3V5A A;  2Y84 A;  3K02 A;  3O2A A;  1HNX E;  1A8E A;  2REG A;  2RIN A;  3IWB A;  2MC5 A;  2XXR A;  2EOI A;  2EMI A;  1YUJ A;  1ZJL A;  2EMC A;  4OVT A;  2QS1 A;  2MKZ A;  4F3G A;  4YU0 A;  2LVH A;  2F7A A;  4LQ5 A;  1K9Z A;  2YTO A;  2CEX A;  4H1X A;  4ZEI A;  1RDZ A;  2B3F A;  2QSX A;  2DDK A;  5AE2 A;  1OLA A;  1MDP 1;  2WZO A;  4XFE A;  5KL4 A;  1DI2 A;  4M9V C;  2YTG A;  4RPN A;  2XX8 A;  2N3H A;  4R74 A;  5HM4 B;  1G2D C;  5A6B A;  4ZYG A;  2EN2 A;  5H8F B;  5B7D A;  1FBD A;  1TN9 A;  1WXR A;  2VRD A;  3R6U A;  4KZS A;  4GBV A;  1X6F A;  5H8S A;  4RNS A;  2O7U A;  5AA1 A;  1RQ0 A;  1MEY C;  1YYZ A;  3MZ1 A;  4C1T A;  1B0L A;  5F7V A;  5CMC A;  1G0I A;  4MFI A;  5ET6 A;  3KEI A;  4PAK A;  4DMI A;  4B3T E;  2EPK X;  5K2Y A;  2HFB A;  1YFH A;  1B32 A;  2KLF A;  1D3K A;  1VFD A;  1Y4T A;  5KL3 A;  1N36 E;  4U4S A;  4JI2 E;  2PVU A;  5A6B D;  2YWQ A;  2H4I A;  2XD3 A;  4KFQ A;  5KL5 A;  1X5W A;  2DWI A;  1YYW A;  1B5I A;  3B6W A;  2EM0 A;  2HXW A;  3Q29 A;  4NF5 B;  2V89 A;  2EPO A;  3HHG A;  1MS7 A;  4OMB A;  1SD3 A;  2VE7 C;  3N26 A;  5EHM A;  2OWT A;  4R2F A;  4LVQ A;  1AOV A;  1P1N A;  4G68 C;  3IX1 A;  3HST A;  4NG7 A;  1MY0 A;  1UBD C;  2XXY A;  2Q2A A;  3G3K A;  2CZI A;  3N5L A;  2EOJ A;  3HO7 A;  3QMF A;  1YTV A;  4F18 A;  4G68 A;  1LST A;  2P0S A;  4EF1 A;  1GR2 A;  4MEV A;  3VYY A;  4YZZ A;  4K3F A;  2OLB A;  2EL6 A;  4NMY A;  2OWZ A;  4L17 A;  4ELP A;  2B4M A;  1TFA A;  1IMC A;  4ZYH A;  5T6J A;  4ISU A;  5J16 A;  1IZ1 A;  3O6I A;  4KHP E;  3MJN A;  4JI7 E;  4WXC A;  2YU5 A;  2EN3 A;  4EXK A;  2EPR A;  1CB6 A;  2AL5 A;  2B3T B;  3V89 B;  1I6B A;  2X7Q A;  3SET A;  4LP2 B;  3TFL A;  4IGT A;  4G8H A;  3TQL A;  3HPS A;  1LBV A;  1HSJ A;  4WEP A;  5CM6 A;  4MAG A;  3T66 A;  2HZL A;  3SER A;  3H6T A;  1JW4 A;  1N32 E;  2EOO A;  5LMU E;  1FJG E;  1H3D A;  4N15 A;  4LA9 A;  4P3L A;  3WAF A;  3K0V A;  5I57 B;  3U72 A;  3PPO A;  4U21 A;  4DR4 E;  4N8G A;  3IR1 A;  2EPX A;  1LGB C;  3KJT A;  4WED A;  4NF4 B;  4NF6 B;  5ITP A;  1I6A A;  4F54 A;  1XOC A;  2XXT A;  1NUY A;  1MPB A;  3G3G A;  4GX6 A;  4JVC A;  4FED A;  1IXH A;  2Q8M A;  2KON A;  4DV4 E;  2V88 A;  3O66 A;  4YHH E;  3H09 A;  2PT1 A;  3MAM A;  2EP3 A;  1FPE A;  1FQB A;  4QFP A;  2M9A A;  4R2A A;  1PB8 A;  4O7M A;  5AA4 B;  2LE2 A;  4PGN A;  4YMA A;  2NWJ A;  1B3F A;  5I56 B;  1PKP A;  5LTC A;  3V83 A;  4F31 B;  1T4N A;  3MWB A;  3VFJ A;  1B1H A;  2HHH E;  3KGC A;  2HZK A;  2EOE A;  1QKA A;  2YT4 A;  2DXR A;  4NQ8 A;  2VQF E;  3DP6 A;  4ZZA A;  2MKD A;  2CT1 A;  2LTR A;  2DVC A;  2QL3 A;  4GKJ E;  2B9D A;  2EMY A;  2DQV A;  3OXN A;  1NUX A;  1JQF A;  2QMW A;  3OSR A;  2YTI A;  4P78 A;  2PMS A;  4EUO A;  2V8Q B;  3IJO B;  1KA1 A;  1IBM E;  3JYR A;  1Q35 A;  4I9D A;  2ZNT A;  3VLU A;  1SVX B;  2WEF A;  3MZB A;  3BF2 A;  2EMK A;  4F6M A;  3EPK A;  3MBP A;  4HCW A;  2O6A A;  5TSE A;  5FTI A;  2I13 A;  1NCS A;  4M2Z A;  3TDJ A;  3FXU A;  2Z8E A;  4N13 A;  5H8N A;  4LAT A;  4F3P A;  4OEV A;  4TOZ A;  1M5F A;  1EYJ A;  1UTB A;  2EE8 A;  4F1V A;  2L8T A;  1AWB A;  1Y4C A;  1XC1 A;  2WBU A;  3KBZ A;  3I5O A;  4RHB B;  3N6T A;  1O63 A;  3S4U A;  3O6H A;  1AH5 A;  1R1N A;  2K4V A;  4GOT A;  1MG1 A;  2ZMB A;  4G8M A;  5I2K A;  1ZBM A;  1A40 A;  2YTD A;  3C4B A;  1NV4 A;  1FTJ A;  2XXU A;  2I4B A;  4NAP A;  1NKX A;  2JXP A;  3OO9 A;  4AQ4 A;  4GXS B;  3CG1 A;  1GVC A;  5AE3 A;  3EHS A;  2ADR A;  3LUZ A;  1RYX A;  3OO7 A;  2UXA A;  4GD5 A;  3C34 A;  1YYO A;  3Q28 A;  3LBS A;  1L4S A;  2BJI A;  2ODR C;  1FPB A;  1IBK E;  1FBF A;  2I4C A;  2P3V A;  5B70 A;  5I84 A;  3RPL A;  4ESW A;  5J1D A;  1FSA A;  1LBB A;  1NV3 A;  2M7Q A;  5I59 B;  2EPC A;  3IO4 A;  4O94 A;  4OET A;  5KDT A;  2RS6 A;  3B8B A;  4RY1 A;  4LF8 E;  1SI0 A;  5KCJ B;  1P1O A;  3PPR A;  3QK6 A;  3O28 A;  1I94 E;  2EOX A;  1PDA A;  2UVG A;  4QRZ A;  1IMF A;  5CMK A;  3IJX B;  3QUF A;  2M8C A;  3KN3 A;  4R75 A;  4EF2 A;  2EMW A;  2YTF A;  1UIU A;  3P7I A;  3VVF A;  4B3R E;  1IXG A;  1NUW A;  5ESY A;  4PE3 A;  1B5H A;  4ELR A;  5ADZ A;  4Q28 A;  3IB2 A;  1KJK A;  1PB7 A;  5EHS A;  1FBC A;  5DVI A;  2F7B A;  1BBG A;  1DGC A;  5F1Q A;  3CFL A;  2ODR D;  4IY6 A;  3IL1 B;  1LB8 A;  4EQB A;  5CBR A;  1EU8 A;  1TWY A;  2N8X A;  3BFT A;  1B58 A;  3TEL A;  2DVZ A;  2Q9T A;  3LSF B;  1YCJ A;  3O29 A;  1FPF A;  4P9K A;  2Y7W A;  2WBT A;  5DNY A;  4R8O A;  2EMZ A;  1LAG E;  1SW1 A;  4P1L A;  1MH4 A;  3U1O A;  2CEY A;  3RT8 A;  3D1R A;  2DMY A;  4O3B A;  4OHN A;  2XXQ A;  3MST A;  1DCU A;  2WBD A;  2GHA A;  4AQY E;  1H44 A;  4MF3 A;  1M5E A;  1TT1 A;  1B46 A;  3Q27 A;  2YLN A;  3RMP A;  5L9S A;  1Z1B A;  2X7P A;  4PAI A;  1FBP A;  5ELV A;  4F9B B;  2YTP A;  2UXC E;  1DOT A;  4IGR A;  4OFJ A;  5LLQ A;  2H9B A;  4WKM A;  4GQO A;  1URG A;  2JPA A;  2KQZ A;  4TLL B;  3QYT A;  3JU0 A;  3LV0 A;  4OER A;  1B4Z A;  1LLS A;  5KZT A;  1FJ6 A;  4YKJ A;  1N3W A;  4JI1 E;  3BBR A;  4NXM E;  1R9L A;  2A5S A;  4GEQ B;  2ALU A;  2MC6 A;  3CIJ A;  4Q35 B;  2F97 A;  1WHQ A;  3HCQ A;  2EMA A;  1POT A;  1LCF A;  1QUJ A;  2YSP A;  5F3W A;  2HJJ A;  1N84 A;  2XXK A;  4HW8 A;  1IIT A;  2YU8 A;  1FW0 A;  4N91 A;  1QUL A;  3IB1 A;  3MP1 A;  2E72 A;  2ENA A;  4NED A;  2EM5 A;  5EYF A;  4R72 A;  1Z7M E;  2F5X A;  4DE8 A;  2LUP B;  4E0W A;  2EPA A;  3BIG A;  1R6Z A;  4WYQ B;  2RQL A;  2ONK E;  2DSY A;  1MXW A;  1B40 A;  2R1F A;  2L2M A;  4OFL A;  5FTH A;  2ELZ A;  5AC4 A;  5CRY A;  5L9M A;  4FEB A;  5DVF A;  1FBG A;  4HE2 A;  2ABH A;  4WFT A;  3O97 A;  2Y7K A;  1UHZ A;  3HPZ A;  4G4P A;  2XD2 A;  5ICQ A;  1N3X A;  3FJG A;  4GZN C;  1PB9 A;  5I2N A;  4BDQ A;  4PTK A;  1EH8 A;  1A1G A;  3UGW A;  4LUB A;  4BDR A;  1N04 A;  4OYV A;  3IB0 A;  3VLV A;  4JI8 E;  4X8W A;  1S7Y A;  4BHC A;  3EPE A;  3EN3 A;  2LUQ A;  3IAZ A;  2OCU A;  3E78 A;  5BWJ A;  5EYH A;  3H3G A;  1HSL A;  1URD A;  3C4M A;  2V3T A;  2V85 A;  1Y1Z A;  2UVI A;  2W7Y A;  5FLX C;  4U4X A;  4F39 A;  1G0H A;  1LBW A;  1FPJ A;  4YAH X;  5TP9 B;  4F9C B;  3SEW A;  1AIV A;  2FBP A;  4F2O A;  2E0S A;  4WXJ A;  1ELJ A;  1A1I A;  4GWW A;  3HV1 A;  4F1U A;  5ISU A;  4NF0 A;  1WVJ A;  2YTE A;  4MCO A;  4WPY A;  1IMB A;  3M99 B;  2GFE A;  3ZS6 A;  1US4 A;  5AAS A;  2EPN A;  1LBX A;  3TCF A;  2L3J A;  1SW5 A;  2ZYK A;  2PBW A;  2XWO A;  2EN8 A;  4HE1 A;  2G29 A;  4P11 A;  2EOZ A;  2FTX B;  4BMJ A;  3L00 A;  4GWZ A;  5CI5 A;  2QVU A;  2R6G E;  3SKP A;  4PET A;  2EOM A;  3PPN A;  1MGT A;  1MY4 A;  5IT9 C;  1X6H A;  3VYX A;  2RCA A;  3G3I A;  3KN7 A;  5CBS A;  4DV5 E;  1LFI A;  2CZL A;  4IJD A;  2A25 A;  1FBE A;  1A7L A;  2VHA A;  4C0R A;  4EDP A;  5BR8 E;  2XX7 A;  3EHT A;  4DV2 E;  2XXV A;  3PD9 A;  5ITO A;  2RTX A;  3VLW A;  4X66 E;  4KD5 A;  2B65 A;  4O4K A;  1T4L B;  1ZKB A;  2FA7 A;  3MC2 A;  1X48 A;  1BB8 A;  2UVH A;  2DRP A;  2V3U A;  4GWX A;  2RS7 A;  4LZ8 A;  2UUA E;  3MPL A;  3OTO E;  4PBH A;  1NV0 A;  4PAF A;  4JSO A;  4L5N C;  4NHB A;  2L2K B;  5AE1 A;  1IQ7 A;  2HCA A;  4F1Y A;  2VPN A;  3VHT B;  4LF6 E;  4DUY E;  1ZBT A;  2Y7R A;  4PFY A;  2O7I A;  4YB5 A;  4JB7 A;  1ANF A;  2BJJ X;  2V4C A;  2LRS A;  1FCK A;  4ZS9 A;  4R2S A;  2PFZ A;  1MQD A;  3E79 A;  3KBR A;  4GVO A;  2DLQ A;  3DF6 A;  1IXC A;  4X62 E;  4QSC A;  1Q9D A;  4OVP A;  4F22 A;  3I6V A;  4P47 A;  2DLK A;  4KWY A;  3P1X A;  3TKD A;  2LO3 A;  2D5W A;  2FVZ A;  3T9U A;  1OVB A;  5H8Q B;  4EXL A;  3TZA A;  3TTL A;  2I0C A;  4GIZ A;  2EPM X;  2I3W A;  3IOT A;  1QNT A;  4PFT A;  3MHH C;  4ONY A;  2EPZ A;  3K6X A;  4PQJ A;  1MPD A;  2WKY A;  3SES A;  1FJ9 A;  4GX3 A;  3N6U A;  5DEX B;  1GQE A;  2L6M A;  4U22 A;  1TF6 A;  3USD A;  3THO B;  4LON B;  2V25 A;  3ADJ A;  4NWD A;  3HN0 A;  4OWD A;  3PUV E;  2QS4 A;  2IEE A;  3OEM A;  2OBG A;  2VF1 A;  1P47 A;  3TMG A;  5I58 B;  4NHR A;  3UK4 A;  3T1H E;  4NF8 A;  1IBL E;  2JJK A;  5IZ3 B;  1D9Q A;  3PU5 A;  2UUB E;  4X64 E;  1HNW E;  5LMN E;  4ND9 A;  5H8H A;  2L33 A;  3MSW A;  2EN6 A;  4DLD A;  1MXY A;  1GV8 A;  1USY E;  3C9H A;  4PFI A;  4O43 A;  1D9Y A;  4Q0C A;  1LLM C;  3ZSF A;  3RNN A;  5KL2 A;  5A6K A;  3GBA A;  2YRM A;  2F34 A;  3OO8 A;  3C6K A;  1L5T A;  3EF7 A;  2V87 A;  3VK6 A;  1JVX A;  2A5T A;  3CHG A;  2PT2 A;  2ENC A;  1IEJ A;  1X3C A;  2PFY A;  2NXO A;  2B4L A;  5KL6 A;  3TUS A;  2AL4 A;  1M5B A;  4M1V A;  3RTW B;  4DCX A;  2QRY A;  3HQ1 A;  4IB2 A;  1N7X A;  2ZM6 E;  3LC8 A;  3ONM A;  5ET7 A;  3EKI A;  5I3S A;  2AYS A;  5A5X B;  4LF4 E;  4DIG A;  2V84 A;  2EOS A;  4OES A;  1MDQ A;  2WYK A;  3GYY A;  4G61 A;  3FV2 A;  1SI1 A;  2OWS A;  3ISP A;  2J7J A;  1NH8 A;  5TPA B;  5FBP A;  3EPH A;  5AE4 A;  1IUD A;  2PX1 A;  4R6Y A;  4YKK A;  2E1M A;  2EMF A;  2CZK A;  2I3V A;  1N76 A;  1IME A;  4PBQ A;  2WBS A;  1UTH B;  3MW0 A;  1ATG A;  4JWO A;  1UIV A;  4N81 A;  3UN6 A;  3H03 A;  3THI A;  2EM3 A;  3LSL A;  1DK4 A;  4X48 A;  4OEU A;  1LCT A;  2NA2 A;  3PGF A;  4X9T A;  1OQG A;  3MZ9 A;  2O1M A;  4RA1 A;  4LTY A;  2B7T A;  3KZZ A;  4BDO A;  2EL4 A;  3MVW A;  4OX9 E;  1DTG A;  5K2X A;  2CZH A;  5EYG A;  3TQM A;  2UVJ A;  2O51 A;  3LML A;  1CE2 A;  3VVE A;  4H8I A;  3KZY A;  2K7I A;  3J81 C;  2YRK A;  1KA0 A;  4QFO A;  4GX4 A;  1OQH A;  1VDW A;  3K1M A;  1A54 A;  4NWC A;  4MBP A;  1Y3N A;  2QPQ A;  4JI4 E;  2ZYO A;  1NEI A;  1AAY A;  3C36 A;  4R2B A;  1KYQ A;  4QFK A;  4G68 B;  1YXI A;  3F6H A;  3RQT A;  4C1U A;  2RC7 A;  5DT6 A;  4OXV A;  4Q5T A;  3T1B A;  1BIY A;  1R9Q A;  2DYX A;  4IY5 A;  1WRJ A;  2I9I A;  2F3B A;  1POY 1;  4ZED A;  2Z22 A;  2LV2 A;  2EMG A;  4JXI A;  4MLV A;  3MQ9 A;  1MM7 A;  4TUI A;  4DR2 E;  2XXX A;  4N6K A;  4X9J A;  3CFX A;  3M8U A;  3MPK A;  4OA4 A;  3AXF A;  3K4U A;  5DTB A;  4IO7 A;  4KYE A;  4KPT A;  4FE8 A;  2EM8 A;  3ZKK A;  3THN A;  1DBZ A;  4WXD A;  4QXD A;  4GKK E;  1XVX A;  1MRP A;  2EM4 A;  2D9H A;  1LBC A;  1EYK A;  1T0K A;  4POW A;  1SYI A;  3SDF A;  1FQE A;  4Q30 B;  1RKM A;  2WYP A;  2DE3 A;  3KWR A;  2FYI A;  3E9X A;  1DSN A;  4P8B A;  3H6U A;  1UQW A;  5A69 A;  1H43 A;  3U8Q A;  2DSF A;  2EN1 A;  4JI3 E;  3IOW A;  2DIX A;  5A6J A;  5A5L A;  4LU9 A;  2NAB A;  1K9Y A;  5L9O A;  1LAH E;  4R2E A;  4MLQ A;  3JZJ A;  5CMM A;  4Z7E A;  4OVJ A;  3JV9 A;  2H5Y A;  1MXU A;  2EPU A;  3TTM A;  3W9V A;  2UU9 E;  1ZU0 A;  4H65 A;  4QBA A;  4IO4 A;  4IO6 A;  1BKA A;  3K6U A;  2GRV A;  4F19 A;  4R6K A;  3FVN A;  3TYH A;  1SQY A;  3IO6 A;  1NI9 A;  3TQW A;  5AA2 A;  4B3M E;  2UXB E;  2ZYM A;  4R9G A;  1B7H A;  3VV5 A;  1I6Q A;  1YYK A;  1S50 A;  3GLB A;  1WHN A;  1SW2 A;  3OD7 A;  3RN8 A;  1DPE A;  2F4V E;  3JAM C;  1ZAA C;  3UK3 C;  4NX1 A;  2LMZ A;  4JVD A;  4JI5 E;  2CTD A;  2O69 A;  3S9L C;  5FHM A;  4HCY A;  1NFT A;  4PFR A;  4L8N A;  4DCY A;  3G3J A;  3Q25 A;  3FJ7 A;  2JOX A;  2LJU A;  3KZG A;  4ZEB A;  2Y7I A;  4NN3 A;  4RPO A;  4OVS A;  4GWU A;  4JWY A;  5AA2 D;  1B3G A; 
#chains in the Genus database with same CATH homology
 4YB6 A;  3K1P A;  3TCG A;  5JTY A;  2NVU B;  3OSQ A;  3MP6 A;  4OFO A;  4H5F A;  2P2A A;  2NUV A;  2QS2 A;  3FD3 A;  1MQJ A;  3KSX A;  4F2Q A;  3D4C A;  4QF9 A;  3U92 A;  1VR5 A;  3M3L A;  5DVJ A;  4AB6 A;  2D3I A;  5FHO A;  1JNF A;  2UYE A;  5H8N B;  1AMF A;  4YMB A;  1QUI A;  4H8J A;  2F36 A;  3C32 A;  1UTB B;  3E13 X;  4BDM A;  2IA4 A;  1FTL A;  3PV0 E;  3TTR A;  2DOJ A;  3DEL B;  5I2K B;  3TOD A;  1MY1 A;  4GL0 A;  3FAT A;  5HBC A;  1IXI A;  3DP4 A;  2VD2 A;  2XX9 A;  1MM6 A;  1B3E A;  3FZV A;  4TQU Q;  3CRB A;  1O7T A;  1JEU A;  3CSB A;  2DE4 A;  1GGG A;  1EZP A;  1QW0 A;  1LAF E;  4XKR A;  3OMB A;  4ESX A;  4YKI A;  3T9V A;  3T9H B;  4FAT A;  3IOV A;  3PUX E;  1H76 A;  2YJP A;  3L6G A;  3FGS A;  1JW1 A;  1P1Q A;  4RK2 A;  2CMO A;  1KWH A;  3FV1 A;  1BTJ A;  5KDT B;  3UA8 A;  3K6V A;  3UOR A;  3OEK A;  3EQ1 A;  2F6G A;  4R9F A;  4XIG Q;  4OTE A;  4KR5 A;  2H98 A;  1MXV A;  5HPQ A;  3VXB A;  3HPI A;  3TTN A;  4AB5 A;  4RK9 A;  1LB9 A;  3WAE A;  4RJZ A;  4XKQ A;  1EZO A;  4PFW A;  4XXU A;  1VSO A;  4R6H A;  5H8F A;  4MH5 A;  2O84 X;  1N7W A;  5FHN A;  2HEU A;  1B52 A;  2I58 A;  3UIF A;  4FOR A;  3C33 A;  2I0B A;  3BKI B;  1MPC A;  1B2H A;  4GL8 A;  4OEN A;  3CI8 A;  1SYH A;  2RKM A;  4ZEF A;  2VD3 A;  4H0W A;  4DXC A;  3H6W A;  3ILT B;  4FIM A;  3W15 C;  4F29 A;  3B7D A;  1HSE A;  2ESN A;  4KQP A;  4NF5 A;  3K2D A;  3B6Q A;  4DZ1 A;  3D4G A;  3GBB A;  4G8N A;  5CC2 A;  3F11 A;  3K1N A;  3U94 A;  2F7C A;  2ONS A;  4QFN A;  3OOA A;  1NNK A;  4P0I A;  3KSJ A;  2P1S A;  1NNP A;  3SEX A;  3MVY A;  3QXM A;  2RC9 A;  2F35 A;  3K01 A;  3RTF B;  1MQG A;  2B3B A;  1DMB A;  3FXQ A;  3ECR A;  3QSL A;  2LAO A;  2D21 A;  2I48 A;  3E3K A;  3PMV A;  4H5G A;  1B1X A;  3I3V A;  4ZEK A;  4HS7 A;  4PP0 A;  5I2N B;  3CG3 A;  4I1D A;  1VE4 A;  1MXX A;  3A09 A;  1F9B A;  2FNC A;  3TAJ A;  2F78 A;  5A5X A;  3RPW A;  1B3L A;  1VFE A;  2PYY A;  3MVZ A;  4PFU A;  3G3F A;  2THI A;  3KOS A;  5TPA A;  5I57 A;  2XXW A;  1ZTY A;  1OMP A;  4NF4 A;  1UTH A;  4NF6 A;  4X1D A;  3CVG A;  3FUZ A;  3FVK A;  3FVO A;  1MQI A;  4YKP A;  4IO2 A;  4ELO A;  1P99 A;  3TTK A;  3H6V A;  2GHB A;  3OO6 A;  2XXH A;  1BLF A;  2ZNS A;  1ZIU A;  2R9J A;  4KCC A;  3V8X B;  4DXB A;  1FTM A;  3PUZ E;  1Y3Q A;  2ONR A;  5AA4 A;  1LFG A;  5I56 A;  2Y7P A;  1OIB A;  3MUQ A;  5JK4 A;  2RC8 A;  1A8F A;  3LR1 A;  4ELQ A;  3T96 B;  1Y20 A;  3O9P A;  4G2Z A;  1XHY A;  1FQD A;  3SEU A;  3LSX A;  5JEI A;  2F6P A;  3KOT A;  4U1O A;  1PBP A;  1DPP A;  4JSD A;  3H06 B;  1B3H A;  3HHF A;  1QJM A;  1TFD A;  4H6D A;  3H4Z A;  2Q8J A;  3VE1 B;  4NE4 A;  2QS3 A;  1WDN A;  3MVX A;  1USY H;  4R73 A;  1P1U A;  3SEV A;  4N07 A;  2ZNU A;  2HAV A;  4QSD A;  5AA3 A;  3KJ7 A;  1EH3 A;  3LSW A;  4POX A;  4RYA A;  4ZE9 A;  3C31 A;  4X1B A;  5IKB A;  4BLA A;  1M5D A;  2RCB A;  2O68 A;  4LZ5 A;  1SBP A;  4GXA A;  3TCH A;  3M3K A;  1FQC A;  3S2V A;  2V3Q A;  4NTL A;  3ODB A;  5I59 A;  1GTK A;  3QUJ A;  3TPA A;  4FAJ A;  1OLC A;  2HQ0 A;  4NF8 B;  3ILU B;  3B6T A;  5KCJ A;  2X26 A;  2QJE A;  3IOR A;  1XT8 A;  3FVG A;  2R71 A;  3PPQ A;  5H8H B;  1IIW A;  1II5 A;  3CSG A;  4GLI A;  2Q88 A;  3FAS A;  3S9N C;  1O64 A;  1XVY A;  2A5T B;  2DP8 A;  2E1S A;  1B4H A;  2DS9 A;  2DE2 A;  4ZZE A;  5L8D A;  4YIC A;  1PBQ A;  4Q8R A;  2OJT A;  2Q89 A;  4JWX A;  3S9M C;  1B0H A;  3PMW A;  1XS5 A;  2AIX A;  3DLN A;  3DM0 A;  3BFU A;  4BDN A;  1Y1M A;  3N94 A;  1FQA A;  4THI A;  3K00 A;  4EQ9 A;  4E0X A;  3SEY A;  2I6E A;  4LZ7 A;  2VOZ A;  1FTK A;  3M3F A;  3DP8 A;  2Z8D A;  2HAU A;  1B7U A;  4I62 A;  3RY3 A;  3Q26 A;  4LQ2 A;  1RYO A;  4U1Z A;  4H67 A;  2I49 A;  4ZDM A;  3IOU A;  3RGY A;  5CMB A;  5LOM A;  4ECF A;  3PD8 A;  1Z7N E;  3FXR A;  1B7Z A;  3CFZ A;  4KYS A;  4GF8 A;  4P0G A;  4QFL A;  2V93 A;  3L6H A;  2ZXT A;  1PEB A;  3FIR A;  4TLM B;  4ZE8 A;  1D9V A;  4KHZ E;  1NNF A;  3A3C A;  3R7X A;  1SDX A;  1FTO A;  1QUK A;  1NNT A;  1H45 A;  1MXZ A;  4IO5 A;  1J1N A;  1US5 A;  3VDF A;  1N0T A;  3LUY A;  1M5C A;  1MY2 A;  3C35 A;  3MP8 A;  2DXY A;  4GWO A;  4JBZ A;  1A55 A;  1AL3 A;  1BP5 A;  4GRK A;  4UA8 A;  4BDL A;  1FQF A;  3PUY E;  4Z0I A;  3S9E A;  1YPN A;  1JET A;  4DXU A;  4O3A A;  4YB7 A;  4QHQ A;  3KFM A;  3RUM A;  2G93 A;  3RLF E;  4G77 A;  5TP9 A;  3GZG A;  1QKB A;  4KCD A;  1I69 A;  1OVT A;  1B51 A;  5TU0 A;  2QMX A;  1Y3P A;  3QIM A;  1NMU A;  3VXC A;  4M4G A;  4N6P A;  3PMX A;  3OEL A;  1JW5 A;  2REJ A;  3G7W A;  4UAC A;  3K6W A;  3PPP A;  1JEV A;  5BUU A;  1A99 A;  1NL5 A;  4XTC Q;  4JDF A;  4HTG A;  2ZYN A;  2GH9 A;  2Q2C A;  3GXA A;  2XXP A;  1EZ9 A;  3U93 A;  3TEP A;  5AA2 B;  1SW4 A;  3H7M A;  1MY3 A;  4FJP A;  2XXI A;  4GFR A;  2NOO A;  5M2V A;  2VGQ A;  4OQO A;  4O3C A;  4FEC A;  2DWH A;  3RT6 B;  4XKP A;  5ICT A;  3E4R A;  3QAX A;  1LFH A;  1D4N A;  4IO3 A;  2RF1 A;  3CR9 A;  3OEN A;  4QSE A;  4PE5 B;  4EQ7 A;  4RXL A;  5JTY B;  1B6H A;  3T9X B;  1PC3 A;  1ZLQ A;  4KI0 E;  2DWA A;  3UP9 A;  2H25 A;  1Y9U A;  2OK2 A;  4F3B A;  1LAX A;  4XKN A;  3ZKL A;  1YAE A;  3R26 A;  4DDD A;  3T93 B;  4I8C A;  1NH7 A;  4U2R A;  5IAI A;  2O1L A;  3KN8 A;  2OZZ A;  2Z8F A;  3G3H A;  4F3S A;  1WOD A;  1JVY A;  1B9J A;  1B05 A;  1P1W A;  2ANJ A;  2DWJ A;  3KG2 A;  1URS A;  3O6G A;  4ZEC A;  1ZMG A;  2H99 A;  2VP1 A;  5H8Q A;  3PUW E;  2XHD A;  1MH3 A;  2Z23 A;  3T22 A;  3W9W A;  4KYD A;  2YPN A;  3IK6 B;  4U23 A;  5DEX A;  1DTZ A;  3FJM A;  3VVD A;  1QVS A;  5DYH A;  1Q1K A;  2UYF A;  4OZ9 A;  3EHU A;  1S9T A;  1TXF A;  1MQH A;  2F8D A;  1B5J A;  5I58 A;  3A3U A;  3V5A A;  2Y84 A;  3K02 A;  3O2A A;  1A8E A;  2REG A;  2RIN A;  2XXR A;  1ZJL A;  2QS1 A;  4F3G A;  4YU0 A;  2F7A A;  4LQ5 A;  4H1X A;  4ZEI A;  2B3F A;  2QSX A;  1OLA A;  1MDP 1;  4RPN A;  2XX8 A;  4R74 A;  5HM4 B;  5H8F B;  5B7D A;  3R6U A;  5H8S A;  4RNS A;  2O7U A;  5AA1 A;  3MZ1 A;  4C1T A;  1B0L A;  5F7V A;  5CMC A;  4MFI A;  3KEI A;  5K2Y A;  2HFB A;  1B32 A;  2KLF A;  1D3K A;  1VFD A;  1Y4T A;  4U4S A;  2PVU A;  2H4I A;  2XD3 A;  4KFQ A;  2DWI A;  1B5I A;  3B6W A;  2HXW A;  3Q29 A;  4NF5 B;  3HHG A;  1MS7 A;  4OMB A;  1SD3 A;  3N26 A;  5EHM A;  2OWT A;  4R2F A;  4LVQ A;  1AOV A;  1P1N A;  4G68 C;  3IX1 A;  3HST A;  1MY0 A;  2XXY A;  2Q2A A;  3G3K A;  3N5L A;  3HO7 A;  4F18 A;  1YTV A;  4G68 A;  1LST A;  2P0S A;  4EF1 A;  1GR2 A;  4YZZ A;  4K3F A;  2OLB A;  4NMY A;  4L17 A;  4ELP A;  1TFA A;  4ISU A;  1IZ1 A;  3O6I A;  3MJN A;  4EXK A;  1CB6 A;  2AL5 A;  3V89 B;  1I6B A;  2X7Q A;  3SET A;  4LP2 B;  3TFL A;  4IGT A;  4G8H A;  3TQL A;  4WEP A;  1HSJ A;  5CM6 A;  3T66 A;  2HZL A;  3SER A;  3H6T A;  1JW4 A;  1H3D A;  4LA9 A;  3WAF A;  3K0V A;  5I57 B;  3U72 A;  3PPO A;  4U21 A;  3IR1 A;  1LGB C;  3KJT A;  4WED A;  4NF4 B;  4NF6 B;  5ITP A;  1I6A A;  1XOC A;  2XXT A;  1MPB A;  3G3G A;  4FED A;  1IXH A;  3O66 A;  2PT1 A;  3MAM A;  1FQB A;  4QFP A;  1PB8 A;  5AA4 B;  4YMA A;  2NWJ A;  1B3F A;  5I56 B;  3V83 A;  4F31 B;  3MWB A;  3VFJ A;  1B1H A;  3KGC A;  2HZK A;  1QKA A;  2DXR A;  3DP6 A;  4ZZA A;  2DVC A;  2QL3 A;  2DQV A;  3OXN A;  1JQF A;  2QMW A;  3OSR A;  2PMS A;  4EUO A;  3IJO B;  3JYR A;  1Q35 A;  4I9D A;  2ZNT A;  3VLU A;  1SVX B;  3MZB A;  3MBP A;  4HCW A;  2O6A A;  5FTI A;  3TDJ A;  3FXU A;  2Z8E A;  4N13 A;  5H8N A;  4LAT A;  4F3P A;  4OEV A;  4TOZ A;  1M5F A;  1UTB A;  4F1V A;  1Y4C A;  1XC1 A;  3I5O A;  3N6T A;  1O63 A;  3S4U A;  3O6H A;  1AH5 A;  1R1N A;  4GOT A;  1MG1 A;  2ZMB A;  4G8M A;  5I2K A;  1ZBM A;  1A40 A;  1FTJ A;  2XXU A;  2I4B A;  1NKX A;  3OO9 A;  4AQ4 A;  4GXS B;  3CG1 A;  1GVC A;  3EHS A;  1RYX A;  3OO7 A;  2UXA A;  4GD5 A;  3C34 A;  3Q28 A;  3LBS A;  5B70 A;  2I4C A;  5I84 A;  4ESW A;  5J1D A;  1LBB A;  5I59 B;  3IO4 A;  4OET A;  5KDT A;  4RY1 A;  1SI0 A;  5KCJ B;  1P1O A;  3PPR A;  3QK6 A;  3O28 A;  1PDA A;  2UVG A;  4QRZ A;  5CMK A;  3IJX B;  3QUF A;  2M8C A;  3KN3 A;  4R75 A;  4EF2 A;  1UIU A;  3VVF A;  3P7I A;  1IXG A;  1B5H A;  4ELR A;  3IB2 A;  1PB7 A;  5EHS A;  5DVI A;  2F7B A;  5F1Q A;  3CFL A;  4IY6 A;  3IL1 B;  1LB8 A;  4EQB A;  5CBR A;  1EU8 A;  1TWY A;  3BFT A;  1B58 A;  3TEL A;  2DVZ A;  2Q9T A;  3LSF B;  1YCJ A;  3O29 A;  2Y7W A;  1LAG E;  1SW1 A;  1MH4 A;  3U1O A;  3RT8 A;  4O3B A;  4OHN A;  2XXQ A;  2GHA A;  1H44 A;  4MF3 A;  1M5E A;  1TT1 A;  1B46 A;  3Q27 A;  2YLN A;  5L9S A;  2X7P A;  5ELV A;  1DOT A;  4IGR A;  4OFJ A;  2H9B A;  4WKM A;  4GQO A;  1URG A;  4TLL B;  3QYT A;  4OER A;  1B4Z A;  1LLS A;  5KZT A;  4YKJ A;  1N3W A;  3BBR A;  1R9L A;  2A5S A;  2ALU A;  3CIJ A;  2F97 A;  3HCQ A;  1POT A;  1LCF A;  1QUJ A;  1B3G A;  1N84 A;  4HW8 A;  1IIT A;  1FW0 A;  1QUL A;  3IB1 A;  3MP1 A;  4NED A;  5EYF A;  4R72 A;  1Z7M E;  2F5X A;  4DE8 A;  4E0W A;  1R6Z A;  2ONK E;  1MXW A;  1B40 A;  4OFL A;  5FTH A;  5CRY A;  5L9M A;  4FEB A;  5DVF A;  2ABH A;  3O97 A;  2Y7K A;  4G4P A;  2XD2 A;  5ICQ A;  1N3X A;  3FJG A;  1PB9 A;  5I2N A;  4BDQ A;  3UGW A;  4LUB A;  4BDR A;  1N04 A;  4OYV A;  3IB0 A;  3VLV A;  1S7Y A;  3EN3 A;  3IAZ A;  2OCU A;  5BWJ A;  3H3G A;  1HSL A;  1URD A;  3C4M A;  2V3T A;  1Y1Z A;  2UVI A;  2W7Y A;  4U4X A;  4F39 A;  4YAH X;  5TP9 B;  3SEW A;  1AIV A;  4F2O A;  2E0S A;  4WXJ A;  1ELJ A;  4F1U A;  3HV1 A;  5ISU A;  1WVJ A;  2GFE A;  3ZS6 A;  1US4 A;  3TCF A;  1SW5 A;  2ZYK A;  2PBW A;  2G29 A;  4P11 A;  5CI5 A;  2R6G E;  3SKP A;  4PET A;  3PPN A;  1MY4 A;  2RCA A;  3G3I A;  3KN7 A;  5CBS A;  1LFI A;  2CZL A;  1A7L A;  2VHA A;  4C0R A;  4EDP A;  2XX7 A;  3EHT A;  2XXV A;  3PD9 A;  5ITO A;  3VLW A;  4KD5 A;  2B65 A;  1ZKB A;  2FA7 A;  3MC2 A;  2UVH A;  2V3U A;  4LZ8 A;  3MPL A;  4JSO A;  1IQ7 A;  2HCA A;  4F1Y A;  2Y7R A;  4PFY A;  2O7I A;  4YB5 A;  4JB7 A;  1ANF A;  2BJJ X;  4ZS9 A;  1FCK A;  1MQD A;  4GVO A;  3KBR A;  1IXC A;  4QSC A;  4F22 A;  3I6V A;  3TKD A;  2D5W A;  3T9U A;  1OVB A;  5H8Q B;  4EXL A;  3TZA A;  3TTL A;  2I0C A;  4GIZ A;  2I3W A;  3IOT A;  4PFT A;  4ONY A;  3K6X A;  4PQJ A;  1MPD A;  2WKY A;  3SES A;  3N6U A;  5DEX B;  4U22 A;  3USD A;  4LON B;  2V25 A;  4NWD A;  3HN0 A;  4OWD A;  3PUV E;  2QS4 A;  2IEE A;  3OEM A;  2OBG A;  3TMG A;  5I58 B;  3UK4 A;  4NF8 A;  3PU5 A;  4ND9 A;  5H8H A;  4DLD A;  1MXY A;  1GV8 A;  1USY E;  3C9H A;  1D9Y A;  4Q0C A;  3ZSF A;  3RNN A;  3GBA A;  2F34 A;  3OO8 A;  1L5T A;  3EF7 A;  1JVX A;  2A5T A;  2PT2 A;  1IEJ A;  2NXO A;  3TUS A;  2AL4 A;  1M5B A;  4M1V A;  3RTW B;  4DCX A;  2QRY A;  4IB2 A;  1N7X A;  3LC8 A;  3ONM A;  2AYS A;  5A5X B;  4DIG A;  2V84 A;  4OES A;  1MDQ A;  3FV2 A;  1SI1 A;  2OWS A;  1NH8 A;  5TPA B;  5AE4 A;  1IUD A;  2PX1 A;  4R6Y A;  4YKK A;  2I3V A;  1N76 A;  1UTH B;  3MW0 A;  1ATG A;  4JWO A;  1UIV A;  3UN6 A;  3H03 A;  3THI A;  3LSL A;  4X48 A;  4OEU A;  1LCT A;  3PGF A;  4X9T A;  1OQG A;  3MZ9 A;  2O1M A;  4RA1 A;  4BDO A;  3MVW A;  1DTG A;  5K2X A;  2UVJ A;  2O51 A;  1CE2 A;  3VVE A;  4H8I A;  4QFO A;  1OQH A;  3K1M A;  1A54 A;  4NWC A;  4MBP A;  1Y3N A;  2QPQ A;  2ZYO A;  3C36 A;  4R2B A;  4QFK A;  4G68 B;  3RQT A;  4C1U A;  2RC7 A;  5DT6 A;  4OXV A;  4Q5T A;  1BIY A;  1R9Q A;  2DYX A;  4IY5 A;  1POY 1;  4ZED A;  2Z22 A;  4JXI A;  4MLV A;  3MQ9 A;  1MM7 A;  2XXX A;  3CFX A;  3M8U A;  3MPK A;  3AXF A;  3K4U A;  5DTB A;  4IO7 A;  4KYE A;  4KPT A;  4FE8 A;  3ZKK A;  1XVX A;  1MRP A;  1LBC A;  1T0K A;  4POW A;  1SYI A;  3SDF A;  1FQE A;  4Q30 B;  1RKM A;  2DE3 A;  2FYI A;  3E9X A;  1DSN A;  3H6U A;  1UQW A;  1H43 A;  3U8Q A;  2DSF A;  3IOW A;  5L9O A;  1LAH E;  4MLQ A;  3JZJ A;  5CMM A;  4Z7E A;  4OVJ A;  3JV9 A;  2H5Y A;  1MXU A;  3TTM A;  3W9V A;  1ZU0 A;  4H65 A;  4IO4 A;  4IO6 A;  1BKA A;  3K6U A;  2GRV A;  4F19 A;  4R6K A;  3FVN A;  3TYH A;  1SQY A;  3IO6 A;  3TQW A;  5AA2 A;  2ZYM A;  4R9G A;  1B7H A;  3VV5 A;  1I6Q A;  1S50 A;  3GLB A;  1SW2 A;  3OD7 A;  3RN8 A;  1DPE A;  2O69 A;  3S9L C;  5FHM A;  4HCY A;  1NFT A;  4DCY A;  3G3J A;  3Q25 A;  3FJ7 A;  4ZEB A;  3KZG A;  2Y7I A;  4RPO A;  4JWY A;  5AA2 D;  3EPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...