4MLVA

Crystal structure of bacillus megaterium porphobilinogen deaminase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
290
Chain Sequence
SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKLLIDRVKEELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
publication title Structural evidence for the partially oxidized dipyrromethene and dipyrromethanone forms of the cofactor of porphobilinogen deaminase: structures of the Bacillus megaterium enzyme at near-atomic resolution.
pubmed doi rcsb
source organism Bacillus megaterium
total genus 102
structure length 290
sequence length 311
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 4mlvA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlvA02
3T96B 3PD9A 2DOJA 2HFBA 4GL8A 3H7MA 4YB6A 4OFJA 1LBBA 1OVBA 2PT2A 2QS1A 4PFTA 5CM6A 5B7DA 3RUMA 1CE2A 3PPOA 1B9JA 5BWJA 2XXRA 4HCWA 4Q0CA 3TODA 4ZS9A 3OOAA 2ABHA 2F6PA 5ITOA 3CFXA 2RINA 2ZXTA 1D3KA 3IJXB 1JVYA 5DTBA 4XTCQ 3O6HA 1PC3A 2OWSA 1P1OA 2HQ0A 4GIZA 4G68B 3B7DA 2XXXA 4OVJA 3BBRA 4N07A 3IJOB 1LGBC 4WXJA 1B3EA 3ONMA 1VFDA 4JWXA 2XXQA 2VGQA 3PUWE 5EHSA 3MP6A 4NF8B 5CI5A 5I2KB 4KR5A 2Z23A 1MG1A 2I3VA 2YLNA 2UXAA 2QMXA 3TAJA 4ONYA 3O28A 2PBWA 3A3UA 5H8FA 3N6TA 4GQOA 4NF4A 4U4SA 1NKXA 1MS7A 1IUDA 2AL5A 2REJA 4FECA 2ESNA 3EHUA 1EZPA 5DEXB 2YPNA 4YMAA 1LCTA 1M5CA 4OYVA 3EF7A 4U2RA 2PX1A 4O3AA 3TKDA 4ZEDA 4TLLB 2DWHA 4YZZA 4N13A 1XOCA 3TTKA 3K01A 4R2FA 3PPQA 3SEVA 1T0KA 2PT1A 3KOTA 2QRYA 1FQDA 4Z0IA 2HZLA 2FYIA 4G4PA 5AA4A 1PDAA 2THIA 2ANJA 4KFQA 2GHBA 3SETA 4PE5B 4OESA 4YKIA 5A5XB 5JEIA 3GXAA 4F2QA 3FVGA 5FHOA 4JDFA 1ELJA 4QSDA 2V84A 4K3FA 5H8QA 2QS2A 3UK4A 2F5XA 4F18A 1JNFA 3LSWA 4G8MA 1B5JA 5L9OA 1LAFE 2ONSA 3TCFA 4UA8A 3PGFA 4THIA 3PPRA 1Y4TA 2DSFA 3QK6A 1OVTA 3SERA 3DLNA 4IO7A 4F2OA 4ESWA 3EPEA 3T22A 2LAOA 1EH3A 3TUSA 5I57B 1QUJA 2NOOA 4XKPA 4KYEA 3KSJA 4RPOA 1SVXB 3G3FA 1MH4A 4YICA 2NUVA 2DXYA 4P11A 5M2VA 4GWOA 5KCJA 2BJJX 2XD3A 2CMOA 4GXAA 4U1OA 3U1OA 1MDQA 1OMPA 1MH3A 3O97A 4F39A 1URSA 4UACA 5DVJA 4XKNA 1B3FA 4C1UA 3IO4A 4OXVA 1OLCA 3H4ZA 2F8DA 3Q28A 2H25A 2H98A 1L5TA 1Y1ZA 2F36A 3FVNA 4R6YA 4U21A 4EF2A 1PBQA 3S9MC 1QVSA 4DXCA 4HTGA 4DCYA 3OO8A 4ELOA 3GZGA 3KSXA 3HPIA 4NEDA 3S9LC 3HV1A 2RC8A 3F11A 4GOTA 4MLVA 1XS5A 4R73A 3B6TA 1M5BA 1B52A 2Q9TA 4H1XA 4OWDA 1FTKA 4RK9A 1Z7NE 2E0SA 3CRBA 1POTA 3OO6A 4OEVA 3FVOA 2YJPA 4R72A 2UYEA 3QYTA 4QFLA 4JWOA 4Z7EA 1N04A 3DP4A 2V93A 2XXUA 4BDMA 3CSBA 2DWIA 1P1UA 5CBSA 2DWAA 5LOMA 1WDNA 3U92A 1N7XA 4F29A 1H3DA 3ZKLA 3JV9A 5AA4B 1SYIA 3K6XA 2QS4A 1LB8A 4I62A 1MQHA 3EHSA 2ZMBA 4EXLA 5IAIA 1R9LA 2G29A 4FE8A 4KHZE 1I6BA 4EF1A 1DMBA 1SDXA 2Y7RA 2ONKE 1D4NA 2Z8EA 4DXUA 3K6VA 3MPLA 1MQGA 1J1NA 4KCCA 4OETA 5CMKA 1N3XA 3ILUB 4MF3A 3K1PA 4G68A 4JB7A 4LZ7A 1B05A 2DYXA 2GRVA 2H99A 2FA7A 3R6UA 1D9VA 1POY1 5FHMA 4POXA 4ZEBA 3GLBA 4LQ5A 1WVJA 4NF8A 5I2KA 1SW1A 3T66A 1XVXA 3LSFB 2G93A 1P99A 2OZZA 1BIYA 1IEJA 4ND9A 1JETA 5I56B 3H06B 2REGA 1QJMA 5DVIA 5ICQA 5DEXA 5KZTA 4EUOA 1B7ZA 3W9WA 3N26A 4F3PA 3CSGA 3O66A 2VHAA 4LONB 4XXUA 4XIGQ 4FEDA 3T9UA 3TCGA 2HAUA 2ZYNA 1DPPA 3SEXA 3EHTA 3QSLA 5CMBA 2D3IA 1YAEA 4ZDMA 1DOTA 3OD7A 1B0LA 1GR2A 1VFEA 3THIA 2DXRA 1FW0A 3MZBA 4F3BA 5TP9B 2R9JA 5FHNA 2V3QA 5CMCA 1HSJA 1MQJA 3CVGA 4EQ9A 1MXZA 2X26A 1ATGA 4H67A 1A8FA 5A5XA 3IX1A 4R9GA 4XKRA 3HCQA 1FTMA 4O3BA 2DE4A 3M3FA 3CFZA 4ELRA 1Y20A 3C4MA 4R75A 2RC9A 1QKBA 1MXUA 2D21A 1IXIA 1ANFA 3G3JA 3VV5A 1MPDA 3TFLA 2ZYMA 5H8SA 3T9XB 5ELVA 3IB1A 1UIUA 1IXGA 1ZMGA 3UP9A 3PPNA 3OXNA 3JYRA 3VFJA 1S50A 4QFPA 3HO7A 2F34A 5I57A 2R6GE 2IA4A 2ZNSA 2GHAA 4WEDA 3PUXE 3RT6B 3C34A 2DVCA 3FVKA 4PETA 1FTLA 3CI8A 3TTLA 4OZ9A 5CC2A 1TXFA 3VXCA 4AB5A 4ESXA 2Y7PA 2Q2AA 1MY2A 1N3WA 3K6WA 2HAVA 3S4UA 4N6PA 1A55A 3RTFB 3DP6A 3UGWA 1QUIA 1A40A 4U4XA 3ZKKA 3C32A 3VXBA 4ZECA 2XXTA 1MQDA 3G3IA 2Y7WA 3VE1B 1DTZA 3TQLA 3TCHA 4OFOA 4YB7A 3BFUA 1AMFA 3IB2A 3DM0A 3TDJA 3FXUA 3IOWA 1USYE 1URGA 3MVWA 3QXMA 4IO2A 4KPTA 2XX9A 3BFTA 3SEWA 3B6QA 4R6KA 4KYDA 1LFGA 3W15C 4JWYA 2UVGA 1VE4A 4WEPA 4EQ7A 1EZOA 5HPQA 1IIWA 2I6EA 4H5GA 4DIGA 1BP5A 2NVUB 2XX7A 3PMXA 3O6GA 1SQYA 2AL4A 1I69A 3FXQA 3I5OA 3Q25A 4MH5A 1NMUA 3TQWA 3FIRA 3K1MA 3RT8A 2V3UA 3V8XB 4GLIA 2V25A 2V3TA 2O51A 3PMVA 4G8HA 2XXVA 2DE3A 4I8CA 2A5TB 2D5WA 2O84X 1SW5A 1P1QA 2F7BA 3C31A 4LP2B 3Q27A 2RF1A 3N94A 4PFUA 2WKYA 1FCKA 2QL3A 2I0BA 3PUVE 1JW5A 3JZJA 3RLFE 5DVFA 1IXCA 2I4BA 3O29A 1MPCA 4F19A 2HZKA 4NMYA 4KD5A 3K6UA 4NTLA 3MP1A 1ZLQA 4GVOA 5FTHA 2B3BA 4YKPA 3SEYA 1P1WA 4QFNA 1TFDA 4QSEA 1SD3A 2ZNTA 4FAJA 3I6VA 2OWTA 4IO6A 2B65A 3G7WA 1DPEA 4NWCA 5I56A 2VD2A 1N84A 3G3GA 3IOUA 3OEKA 1B5IA 4ECFA 1UIVA 3PUYE 2DE2A 5JK4A 2DS9A 1VSOA 5AA2D 2Y7KA 3QIMA 4RA1A 3UN6A 4BDNA 1D9YA 2O1MA 4YMBA 2AIXA 1B1HA 1N76A 2OJTA 1M5FA 1UTHB 2Z22A 4ZZEA 4DXBA 1Y4CA 3M8UA 2O1LA 1B58A 4OFLA 1B51A 2DVZA 1B5HA 3K1NA 4I1DA 1USYH 4XKQA 1B3HA 3A09A 3BKIB 1O63A 5TP9A 2O7UA 4ISUA 5I59B 3HSTA 3KN7A 1LAXA 4IO3A 4EXKA 4FJPA 5HM4B 2ZYKA 3ZSFA 2OLBA 1ZIUA 1SI0A 3UA8A 4C1TA 3PMWA 1M5DA 2UVJA 1UTBB 1LFHA 2R71A 5I58B 1SW2A 1Y3NA 5HBCA 4DZ1A 4QSCA 1NH8A 1FQAA 1LLSA 2PYYA 2XHDA 5B70A 5J1DA 3KBRA 1LCFA 4LA9A 3VVEA 1RYXA 1B46A 3FD3A 3G3HA 1F9BA 5F1QA 2Z8DA 1JEUA 1NNPA 4DCXA 4BDRA 3IORA 5KDTB 2E1SA 4JSOA 1Q35A 1QW0A 4BDOA 3GBAA 3TYHA 1B7UA 1FQBA 1A54A 4NF5B 3HHFA 3ILTB 4FIMA 1OLAA 3MVZA 1S7YA 2P0SA 1PB7A 4ZEIA 2KLFA 4ZEKA 3IO6A 1NNKA 3KN3A 2Y7IA 1MXVA 3CFLA 3H6VA 3TTRA 3ODBA 4H8IA 3A3CA 3VLWA 3TTNA 2XXPA 2I49A 1OQHA 5L8DA 2ZNUA 3C35A 3VVFA 3IOVA 1EZ9A 4KQPA 3CG3A 3TEPA 5I2NB 4F22A 4I9DA 2IEEA 3H6UA 5AE4A 2RCAA 3RGYA 1TT1A 1XT8A 1VR5A 3K02A 4R74A 1PB8A 4NE4A 1GTKA 2F6GA 2CZLA 3VLVA 1A8EA 3E3KA 4Q30B 2QSXA 4RNSA 1HSLA 1JW1A 4PFYA 3EQ1A 3SDFA 1NH7A 1MM6A 3MZ1A 4G77A 2VP1A 1JQFA 1US5A 2I48A 4FATA 4IGTA 4U22A 3TZAA 3R7XA 2F35A 4QFKA 2DWJA 1MPBA 1B40A 3C36A 4LQ2A 2H9BA 4MFIA 1QKAA 4RYAA 4HS7A 1AH5A 5CRYA 2Q89A 3MW0A 3V83A 3MZ9A 4YKKA 3MVXA 3UORA 2H5YA 2GFEA 4TOZA 2A5TA 4QHQA 2QMWA 5AA3A 1KWHA 3K2DA 1FQCA 1AOVA 2QS3A 1BKAA 3O9PA 5BUUA 2HEUA 4H5FA 1II5A 2ONRA 4OHNA 2O68A 3FV1A 1B0HA 5TPAB 1GGGA 3USDA 4MLQA 3L6HA 1DSNA 4C0RA 1AL3A 3MP8A 3IR1A 3O2AA 5DYHA 2B3FA 2UVHA 3U72A 5AA2B 5JTYB 3KJTA 4OERA 3OSQA 1B4ZA 3D4GA 4F3SA 2XX8A 4X1DA 3LR1A 4YAHX 2I4CA 1FQEA 4PP0A 3DP8A 3E4RA 4OMBA 3WAFA 3O6IA 2ZYOA 1B6HA 2PMSA 1RYOA 3SEUA 3N6UA 2Y84A 3IOTA 3FJ7A 1MQIA 3KGCA 2XXHA 5ITPA 4ZZAA 2ALUA 4Q5TA 4LUBA 4H65A 2NWJA 1UTHA 5AA1A 2F7CA 3B6WA 3LC8A 3SKPA 4BDLA 4Q8RA 4RPNA 1B2HA 4QRZA 4H8JA 3C33A 5TU0A 3CG1A 4EDPA 1XC1A 3KJ7A 4X1BA 1SI1A 4RXLA 4ZE9A 3MJNA 2A5SA 3EN3A 3OO7A 1R6ZA 4H0WA 2I58A 4OQOA 5I59A 2DQVA 1CB6A 3LSLA 3TMGA 3MVYA 1IXHA 1SW4A 3FJMA 3H3GA 5IKBA 2RKMA 1UTBA 1H76A 3RNNA 5L9MA 4H6DA 3WAEA 1LAHE 3FXRA 5I58A 3R26A 2RC7A 5L9SA 1Q1KA 4X48A 4G8NA 4BDQA 4U1ZA 1BLFA 2FNCA 4P0GA 1URDA 3S2VA 1EU8A 1PEBA 1FTJA 2XD2A 4NF6B 1MRPA 4RJZA 1FQFA 5ICTA 3OMBA 2DP8A 3E9XA 5CMMA 1UQWA 2OCUA 3HN0A 3K00A 4F3GA 1RKMA 2GH9A 5KDTA 1R9QA 2F7AA 4FEBA 4KYSA 4JXIA 4PFWA 4NF5A 4G2ZA 1LFIA 3V89B 1DTGA 3PUZE 3RY3A 1TFAA 1MXXA 1JVXA 3HHGA 2QPQA 1YPNA 4ELPA 1YCJA 1B3LA 3KN8A 3D4CA 4DE8A 3RTWB 2XXWA 1S9TA 1NNTA 1NNFA 2OK2A 5EYFA 3TPAA 1MY3A 5H8HB 3PPPA 5H8NB 3LUYA 2VOZA 2VD3A 4GL0A 4M4GA 3DELB 1XVYA 1GV8A 5ISUA 4GRKA 1A99A 3OEMA 5I2NA 2OBGA 3VDFA 1MXYA 1YTVA 4HCYA 2P1SA 4JSDA 3VLUA 2X7QA 1ZU0A 3IAZA 4GF8A 3M3KA 1I6AA 2Q8JA 2W7YA 3K0VA 2X7PA 2XXIA 3OELA 4E0WA 4LVQA 1JW4A 1MM7A 3QAXA 5EHMA 3CR9A 4IB2A 3QUJA 3OO9A 2PVUA 1OQGA 1ZBMA 1Y1MA 3TTMA 4F1UA 4FORA 3T9HB 3V5AA 4JBZA 4O3CA 1B32A 2F78A 4AB6A 3G3KA 2F97A 3MPKA 1IQ7A 4DLDA 1H43A 4WKMA 4F1YA 4DDDA 3UIFA 2NXOA 3PV0E 5H8FB 4NF4B 4TLMB 5FTIA 3MAMA 3IB0A 1GVCA 2RCBA 3H6WA 1I6QA 1B3GA 3AXFA 4GD5A 3U94A 2M8CA 3W9VA 2HCAA 1A7LA 5TPAA 3TELA 3FZVA 5I84A 4IO4A 4ZEFA 4G68C 1MY0A 3ECRA 4YB5A 3C9HA 4X9TA 4IO5A 1H44A 4HW8A 5CBRA 2AYSA 1Z7ME 1M5EA 1MY1A 4IY5A 5AA2A 5JTYA 1TWYA 3S9NC 2I3WA 3MC2A 1MY4A 3LSXA 1IITA 3KG2A 3P7IA 3KZGA 1PBPA 5K2XA 1QULA 2HXWA 1MDP1 1ZJLA 4LATA 3GBBA 4OEUA 4EQBA 4RK2A 3U8QA 1ZTYA 3OENA 2I0CA 4R2BA 2Z8FA 3FGSA 4F31B 4IY6A 3Q26A 1XHYA 3ZS6A 3K4UA 4R6HA 3KOSA 3OSRA 1B4HA 1NL5A 3I3VA 3KEIA 4MBPA 2O7IA 1WODA 5H8QB 1PB9A 4LZ8A 5K2YA 1NFTA 3FASA 3PD8A 1SYHA 2XXYA 1N0TA 5F7VA 4POWA 4OTEA 1JEVA 4KI0E 4U23A 2O69A 3IL1B 1US4A 3RN8A 4QF9A 3FJGA 4ELQA 3VVDA 1SBPA 4GXSB 1LB9A 4GFRA 4LZ5A 3N5LA 1B1XA 1Y3PA 1IZ1A 3U93A 4KCDA 3T9VA 3S9EA 1QUKA 1N7WA 3H6TA 1LSTA 3RPWA 4P0IA 1O7TA 1ZKBA 4E0XA 4R9FA 4AQ4A 1R1NA 4NF6A 4YKJA 5KCJB 4BLAA 4L17A 1BTJA 4RY1A 4QFOA 1B7HA 4IGRA 3KFMA 5DT6A 2UVIA 4TQUQ 3MUQA 3M3LA 2O6AA 3CIJA 2H4IA 4F1VA 3MWBA 3FUZA 1MXWA 3PU5A 3T93B 1O64A 3L6GA 2UYFA 1AIVA 3Q29A 3FV2A 1Y9UA 4PQJA 1H45A 3SESA 1Y3QA 4NWDA 3MQ9A 1LBCA 4OENA 4YU0A 3RQTA 2P2AA 3IK6B 4M1VA 2Q2CA 2Q88A 1LAGE 3E13X 3FATA 3QUFA 2QJEA 5H8HA 3MBPA 5H8NA 3H03A 4ZE8A 3LBSA 1P1NA 1OIBA 1HSEA 1FTOA
chains in the Genus database with same CATH superfamily
4NX1A 2WBBA 3T96B 3PD9A 2DOJA 4LFAE 2HFBA 2EPMX 4GL8A 2L3CA 3H7MA 2L2NA 5A6BD 1IQOA 3DF6A 4JVDA 2QVVA 4YB6A 4OFJA 1LBBA 2LTRA 1OVBA 3ZOQB 2LBSB 3FXBA 2FVZA 2PT2A 2QS1A 4PFTA 5CM6A 5B7DA 3RUMA 1CE2A 3PPOA 3J7Yp 1B9JA 5BWJA 1VDWA 2XXRA 4HCWA 1IMBA 4Q0CA 3TODA 4ZS9A 3OOAA 2ABHA 2F6PA 5ITOA 4N8GA 5AE1A 4DV5E 3CFXA 2CT1A 2RINA 2ZXTA 1D3KA 1IMEA 3IJXB 1JVYA 1FKAE 5DTBA 2A25A 4XTCQ 3ADIA 3O6HA 2DRPA 1FBPA 1WRJA 1PC3A 4QBAA 2OWSA 3FIGA 2HHMA 4DUZE 1FPKA 4R03A 1P1OA 4R2DA 2HQ0A 4GIZA 4YHHE 1XNRE 4G68B 3B7DA 2XXXA 4O5GA 2EMAA 4JI4E 4OVJA 1FPFA 1G2FC 3BBRA 4N07A 3IJOB 1LGBC 4WXJA 1B3EA 3ONMA 1VFDA 4JWXA 2XXQA 2VGQA 3PUWE 3B50A 5EHSA 1SPIA 3MP6A 4NF8B 5CI5A 5I2KB 4KR5A 2Z23A 1MG1A 2I3VA 2YLNA 2UXAA 2LVHA 2QMXA 3TAJA 4ONYA 3O28A 2PBWA 3A3UA 5H8FA 3N6TA 4DV0E 4GQOA 4NF4A 4BS9A 4U4SA 1NKXA 1MS7A 4BHCA 1IUDA 4O94A 3HQ1A 1WHNA 1EYJA 4J8ZA 2AL5A 2REJA 4FECA 2ZZVA 1IBLE 2ESNA 2EPUA 1ZAAC 1EH7A 3EHUA 1EZPA 5DW8A 2F3BA 3BBGA 4GEQB 1X48A 5DEXB 2JR1A 2YPNA 4YMAA 1LCTA 2H36X 4AQYE 5A69A 1M5CA 4DV7E 4OYVA 2EN3A 1N34E 2Y5KA 1A1JA 3EF7A 4U2RA 4N6KA 1CNQA 2PX1A 4NXME 2EOJA 4O3AA 4JI8E 4F6MA 3TKDA 4ZEDA 4TLLB 2DWHA 4YZZA 4GX4A 4N13A 2ELYA 1XOCA 1DQ3A 3TTKA 5IZ3A 3K01A 4R2FA 1DI2A 2N8XA 4XF5A 3PPQA 3SEVA 2LUPB 1UN6B 4PFIA 1T0KA 2PT1A 3KOTA 2QRYA 2LT7A 1FQDA 4Z0IA 2HZLA 1NUWA 2FYIA 4G4PA 5AA4A 1PDAA 2THIA 2ANJA 4KFQA 2GHBA 3J81C 3SETA 4PE5B 2HXRA 4DR3E 4OESA 4YKIA 5IM2A 5A5XB 3C4BA 5JEIA 3GXAA 4F2QA 3FVGA 5ADZA 4GBVA 5FHOA 4JDFA 1ELJA 2E72A 3J7AG 4QSDA 4DV2E 2V84A 4K3FA 5H8QA 2QS2A 3A29A 1B69A 1LBWA 3UK4A 1IMUA 2F5XA 4JI7E 4F18A 1JNFA 4OANA 4TUGA 2PFZA 3LSWA 2M7QA 4G8MA 4K0KE 1F2IG 1B5JA 5L9OA 3HXLA 1LAFE 1NEIA 2NUEA 2ONSA 4PCDA 2JY9A 3TCFA 4UA8A 3PGFA 4THIA 2RS7A 3PPRA 1Y4TA 2DSFA 3QK6A 1OVTA 3J80C 3SERA 3DLNA 4IO7A 2QFLA 4F2OA 4ESWA 3EPEA 3T22A 1NV0A 2YZTA 2EPZA 1EH3A 2LAOA 3TUSA 5I57B 2QVUA 1T4LB 1QUJA 4HE2A 2EQ1A 2JP9A 1FPGA 4OVSA 4N15A 2NOOA 4X04A 4MHFA 4XKPA 4KYEA 3OTOE 3KSJA 4RPOA 1SVXB 3G3FA 3T0JA 1MH4A 4YICA 1UILA 2NUVA 2DXYA 4P11A 5M2VA 4GWOA 1BBOA 4MX6A 5KCJA 2BJJX 2XD3A 2CMOA 4GXAA 4U1OA 3U1OA 2V85A 1MDQA 1OMPA 1MH3A 3O97A 1TN9A 1URSA 4F39A 4UACA 5DVJA 4XKNA 1B3FA 4C1UA 2D9HA 1FBDA 3IO4A 4OXVA 1OLCA 3H4ZA 2UXDE 4DR4E 1J26A 2F8DA 3Q28A 2H25A 2WBDA 3DJWA 2XWOA 2H98A 4PFRA 1L5TA 5LL6R 1KJKA 1Y1ZA 3HTXA 2F36A 3FVNA 4R6YA 2EL5A 4U21A 4KZSA 3ADJA 1D9QA 1NV4A 4EF2A 2EN7A 1PBQA 3S9MC 1QVSA 2WZOA 4PFBA 4DXCA 3MHHC 2YTNA 5J16A 4P8BA 4HTGA 4DCYA 3OO8A 4ELOA 3GZGA 4OVTA 3KSXA 3HPIA 4NEDA 3S9LC 1YZ0A 2RC8A 3HV1A 3F11A 2V89A 4MLVA 4GOTA 5EYHA 1XS5A 1HNWE 3IFCA 4R73A 4I8OA 4O7IA 3B6TA 2K7IA 4WX9A 1EYIA 1M5BA 1B52A 2JYAA 4M30A 2Q9TA 4H1XA 4OWDA 1FTKA 4RK9A 1Z7NE 2E0SA 4JI6E 3CRBA 1POTA 5I5PA 2ADRA 3OO6A 4OEVA 3FVOA 2JXPA 2YJPA 4R72A 2UYEA 3QYTA 4QFLA 4JWOA 4Z7EA 1N04A 2P3NA 2L6MA 3DP4A 4P7DA 2V93A 1DBZA 2XXUA 4BDMA 3CSBA 2DWIA 1FBFA 2Y5LA 1P1UA 2K4VA 5CBSA 2DWAA 3BGHA 5LOMA 1YYOA 1WDNA 4N81A 3U92A 1EKZA 1N7XA 4F29A 1H3DA 3ZKLA 3JV9A 3OMLA 5AA4B 1SYIA 3K6XA 2QS4A 1LB8A 4I62A 2EMLA 1MQHA 4O43A 2EPOA 3EHSA 2ZMBA 4EXLA 2HGHA 3VHTB 5IAIA 4R2PA 4DR7E 1R9LA 2G29A 4FE8A 1ZBQA 4KHZE 1I6BA 4EF1A 2EL6A 1DMBA 1SDXA 2Y7RA 2ONKE 1D4NA 1XNQE 5KL5A 4R8OA 2Z8EA 4DXUA 5IT9C 4X8RA 5F3WA 3K6VA 3MPLA 4LF7E 1MQGA 1J1NA 4X9JA 4KCCA 4OETA 1N3XA 5CMKA 3ILUB 2NABA 1DK4A 4MF3A 3K1PA 4G68A 1NUZA 4JB7A 4LZ7A 4PDHA 1B05A 2DYXA 2GRVA 2H99A 4OOGC 2FA7A 3R6UA 1D9VA 1POY1 2HC5A 4XFEA 4POXA 5FHMA 4ZEBA 3GLBA 4LQ5A 1WVJA 2VPOA 4NF8A 5I2KA 1SW1A 2YWQA 2MC6A 3T66A 2KOUA 1XVXA 3LSFB 2G93A 4N6DA 1NUYA 1P99A 2OZZA 1BIYA 5AASA 5A5LA 1BK4A 1IEJA 4ND9A 1JETA 2YTQA 5I56B 3HPSA 3H06B 3IWDA 2REGA 1QJMA 1JK2A 1LBVA 3RMPA 1KZ8A 5DVIA 2BJIA 1NV6A 5ICQA 2MKNA 4GWXA 5DEXA 2I13A 5KZTA 2NA2A 4EUOA 2FIXA 1B7ZA 3W9WA 3N26A 4F3PA 3CSGA 3O66A 5IWAE 2VHAA 4LONB 4XXUA 4XIGQ 4FEDA 3T9UA 3TCGA 2HAUA 2ZYNA 4P56A 1DPPA 3SEXA 3EHTA 3LV0A 2WBUA 2BB8A 1X3CA 4OX9E 1EYKA 3QSLA 5CMBA 3VYYA 4JYAE 2UXBE 2D3IA 4MNPA 1A1GA 2OX3A 1YAEA 4ZDMA 1DOTA 3OD7A 3T1HE 1B0LA 1GR2A 1VFEA 3THIA 2DXRA 1FW0A 2L2MA 4LN5A 4BMJA 1RQ0A 3MZBA 4F3BA 5TP9B 2RQLA 2R9JA 5FHNA 2V3QA 5CMCA 1HSJA 1MQJA 3CVGA 4PDDA 2EMKA 4EQ9A 2J7JA 1MXZA 2EMFA 2X26A 1ATGA 4IS1C 4H67A 4DV6E 1O0WA 2DIXA 1A8FA 5A5XA 3IX1A 2EM0A 1FPDA 4R9GA 4DR2E 4XKRA 3VYXA 3HCQA 2L33A 1FTMA 4O3BA 2FHYA 2DE4A 3M3FA 4GX6A 3CFZA 4ELRA 1Y20A 4LFBE 3C4MA 4R75A 2RC9A 1QKBA 1MXUA 2D21A 2B3TB 1IXIA 1ANFA 2ELZA 4N4RB 1HNZE 3G3JA 3VV5A 3IFAA 4O7MA 1MPDA 3TFLA 2ZYMA 3D1RA 3IWCA 5H8SA 5IZ1A 4PF6A 3T9XB 2DGCA 1FPEA 5ELVA 3IB1A 3F6GA 1UIUA 2WBTA 4XEQA 2B4MA 1ZBTA 1IXGA 3L00A 3RYDA 5IGAA 1ZMGA 4NHBA 5KL7A 4DUYE 2LJHA 3UP9A 4MMPA 2EPPA 5CFFE 3PPNA 4JI0E 3HPZA 3OXNA 3JYRA 3VFJA 5LMNE 4OVQA 1S50A 4NQ8A 2DLQA 4QFPA 3HO7A 2F34A 4WSPA 4MEVA 5I57A 2R6GE 2M1SA 2IA4A 2ENHA 2ZNSA 2GHAA 4WEDA 3PUXE 2VE7C 3RT6B 2MC5A 3C34A 2EM3A 1LEVA 2DVCA 3FVKA 4PETA 1FTLA 1GZ6A 3CI8A 3TTLA 4OZ9A 5CC2A 1A1LA 2EJ4A 1TXFA 4JVCA 3VXCA 4AB5A 4ESXA 2Y7PA 2Q2AA 1MY2A 1N3WA 3H09A 3K6WA 4EQBA 2HAVA 3S4UA 4N6PA 2GQ1A 2XXKA 5TSEA 1LBXA 1A55A 3RTFB 3DP6A 3UGWA 1QUIA 3FBPA 1A40A 4U4XA 4PGPA 3NOHA 1YYWA 3ZKKA 3C32A 5T6JA 3VXBA 4ZECA 3JAMC 4X62E 2EMXA 2XXTA 1MQDA 3G3IA 4ZYDA 2EOYA 1JK1A 2Y7WA 3VE1B 1DTZA 3TQLA 3TCHA 4OFOA 4YB7A 3BFUA 1AMFA 3IB2A 1QNTA 4HE1A 3DM0A 4B3RE 3TDJA 3FXUA 3IOWA 4R2QA 1USYE 1URGA 2R76A 5A6BA 3MVWA 3QXMA 3ROJA 2CZHA 4IO2A 2R1FA 4KPTA 1K9ZA 2XX9A 3BFTA 3KC1A 3SEWA 3B6QA 2EPRA 1N33E 1IMDA 4R6KA 2B7VA 4KYDA 1LFGA 1NV7A 3W15C 4JWYA 2UVGA 1VE4A 2FV4B 4WEPA 2FBPA 4EQ7A 4WYQB 1EZOA 5HPQA 1IIWA 2I6EA 4H5GA 4DIGA 1BP5A 2NVUB 3RPLB 5IXMB 2XX7A 3PMXA 4GKKE 3O6GA 1SQYA 2AL4A 1I69A 3FXQA 3I5OA 3E79A 4HXVA 4JI1E 3AUZA 3Q25A 2LUQA 4MH5A 3GYYA 1NMUA 3EPLA 5ET5A 3TQWA 2NUGA 3FIRA 1LBYA 2WYKA 3K1MA 2RSMA 3RT8A 2V3UA 3V8XB 4GLIA 2V25A 1XMQE 2V3TA 2O51A 3PMVA 5F24A 4G8HA 2YTGA 2XXVA 2DE3A 4I8CA 2YTOA 1PJTA 4F9AB 2A5TB 2D5WA 2O84X 1SW5A 1P1QA 2F7BA 3C31A 4LP2B 3Q27A 2L2KB 4OA4A 2RF1A 2XWVA 3N94A 4PFUA 2WKYA 1FCKA 1NUXA 1MGTA 2LE2A 1X47A 4R2EA 2QL3A 2I0BA 3PUVE 2ODRD 4ZYEA 1JW5A 3JZJA 3RLFE 5DVFA 1IXCA 2I4BA 3O29A 1MPCA 4BBYA 4F19A 2JOXA 4GWWA 4NG7A 2HZKA 4NMYA 4KD5A 3KBZA 3K6UA 3QMFA 2EOMA 2DSYA 1G0IA 2WX9A 2ODRC 4NTLA 3MP1A 1ZLQA 2ZZXA 4GVOA 5AE3A 5ET7A 5FTHA 2B3BA 4YKPA 1NV1A 2DMYA 3SEYA 2GPIA 2LMZA 2N3HA 1P1WA 4QFNA 4P78A 1TFDA 4QSEA 1SD3A 2ZNTA 4FAJA 3I6VA 2OWTA 4OVPA 4IO6A 2F4VE 2B65A 1SFEA 3G7WA 1DPEA 4NWCA 4OVRA 5I56A 4PAIA 2VD2A 1N84A 3G3GA 3IOUA 3OEKA 1B5IA 4ECFA 1UIVA 3PUYE 2DE2A 5JK4A 2DS9A 4FBPA 1VSOA 5AA2D 2Y7KA 4HE0A 3QIMA 4RA1A 4LF6E 1RC7A 1T4NA 5EQAA 3UN6A 1LBZA 1FBEA 2YTFA 4BDNA 1D9YA 2O1MA 4YMBA 5ET8A 2EE8A 2AIXA 1B1HA 1N76A 2OJTA 1M5FA 2LRSA 1UTHB 1X6FA 2PCRA 1DGCA 2VRDA 2Z22A 4ZZEA 4DXBA 1Y4CA 3M8UA 2O1LA 1B58A 4OFLA 2YU5A 1B51A 4BCAA 2DVZA 1B5HA 5IZZA 1UBDC 3K1NA 3P1XA 2EPNA 4I1DA 2EP3A 1USYH 4XKQA 2EMBA 1B3HA 3A09A 3BKIB 1O63A 5TP9A 2JPAA 3MHSC 2O7UA 4ISUA 5I59B 3HSTA 3KN7A 1LAXA 4IO3A 2V87A 4EXKA 4FJPA 5HM4B 3MYUA 2ZYKA 3ZSFA 2OLBA 2V8QB 2YRHA 2GHFA 1ZIUA 4GZNC 2PFYA 1SI0A 3UA8A 4C1TA 3PMWA 2E1MA 1M5DA 2UVJA 1EH6A 1UTBB 4R2CA 4LF5E 1LFHA 2R71A 5I58B 3JU0A 1SW2A 1Y3NA 5HBCA 4DZ1A 4QSCA 1NH8A 3MSTA 1FQAA 1LLSA 2PYYA 2XHDA 5B70A 2YSPA 4NHRA 5J1DA 2EMYA 3KBRA 4GBWA 3C4TA 2EN1A 1LCFA 4LA9A 3VVEA 1RYXA 1B46A 3FD3A 4IR8A 2V4CA 4LTYA 3G3HA 1F9BA 2V86A 1BB8A 5F1QA 2Z8DA 1JEUA 1A1KA 1FBGA 1NNPA 4DMIA 4P47A 4DCXA 4BDRA 3IORA 2VQFE 2EM9A 5KDTB 2E1SA 4JSOA 3C6MA 1Q35A 1I94E 1QW0A 4BDOA 3GBAA 3TYHA 1B7UA 1FQBA 1A54A 4NF5B 2G7HA 3B8BA 3HHFA 3ILTB 4DI3D 3BIHA 4FIMA 1OLAA 4JV5E 3MVZA 2I9IA 1S7YA 2P0SA 1PB7A 4ZEIA 2KLFA 4DKKA 4ZYGA 4N4UA 4ZEKA 3IO6A 4PAFA 2KONA 1NNKA 3MSWA 1T39A 2EPXA 2N3GA 3KN3A 4L5NC 2Y7IA 4M0VA 5KL4A 1MXVA 3CFLA 1TF6A 3H6VA 3TTRA 3QG5C 3ODBA 4H8IA 4AS5A 3ISPA 3A3CA 4NXNE 2GLIA 3VLWA 3TTNA 2XXPA 4GKJE 2F3DA 2I49A 1BBGA 4GWUA 1OQHA 2EOOA 5L8DA 2HPGA 2ZNUA 3C35A 3VVFA 3IOVA 1EZ9A 4KQPA 3LLHA 2CEXA 3CG3A 3TEPA 5I2NB 4F22A 4I9DA 2IEEA 3H6UA 5AE4A 2RCAA 3RGYA 1FPJA 2BBGA 5A2QC 3BIGA 2MDGA 1FTAA 1TT1A 1XT8A 4MNIA 2XWIA 1VR5A 2B9DA 3K02A 1PB8A 4GWSA 4R74A 1YYKA 3SZPA 4NE4A 1GTKA 2YTDA 2F6GA 2EPAA 2YRMA 2CZLA 2Q74A 3VLVA 1A8EA 4I3YA 3E3KA 4Q30B 5I3SA 2EOIA 2QSXA 2EPCA 2UXCE 4RNSA 1FPBA 1HSLA 1JW1A 4PFYA 1IQSA 4B3ME 3EQ1A 3SDFA 1NH7A 1MM6A 3MZ1A 2WYPA 4G77A 2VP1A 1JQFA 1US5A 2I48A 4FATA 1KA0A 4N91A 4IGTA 4GWZA 2EN2A 4U22A 3TZAA 3RPLA 3R7XA 2F35A 2IHR1 4JI3E 4QFKA 2ZM6E 2DWJA 1MPBA 2ENAA 1B40A 3C36A 1FBHA 4LQ2A 2H9BA 4N17A 2FIEA 4MFIA 2EN6A 1QKAA 4RYAA 4HS7A 1AH5A 5CRYA 2Q89A 3MW0A 3V83A 4HEIA 3MZ9A 4YKKA 2UUAE 3MVXA 3UORA 1AWBA 2H5YA 2GFEA 4TOZA 5I7IA 3EPKA 1G2DC 2A5TA 4QHQA 1X6EA 2LTSA 3T1YE 2QMWA 5AA3A 1KWHA 3K2DA 1FQCA 1AOVA 4BC9A 2QS3A 1BKAA 3UK3C 3O9PA 5BUUA 2HEUA 4H5FA 2V88A 1II5A 2ONRA 4OHNA 2O68A 3FV1A 1B0HA 1PKPA 5TPAB 1GGGA 1FJ6A 1GQEA 3USDA 2L5VA 5FBPA 4MLQA 4TUIA 3L6HA 1DSNA 1RDXA 4C0RA 2JVAA 1FJGE 4UABA 4AS4A 4LF9E 1AL3A 3MP8A 2EMIA 4NZVA 3E78A 2EPKX 2WCC3 3IR1A 3O2AA 5DYHA 2B3FA 2UVHA 4LF8E 3U72A 4DR5E 5AA2B 5JTYB 2ZZWA 4PGNA 3KJTA 2VF1A 4OERA 3BIDA 5ESYA 3M99B 3OSQA 1B4ZA 2Q8MA 3D4GA 4F3SA 2XX8A 4X1DA 4X65E 3LR1A 4DV3E 4YAHX 2F8BA 2I4CA 1FQEA 4PP0A 2OWZA 3DP8A 3E4RA 4OMBA 4PTKA 4KWYA 2EQ0A 3LMLA 4LU9A 4BHBA 2JWOA 3WAFA 2YTIA 2LO3A 4JI2E 2ZYOA 3O6IA 1B6HA 2PMSA 1RYOA 4P9KA 3SEUA 3N6UA 2Y84A 1HR0E 1UHZA 3IOTA 1FBCA 3FJ7A 1MQIA 3KGCA 2XXHA 5ITPA 4NN3A 4ZZAA 2ALUA 2KR0A 4P3LA 2HHHE 4PAKA 1QGXA 5IV8B 4Q5TA 4LUBA 4H65A 4I3EA 2NWJA 1UTHA 2EMHA 4DV1E 5AA1A 2F7CA 3B6WA 3LC8A 3SKPA 2DLKA 4BDLA 4Q8RA 1KYQA 2DMIA 1N32E 1RMDA 1WXRA 4RPNA 4PBHA 1B2HA 4O24A 4QRZA 4H8JA 5A6KA 4WPYA 3C33A 3ADGA 5TU0A 3CG1A 4EDPA 2Q8UA 3T1BA 1XC1A 3KJ7A 4X1BA 1SI1A 4RXLA 4ZE9A 3MJNA 2A5SA 3EN3A 3OO7A 1R6ZA 4H0WA 2I58A 4OQOA 5I59A 2DQVA 2MDRA 1CB6A 3LSLA 2EWLA 4R2RA 3TMGA 3MVYA 1IXHA 4PE3A 1SW4A 2QVRA 1WJPA 3FJMA 3H3GA 1G0HA 4ZYHA 4DR1E 5IKBA 4H46A 3KWRA 2RKMA 4Q35B 1UTBA 1H76A 3RNNA 5L9MA 4H6DA 3WAEA 2CTDA 1LAHE 3FXRA 5I58A 3R26A 2RC7A 5L9SA 1Q1KA 4X48A 4G8NA 4U1ZA 4BDQA 1BLFA 2FNCA 4P0GA 1URDA 1YUIA 3S2VA 1EU8A 2LCEA 3EKIA 1PEBA 1FTJA 1J5EE 2XD2A 4NF6B 1MRPA 1Z1BA 4RJZA 3KC0A 1FQFA 5ICTA 2XA5A 4WXCA 4RHBB 3OMBA 1EH8A 2DP8A 1AAYA 3E9XA 4X64E 5CMMA 4O8MA 1UQWA 2OCUA 3HN0A 2ENCA 3K00A 2YU8A 4F3GA 1RKMA 2GH9A 2R8TA 2EM6A 5KDTA 1R9QA 2F7AA 4FEBA 4KYSA 1INPA 4JXIA 2EOXA 2YRKA 4RH8A 5AE2A 4PFWA 4NF5A 4G2ZA 3BF2A 4R2SA 4X8WA 5LTCA 1LFIA 3V89B 1DTGA 3PUZE 2LV2A 3RY3A 1TFAA 2EOHA 1MXXA 1JVXA 3HHGA 1FJ9A 5LMUE 2QPQA 1YPNA 4ELPA 3ADLA 1NI9A 1YCJA 2EMWA 1B3LA 3KN8A 3D4CA 4DE8A 1FSAA 3RTWB 2XXWA 4B3SE 1S9TA 4X66E 2YSOA 1NNTA 1NNFA 2EOQA 4YY3E 2OK2A 5EYFA 3TPAA 1MY3A 5AC5A 5H8HB 1NV2A 3PPPA 1YXIA 2CSHA 2EL4A 5H8NB 2EOFA 3LUYA 1HNXE 2EM5A 4JI5E 2VOZA 2RPCA 4N8YA 1PJSA 2VD3A 2EM4A 2WBSA 4GL0A 4M4GA 3DELB 1IMFA 1XVYA 2CPNA 4MJOA 1X6HA 1GV8A 5ISUA 2EORA 4GRKA 2P3VA 1A99A 4P1LA 3OEMA 2EQ3A 5I2NA 5BR8E 2OBGA 2V83A 3VDFA 2JOBA 1STUA 1MXYA 2L8TA 1YTVA 1QU6A 5EYGA 1FPLA 4HCYA 2P1SA 4L8NA 2MKZA 4JSDA 3VLUA 2X7QA 1ZU0A 3IAZA 4GF8A 4NF0A 3M3KA 1I6AA 1K9YA 2Q8JA 4WFTA 2W7YA 5KL2A 3K0VA 1FRPA 2EOZA 2X7PA 4F2JC 2XXIA 3OELA 4NGUA 4PF8A 3EPHA 2UUCE 4E0WA 1T38A 4LVQA 1JW4A 5LLQA 1JP4A 1XI6A 1MM7A 3QAXA 5EHMA 3CR9A 4QXDA 5A6AA 4IB2A 5EQ7A 3QUJA 4JVIA 2VQEE 3OO9A 2YT4A 2PVUA 1OQGA 1ZBMA 1Y1MA 3TTMA 4F1UA 4FORA 3T9HB 2MKDA 3KZZA 3V5AA 4O4KA 4JBZA 4DR6E 4O3CA 4G61A 2M9AA 4FK5C 1B32A 2F78A 3IWBA 4AB6A 3G3KA 2F97A 5FLXC 3MPKA 4F9BB 1IQ7A 4DLDA 1H43A 4WSGA 4WKMA 1RDYA 4F1YA 1A1IA 4DDDA 3UIFA 2UUBE 2NXOA 3PV0E 5H8FB 4NF4B 4TLMB 5FTIA 1KA1A 3MAMA 3IB0A 1GVCA 1NV5A 3AV0A 2RCBA 3H6WA 1I6QA 1B3GA 3AXFA 4GD5A 3U94A 2M8CA 3W9VA 2HCAA 3EPJA 1A7LA 1XMOE 2L3JA 1RDZA 5TPAA 1T4OA 4IJDA 3TELA 2DDKA 1A1FA 2EMGA 3FZVA 4GX3A 3CHGA 3HFUA 4F54A 1LLMC 1ZR9A 2EMZA 5I84A 4IO4A 4ZEFA 4G68C 2M4IA 1IMCA 1MY0A 3ECRA 4YB5A 2EM8A 3C9HA 1N36E 4X9TA 1IMAA 4IO5A 1H44A 4HW8A 2YTJA 5CBRA 2AYSA 1Z7ME 5EQ8A 1M5EA 1MY1A 4IY5A 5AA2A 5JTYA 1TWYA 2CEYA 3S9NC 2I3WA 1Q9DA 3MC2A 2EOEA 1MY4A 3THNA 4M9VC 3LSXA 1IITA 3KG2A 3P7IA 3KZGA 2EPLX 1PBPA 5IZ3B 5K2XA 2L92A 1NV3A 1QULA 2HXWA 2E5LE 2PRTA 2XWKA 1MDP1 1ZJLA 4LATA 3C6KA 2YTPA 3GBBA 2FTXB 2RSIA 4OEUA 4MCOA 4PBQA 4RK2A 5EQ9A 1ZTYA 3OENA 4BC7A 2I0CA 3U8QA 4R2BA 2Z8FA 4KXPA 3FGSA 4F31B 4IY6A 2HJJA 3Q26A 1XHYA 1YUJA 2JJKA 4GWYA 4I40A 3ZS6A 2CZKA 2RTXA 4NAPA 3K4UA 4R6HA 3KOSA 3OSRA 3THOB 1B4HA 1NL5A 3I3VA 3KEIA 4MBPA 2VPNA 5KL6A 3LUZA 2O7IA 1WODA 5H8QB 1PB9A 4LZ8A 5K2YA 3JTZA 4M2ZA 1NFTA 1N3GA 5KL3A 3FASA 3PD8A 5DNYA 1SR9A 2KQZA 2EOSA 4MIJA 1SYHA 2VT5A 1ZU1A 2NUFA 2XXYA 1N0TA 5F7VA 4POWA 4OTEA 1JEVA 4KI0E 2EN8A 3F6HA 4U23A 2O69A 3IL1B 1US4A 3RN8A 4QF9A 3FJGA 2RS6A 1YFHA 4ELQA 4F9CB 2KHXA 3VVDA 1SBPA 4GXSB 1LB9A 4DV4E 4GFRA 5ET6A 4LF4E 4LZ5A 3N5LA 4LFCE 1B1XA 1Y3PA 5T3JA 1IZ1A 3TQMA 1YYZA 4KCDA 4MAGA 3T9VA 3U93A 3S9EA 1QUKA 1N7WA 2CZIA 4H45A 3H6TA 1LSTA 3RPWA 4P0IA 1NCSA 4P1EA 1O7TA 2B4LA 1TF3A 2EN4A 1ZKBA 1P47A 5A6JA 4E0XA 2B7TA 4R9FA 4AQ4A 1R1NA 1YSAC 4NF6A 4YKJA 4BLAA 5KCJB 2UU9E 4L17A 1BTJA 2YTEA 2EZ6A 1IBME 4RY1A 2LJUA 4QFOA 1B7HA 1DCUA 4B3TE 4IGRA 3KFMA 5DT6A 4Q28A 1X49A 2UVIA 4TQUQ 3MUQA 1IBKE 1X5WA 2EMCA 3M3LA 2O6AA 3CIJA 1L4SA 3VK6A 2H4IA 1WHQA 4F1VA 3MWBA 3FUZA 1FPIA 2DB2A 1PJQA 1MXWA 4MNCA 3PU5A 3T93B 1O64A 3L6GA 1YZ9A 2UYFA 1AIVA 3KZYA 4KHPE 3Q29A 3FV2A 1Y9UA 4PQJA 1H45A 3SESA 5AC4A 1Y3QA 1A1HA 1MEYC 4NWDA 4R2AA 3MQ9A 1LBCA 4OENA 4YU0A 2FGGA 3RQTA 2P2AA 3IK6B 2EM2A 2WEFA 3U65A 3PTYA 4M1VA 4PC9A 4WXDA 2Q2CA 2Q88A 1LAGE 3E13X 3FATA 3QUFA 2QJEA 5H8HA 3MBPA 3K6QA 3H03A 5H8NA 4ZE8A 4F6NA 5LDZA 3LBSA 2EM7A 4DI4B 1P1NA 1OIBA 1HSEA 1FTOA
chains in the Genus database with same CATH topology
3T96B 3PD9A 2DOJA 2HFBA 4GL8A 3H7MA 4YB6A 4OFJA 1LBBA 1OVBA 2PT2A 2QS1A 4PFTA 5CM6A 5B7DA 3RUMA 1CE2A 3PPOA 1B9JA 5BWJA 2XXRA 4HCWA 4Q0CA 3TODA 4ZS9A 3OOAA 2ABHA 2F6PA 5ITOA 3CFXA 2RINA 2ZXTA 1D3KA 3IJXB 1JVYA 5DTBA 4XTCQ 3O6HA 1PC3A 2OWSA 1P1OA 2HQ0A 4GIZA 4G68B 3B7DA 2XXXA 4OVJA 3BBRA 4N07A 3IJOB 1LGBC 4WXJA 1B3EA 3ONMA 1VFDA 4JWXA 2XXQA 2VGQA 3PUWE 5EHSA 3MP6A 4NF8B 5CI5A 5I2KB 4KR5A 2Z23A 1MG1A 2I3VA 2YLNA 2UXAA 2QMXA 3TAJA 4ONYA 3O28A 2PBWA 3A3UA 5H8FA 3N6TA 4GQOA 4NF4A 4U4SA 1NKXA 1MS7A 1IUDA 2AL5A 2REJA 4FECA 2ESNA 3EHUA 1EZPA 5DEXB 2YPNA 4YMAA 1LCTA 1M5CA 4OYVA 3EF7A 4U2RA 2PX1A 4O3AA 3TKDA 4ZEDA 4TLLB 2DWHA 4YZZA 4N13A 1XOCA 3TTKA 3K01A 4R2FA 3PPQA 3SEVA 1T0KA 2PT1A 3KOTA 2QRYA 1FQDA 4Z0IA 2HZLA 2FYIA 4G4PA 5AA4A 1PDAA 2THIA 2ANJA 4KFQA 2GHBA 3SETA 4PE5B 4OESA 4YKIA 5A5XB 5JEIA 3GXAA 4F2QA 3FVGA 5FHOA 4JDFA 1ELJA 4QSDA 2V84A 4K3FA 5H8QA 2QS2A 3UK4A 2F5XA 4F18A 1JNFA 3LSWA 4G8MA 1B5JA 5L9OA 1LAFE 2ONSA 3TCFA 4UA8A 3PGFA 4THIA 3PPRA 1Y4TA 2DSFA 3QK6A 1OVTA 3SERA 3DLNA 4IO7A 4F2OA 4ESWA 3EPEA 3T22A 2LAOA 1EH3A 3TUSA 5I57B 1QUJA 2NOOA 4XKPA 4KYEA 3KSJA 4RPOA 1SVXB 3G3FA 1MH4A 4YICA 2NUVA 2DXYA 4P11A 5M2VA 4GWOA 5KCJA 2BJJX 2XD3A 2CMOA 4GXAA 4U1OA 3U1OA 1MDQA 1OMPA 1MH3A 3O97A 4F39A 1URSA 4UACA 5DVJA 4XKNA 1B3FA 4C1UA 3IO4A 4OXVA 1OLCA 3H4ZA 2F8DA 3Q28A 2H25A 2H98A 1L5TA 1Y1ZA 2F36A 3FVNA 4R6YA 4U21A 4EF2A 1PBQA 3S9MC 1QVSA 4DXCA 4HTGA 4DCYA 3OO8A 4ELOA 3GZGA 3KSXA 3HPIA 4NEDA 3S9LC 3HV1A 2RC8A 3F11A 4GOTA 4MLVA 1XS5A 4R73A 3B6TA 1M5BA 1B52A 2Q9TA 4H1XA 4OWDA 1FTKA 4RK9A 1Z7NE 2E0SA 3CRBA 1POTA 3OO6A 4OEVA 3FVOA 2YJPA 4R72A 2UYEA 3QYTA 4QFLA 4JWOA 4Z7EA 1N04A 3DP4A 2V93A 2XXUA 4BDMA 3CSBA 2DWIA 1P1UA 5CBSA 2DWAA 5LOMA 1WDNA 3U92A 1N7XA 4F29A 1H3DA 3ZKLA 3JV9A 5AA4B 1SYIA 3K6XA 2QS4A 1LB8A 4I62A 1MQHA 3EHSA 2ZMBA 4EXLA 5IAIA 1R9LA 2G29A 4FE8A 4KHZE 1I6BA 4EF1A 1DMBA 1SDXA 2Y7RA 2ONKE 1D4NA 2Z8EA 4DXUA 3K6VA 3MPLA 1MQGA 1J1NA 4KCCA 4OETA 5CMKA 1N3XA 3ILUB 4MF3A 3K1PA 4G68A 4JB7A 4LZ7A 1B05A 2DYXA 2GRVA 2H99A 2FA7A 3R6UA 1D9VA 1POY1 5FHMA 4POXA 4ZEBA 3GLBA 4LQ5A 1WVJA 4NF8A 5I2KA 1SW1A 3T66A 1XVXA 3LSFB 2G93A 1P99A 2OZZA 1BIYA 1IEJA 4ND9A 1JETA 5I56B 3H06B 2REGA 1QJMA 5DVIA 5ICQA 5DEXA 5KZTA 4EUOA 1B7ZA 3W9WA 3N26A 4F3PA 3CSGA 3O66A 2VHAA 4LONB 4XXUA 4XIGQ 4FEDA 3T9UA 3TCGA 2HAUA 2ZYNA 1DPPA 3SEXA 3EHTA 3QSLA 5CMBA 2D3IA 1YAEA 4ZDMA 1DOTA 3OD7A 1B0LA 1GR2A 1VFEA 3THIA 2DXRA 1FW0A 3MZBA 4F3BA 5TP9B 2R9JA 5FHNA 2V3QA 5CMCA 1HSJA 1MQJA 3CVGA 4EQ9A 1MXZA 2X26A 1ATGA 4H67A 1A8FA 5A5XA 3IX1A 4R9GA 4XKRA 3HCQA 1FTMA 4O3BA 2DE4A 3M3FA 3CFZA 4ELRA 1Y20A 3C4MA 4R75A 2RC9A 1QKBA 1MXUA 2D21A 1IXIA 1ANFA 3G3JA 3VV5A 1MPDA 3TFLA 2ZYMA 5H8SA 3T9XB 5ELVA 3IB1A 1UIUA 1IXGA 1ZMGA 3UP9A 3PPNA 3OXNA 3JYRA 3VFJA 1S50A 4QFPA 3HO7A 2F34A 5I57A 2R6GE 2IA4A 2ZNSA 2GHAA 4WEDA 3PUXE 3RT6B 3C34A 2DVCA 3FVKA 4PETA 1FTLA 3CI8A 3TTLA 4OZ9A 5CC2A 1TXFA 3VXCA 4AB5A 4ESXA 2Y7PA 2Q2AA 1MY2A 1N3WA 3K6WA 2HAVA 3S4UA 4N6PA 1A55A 3RTFB 3DP6A 3UGWA 1QUIA 1A40A 4U4XA 3ZKKA 3C32A 3VXBA 4ZECA 2XXTA 1MQDA 3G3IA 2Y7WA 3VE1B 1DTZA 3TQLA 3TCHA 4OFOA 4YB7A 3BFUA 1AMFA 3IB2A 3DM0A 3TDJA 3FXUA 3IOWA 1USYE 1URGA 3MVWA 3QXMA 4IO2A 4KPTA 2XX9A 3BFTA 3SEWA 3B6QA 4R6KA 4KYDA 1LFGA 3W15C 4JWYA 2UVGA 1VE4A 4WEPA 4EQ7A 1EZOA 5HPQA 1IIWA 2I6EA 4H5GA 4DIGA 1BP5A 2NVUB 2XX7A 3PMXA 3O6GA 1SQYA 2AL4A 1I69A 3FXQA 3I5OA 3Q25A 4MH5A 1NMUA 3TQWA 3FIRA 3K1MA 3RT8A 2V3UA 3V8XB 4GLIA 2V25A 2V3TA 2O51A 3PMVA 4G8HA 2XXVA 2DE3A 4I8CA 2A5TB 2D5WA 2O84X 1SW5A 1P1QA 2F7BA 3C31A 4LP2B 3Q27A 2RF1A 3N94A 4PFUA 2WKYA 1FCKA 2QL3A 2I0BA 3PUVE 1JW5A 3JZJA 3RLFE 5DVFA 1IXCA 2I4BA 3O29A 1MPCA 4F19A 2HZKA 4NMYA 4KD5A 3K6UA 4NTLA 3MP1A 1ZLQA 4GVOA 5FTHA 2B3BA 4YKPA 3SEYA 1P1WA 4QFNA 1TFDA 4QSEA 1SD3A 2ZNTA 4FAJA 3I6VA 2OWTA 4IO6A 2B65A 3G7WA 1DPEA 4NWCA 5I56A 2VD2A 1N84A 3G3GA 3IOUA 3OEKA 1B5IA 4ECFA 1UIVA 3PUYE 2DE2A 5JK4A 2DS9A 1VSOA 5AA2D 2Y7KA 3QIMA 4RA1A 3UN6A 4BDNA 1D9YA 2O1MA 4YMBA 2AIXA 1B1HA 1N76A 2OJTA 1M5FA 1UTHB 2Z22A 4ZZEA 4DXBA 1Y4CA 3M8UA 2O1LA 1B58A 4OFLA 1B51A 2DVZA 1B5HA 3K1NA 4I1DA 1USYH 4XKQA 1B3HA 3A09A 3BKIB 1O63A 5TP9A 2O7UA 4ISUA 5I59B 3HSTA 3KN7A 1LAXA 4IO3A 4EXKA 4FJPA 5HM4B 2ZYKA 3ZSFA 2OLBA 1ZIUA 1SI0A 3UA8A 4C1TA 3PMWA 1M5DA 2UVJA 1UTBB 1LFHA 2R71A 5I58B 1SW2A 1Y3NA 5HBCA 4DZ1A 4QSCA 1NH8A 1FQAA 1LLSA 2PYYA 2XHDA 5B70A 5J1DA 3KBRA 1LCFA 4LA9A 3VVEA 1RYXA 1B46A 3FD3A 3G3HA 1F9BA 5F1QA 2Z8DA 1JEUA 1NNPA 4DCXA 4BDRA 3IORA 5KDTB 2E1SA 4JSOA 1Q35A 1QW0A 4BDOA 3GBAA 3TYHA 1B7UA 1FQBA 1A54A 4NF5B 3HHFA 3ILTB 4FIMA 1OLAA 3MVZA 1S7YA 2P0SA 1PB7A 4ZEIA 2KLFA 4ZEKA 3IO6A 1NNKA 3KN3A 2Y7IA 1MXVA 3CFLA 3H6VA 3TTRA 3ODBA 4H8IA 3A3CA 3VLWA 3TTNA 2XXPA 2I49A 1OQHA 5L8DA 2ZNUA 3C35A 3VVFA 3IOVA 1EZ9A 4KQPA 3CG3A 3TEPA 5I2NB 4F22A 4I9DA 2IEEA 3H6UA 5AE4A 2RCAA 3RGYA 1TT1A 1XT8A 1VR5A 3K02A 4R74A 1PB8A 4NE4A 1GTKA 2F6GA 2CZLA 3VLVA 1A8EA 3E3KA 4Q30B 2QSXA 4RNSA 1HSLA 1JW1A 4PFYA 3EQ1A 3SDFA 1NH7A 1MM6A 3MZ1A 4G77A 2VP1A 1JQFA 1US5A 2I48A 4FATA 4IGTA 4U22A 3TZAA 3R7XA 2F35A 4QFKA 2DWJA 1MPBA 1B40A 3C36A 4LQ2A 2H9BA 4MFIA 1QKAA 4RYAA 4HS7A 1AH5A 5CRYA 2Q89A 3MW0A 3V83A 3MZ9A 4YKKA 3MVXA 3UORA 2H5YA 2GFEA 4TOZA 2A5TA 4QHQA 2QMWA 5AA3A 1KWHA 3K2DA 1FQCA 1AOVA 2QS3A 1BKAA 3O9PA 5BUUA 2HEUA 4H5FA 1II5A 2ONRA 4OHNA 2O68A 3FV1A 1B0HA 5TPAB 1GGGA 3USDA 4MLQA 3L6HA 1DSNA 4C0RA 1AL3A 3MP8A 3IR1A 3O2AA 5DYHA 2B3FA 2UVHA 3U72A 5AA2B 5JTYB 3KJTA 4OERA 3OSQA 1B4ZA 3D4GA 4F3SA 2XX8A 4X1DA 3LR1A 4YAHX 2I4CA 1FQEA 4PP0A 3DP8A 3E4RA 4OMBA 3WAFA 3O6IA 2ZYOA 1B6HA 2PMSA 1RYOA 3SEUA 3N6UA 2Y84A 3IOTA 3FJ7A 1MQIA 3KGCA 2XXHA 5ITPA 4ZZAA 2ALUA 4Q5TA 4LUBA 4H65A 2NWJA 1UTHA 5AA1A 2F7CA 3B6WA 3LC8A 3SKPA 4BDLA 4Q8RA 4RPNA 1B2HA 4QRZA 4H8JA 3C33A 5TU0A 3CG1A 4EDPA 1XC1A 3KJ7A 4X1BA 1SI1A 4RXLA 4ZE9A 3MJNA 2A5SA 3EN3A 3OO7A 1R6ZA 4H0WA 2I58A 4OQOA 5I59A 2DQVA 1CB6A 3LSLA 3TMGA 3MVYA 1IXHA 1SW4A 3FJMA 3H3GA 5IKBA 2RKMA 1UTBA 1H76A 3RNNA 5L9MA 4H6DA 3WAEA 1LAHE 3FXRA 5I58A 3R26A 2RC7A 5L9SA 1Q1KA 4X48A 4G8NA 4BDQA 4U1ZA 1BLFA 2FNCA 4P0GA 1URDA 3S2VA 1EU8A 1PEBA 1FTJA 2XD2A 4NF6B 1MRPA 4RJZA 1FQFA 5ICTA 3OMBA 2DP8A 3E9XA 5CMMA 1UQWA 2OCUA 3HN0A 3K00A 4F3GA 1RKMA 2GH9A 5KDTA 1R9QA 2F7AA 4FEBA 4KYSA 4JXIA 4PFWA 4NF5A 4G2ZA 1LFIA 3V89B 1DTGA 3PUZE 3RY3A 1TFAA 1MXXA 1JVXA 3HHGA 2QPQA 1YPNA 4ELPA 1YCJA 1B3LA 3KN8A 3D4CA 4DE8A 3RTWB 2XXWA 1S9TA 1NNTA 1NNFA 2OK2A 5EYFA 3TPAA 1MY3A 5H8HB 3PPPA 5H8NB 3LUYA 2VOZA 2VD3A 4GL0A 4M4GA 3DELB 1XVYA 1GV8A 5ISUA 4GRKA 1A99A 3OEMA 5I2NA 2OBGA 3VDFA 1MXYA 1YTVA 4HCYA 2P1SA 4JSDA 3VLUA 2X7QA 1ZU0A 3IAZA 4GF8A 3M3KA 1I6AA 2Q8JA 2W7YA 3K0VA 2X7PA 2XXIA 3OELA 4E0WA 4LVQA 1JW4A 1MM7A 3QAXA 5EHMA 3CR9A 4IB2A 3QUJA 3OO9A 2PVUA 1OQGA 1ZBMA 1Y1MA 3TTMA 4F1UA 4FORA 3T9HB 3V5AA 4JBZA 4O3CA 1B32A 2F78A 4AB6A 3G3KA 2F97A 3MPKA 1IQ7A 4DLDA 1H43A 4WKMA 4F1YA 4DDDA 3UIFA 2NXOA 3PV0E 5H8FB 4NF4B 4TLMB 5FTIA 3MAMA 3IB0A 1GVCA 2RCBA 3H6WA 1I6QA 1B3GA 3AXFA 4GD5A 3U94A 2M8CA 3W9VA 2HCAA 1A7LA 5TPAA 3TELA 3FZVA 5I84A 4IO4A 4ZEFA 4G68C 1MY0A 3ECRA 4YB5A 3C9HA 4X9TA 4IO5A 1H44A 4HW8A 5CBRA 2AYSA 1Z7ME 1M5EA 1MY1A 4IY5A 5AA2A 5JTYA 1TWYA 3S9NC 2I3WA 3MC2A 1MY4A 3LSXA 1IITA 3KG2A 3P7IA 3KZGA 1PBPA 5K2XA 1QULA 2HXWA 1MDP1 1ZJLA 4LATA 3GBBA 4OEUA 4EQBA 4RK2A 3U8QA 1ZTYA 3OENA 2I0CA 4R2BA 2Z8FA 3FGSA 4F31B 4IY6A 3Q26A 1XHYA 3ZS6A 3K4UA 4R6HA 3KOSA 3OSRA 1B4HA 1NL5A 3I3VA 3KEIA 4MBPA 2O7IA 1WODA 5H8QB 1PB9A 4LZ8A 5K2YA 1NFTA 3FASA 3PD8A 1SYHA 2XXYA 1N0TA 5F7VA 4POWA 4OTEA 1JEVA 4KI0E 4U23A 2O69A 3IL1B 1US4A 3RN8A 4QF9A 3FJGA 4ELQA 3VVDA 1SBPA 4GXSB 1LB9A 4GFRA 4LZ5A 3N5LA 1B1XA 1Y3PA 1IZ1A 3U93A 4KCDA 3T9VA 3S9EA 1QUKA 1N7WA 3H6TA 1LSTA 3RPWA 4P0IA 1O7TA 1ZKBA 4E0XA 4R9FA 4AQ4A 1R1NA 4NF6A 4YKJA 5KCJB 4BLAA 4L17A 1BTJA 4RY1A 4QFOA 1B7HA 4IGRA 3KFMA 5DT6A 2UVIA 4TQUQ 3MUQA 3M3LA 2O6AA 3CIJA 2H4IA 4F1VA 3MWBA 3FUZA 1MXWA 3PU5A 3T93B 1O64A 3L6GA 2UYFA 1AIVA 3Q29A 3FV2A 1Y9UA 4PQJA 1H45A 3SESA 1Y3QA 4NWDA 3MQ9A 1LBCA 4OENA 4YU0A 3RQTA 2P2AA 3IK6B 4M1VA 2Q2CA 2Q88A 1LAGE 3E13X 3FATA 3QUFA 2QJEA 5H8HA 3MBPA 5H8NA 3H03A 4ZE8A 3LBSA 1P1NA 1OIBA 1HSEA 1FTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T96 B;  3PD9 A;  2DOJ A;  2HFB A;  4GL8 A;  3H7M A;  4YB6 A;  4OFJ A;  1LBB A;  1OVB A;  2PT2 A;  2QS1 A;  4PFT A;  5CM6 A;  5B7D A;  3RUM A;  1CE2 A;  3PPO A;  1B9J A;  5BWJ A;  2XXR A;  4HCW A;  4Q0C A;  3TOD A;  4ZS9 A;  3OOA A;  2ABH A;  2F6P A;  5ITO A;  3CFX A;  2RIN A;  2ZXT A;  1D3K A;  3IJX B;  1JVY A;  5DTB A;  4XTC Q;  3O6H A;  1PC3 A;  2OWS A;  1P1O A;  2HQ0 A;  4GIZ A;  4G68 B;  3B7D A;  2XXX A;  4OVJ A;  3BBR A;  4N07 A;  3IJO B;  1LGB C;  4WXJ A;  1B3E A;  3ONM A;  1VFD A;  4JWX A;  2XXQ A;  2VGQ A;  3PUW E;  5EHS A;  3MP6 A;  4NF8 B;  5CI5 A;  5I2K B;  4KR5 A;  2Z23 A;  1MG1 A;  2I3V A;  2YLN A;  2UXA A;  2QMX A;  3TAJ A;  4ONY A;  3O28 A;  2PBW A;  3A3U A;  5H8F A;  3N6T A;  4GQO A;  4NF4 A;  4U4S A;  1NKX A;  1MS7 A;  1IUD A;  2AL5 A;  2REJ A;  4FEC A;  2ESN A;  3EHU A;  1EZP A;  5DEX B;  2YPN A;  4YMA A;  1LCT A;  1M5C A;  4OYV A;  3EF7 A;  4U2R A;  2PX1 A;  4O3A A;  3TKD A;  4ZED A;  4TLL B;  2DWH A;  4YZZ A;  4N13 A;  1XOC A;  3TTK A;  3K01 A;  4R2F A;  3PPQ A;  3SEV A;  1T0K A;  2PT1 A;  3KOT A;  2QRY A;  1FQD A;  4Z0I A;  2HZL A;  2FYI A;  4G4P A;  5AA4 A;  1PDA A;  2THI A;  2ANJ A;  4KFQ A;  2GHB A;  3SET A;  4PE5 B;  4OES A;  4YKI A;  5A5X B;  5JEI A;  3GXA A;  4F2Q A;  3FVG A;  5FHO A;  4JDF A;  1ELJ A;  4QSD A;  2V84 A;  4K3F A;  5H8Q A;  2QS2 A;  3UK4 A;  2F5X A;  4F18 A;  1JNF A;  3LSW A;  4G8M A;  1B5J A;  5L9O A;  1LAF E;  2ONS A;  3TCF A;  4UA8 A;  3PGF A;  4THI A;  3PPR A;  1Y4T A;  2DSF A;  3QK6 A;  1OVT A;  3SER A;  3DLN A;  4IO7 A;  4F2O A;  4ESW A;  3EPE A;  3T22 A;  2LAO A;  1EH3 A;  3TUS A;  5I57 B;  1QUJ A;  2NOO A;  4XKP A;  4KYE A;  3KSJ A;  4RPO A;  1SVX B;  3G3F A;  1MH4 A;  4YIC A;  2NUV A;  2DXY A;  4P11 A;  5M2V A;  4GWO A;  5KCJ A;  2BJJ X;  2XD3 A;  2CMO A;  4GXA A;  4U1O A;  3U1O A;  1MDQ A;  1OMP A;  1MH3 A;  3O97 A;  4F39 A;  1URS A;  4UAC A;  5DVJ A;  4XKN A;  1B3F A;  4C1U A;  3IO4 A;  4OXV A;  1OLC A;  3H4Z A;  2F8D A;  3Q28 A;  2H25 A;  2H98 A;  1L5T A;  1Y1Z A;  2F36 A;  3FVN A;  4R6Y A;  4U21 A;  4EF2 A;  1PBQ A;  3S9M C;  1QVS A;  4DXC A;  4HTG A;  4DCY A;  3OO8 A;  4ELO A;  3GZG A;  3KSX A;  3HPI A;  4NED A;  3S9L C;  3HV1 A;  2RC8 A;  3F11 A;  4GOT A;  4MLV A;  1XS5 A;  4R73 A;  3B6T A;  1M5B A;  1B52 A;  2Q9T A;  4H1X A;  4OWD A;  1FTK A;  4RK9 A;  1Z7N E;  2E0S A;  3CRB A;  1POT A;  3OO6 A;  4OEV A;  3FVO A;  2YJP A;  4R72 A;  2UYE A;  3QYT A;  4QFL A;  4JWO A;  4Z7E A;  1N04 A;  3DP4 A;  2V93 A;  2XXU A;  4BDM A;  3CSB A;  2DWI A;  1P1U A;  5CBS A;  2DWA A;  5LOM A;  1WDN A;  3U92 A;  1N7X A;  4F29 A;  1H3D A;  3ZKL A;  3JV9 A;  5AA4 B;  1SYI A;  3K6X A;  2QS4 A;  1LB8 A;  4I62 A;  1MQH A;  3EHS A;  2ZMB A;  4EXL A;  5IAI A;  1R9L A;  2G29 A;  4FE8 A;  4KHZ E;  1I6B A;  4EF1 A;  1DMB A;  1SDX A;  2Y7R A;  2ONK E;  1D4N A;  2Z8E A;  4DXU A;  3K6V A;  3MPL A;  1MQG A;  1J1N A;  4KCC A;  4OET A;  5CMK A;  1N3X A;  3ILU B;  4MF3 A;  3K1P A;  4G68 A;  4JB7 A;  4LZ7 A;  1B05 A;  2DYX A;  2GRV A;  2H99 A;  2FA7 A;  3R6U A;  1D9V A;  1POY 1;  5FHM A;  4POX A;  4ZEB A;  3GLB A;  4LQ5 A;  1WVJ A;  4NF8 A;  5I2K A;  1SW1 A;  3T66 A;  1XVX A;  3LSF B;  2G93 A;  1P99 A;  2OZZ A;  1BIY A;  1IEJ A;  4ND9 A;  1JET A;  5I56 B;  3H06 B;  2REG A;  1QJM A;  5DVI A;  5ICQ A;  5DEX A;  5KZT A;  4EUO A;  1B7Z A;  3W9W A;  3N26 A;  4F3P A;  3CSG A;  3O66 A;  2VHA A;  4LON B;  4XXU A;  4XIG Q;  4FED A;  3T9U A;  3TCG A;  2HAU A;  2ZYN A;  1DPP A;  3SEX A;  3EHT A;  3QSL A;  5CMB A;  2D3I A;  1YAE A;  4ZDM A;  1DOT A;  3OD7 A;  1B0L A;  1GR2 A;  1VFE A;  3THI A;  2DXR A;  1FW0 A;  3MZB A;  4F3B A;  5TP9 B;  2R9J A;  5FHN A;  2V3Q A;  5CMC A;  1HSJ A;  1MQJ A;  3CVG A;  4EQ9 A;  1MXZ A;  2X26 A;  1ATG A;  4H67 A;  1A8F A;  5A5X A;  3IX1 A;  4R9G A;  4XKR A;  3HCQ A;  1FTM A;  4O3B A;  2DE4 A;  3M3F A;  3CFZ A;  4ELR A;  1Y20 A;  3C4M A;  4R75 A;  2RC9 A;  1QKB A;  1MXU A;  2D21 A;  1IXI A;  1ANF A;  3G3J A;  3VV5 A;  1MPD A;  3TFL A;  2ZYM A;  5H8S A;  3T9X B;  5ELV A;  3IB1 A;  1UIU A;  1IXG A;  1ZMG A;  3UP9 A;  3PPN A;  3OXN A;  3JYR A;  3VFJ A;  1S50 A;  4QFP A;  3HO7 A;  2F34 A;  5I57 A;  2R6G E;  2IA4 A;  2ZNS A;  2GHA A;  4WED A;  3PUX E;  3RT6 B;  3C34 A;  2DVC A;  3FVK A;  4PET A;  1FTL A;  3CI8 A;  3TTL A;  4OZ9 A;  5CC2 A;  1TXF A;  3VXC A;  4AB5 A;  4ESX A;  2Y7P A;  2Q2A A;  1MY2 A;  1N3W A;  3K6W A;  2HAV A;  3S4U A;  4N6P A;  1A55 A;  3RTF B;  3DP6 A;  3UGW A;  1QUI A;  1A40 A;  4U4X A;  3ZKK A;  3C32 A;  3VXB A;  4ZEC A;  2XXT A;  1MQD A;  3G3I A;  2Y7W A;  3VE1 B;  1DTZ A;  3TQL A;  3TCH A;  4OFO A;  4YB7 A;  3BFU A;  1AMF A;  3IB2 A;  3DM0 A;  3TDJ A;  3FXU A;  3IOW A;  1USY E;  1URG A;  3MVW A;  3QXM A;  4IO2 A;  4KPT A;  2XX9 A;  3BFT A;  3SEW A;  3B6Q A;  4R6K A;  4KYD A;  1LFG A;  3W15 C;  4JWY A;  2UVG A;  1VE4 A;  4WEP A;  4EQ7 A;  1EZO A;  5HPQ A;  1IIW A;  2I6E A;  4H5G A;  4DIG A;  1BP5 A;  2NVU B;  2XX7 A;  3PMX A;  3O6G A;  1SQY A;  2AL4 A;  1I69 A;  3FXQ A;  3I5O A;  3Q25 A;  4MH5 A;  1NMU A;  3TQW A;  3FIR A;  3K1M A;  3RT8 A;  2V3U A;  3V8X B;  4GLI A;  2V25 A;  2V3T A;  2O51 A;  3PMV A;  4G8H A;  2XXV A;  2DE3 A;  4I8C A;  2A5T B;  2D5W A;  2O84 X;  1SW5 A;  1P1Q A;  2F7B A;  3C31 A;  4LP2 B;  3Q27 A;  2RF1 A;  3N94 A;  4PFU A;  2WKY A;  1FCK A;  2QL3 A;  2I0B A;  3PUV E;  1JW5 A;  3JZJ A;  3RLF E;  5DVF A;  1IXC A;  2I4B A;  3O29 A;  1MPC A;  4F19 A;  2HZK A;  4NMY A;  4KD5 A;  3K6U A;  4NTL A;  3MP1 A;  1ZLQ A;  4GVO A;  5FTH A;  2B3B A;  4YKP A;  3SEY A;  1P1W A;  4QFN A;  1TFD A;  4QSE A;  1SD3 A;  2ZNT A;  4FAJ A;  3I6V A;  2OWT A;  4IO6 A;  2B65 A;  3G7W A;  1DPE A;  4NWC A;  5I56 A;  2VD2 A;  1N84 A;  3G3G A;  3IOU A;  3OEK A;  1B5I A;  4ECF A;  1UIV A;  3PUY E;  2DE2 A;  5JK4 A;  2DS9 A;  1VSO A;  5AA2 D;  2Y7K A;  3QIM A;  4RA1 A;  3UN6 A;  4BDN A;  1D9Y A;  2O1M A;  4YMB A;  2AIX A;  1B1H A;  1N76 A;  2OJT A;  1M5F A;  1UTH B;  2Z22 A;  4ZZE A;  4DXB A;  1Y4C A;  3M8U A;  2O1L A;  1B58 A;  4OFL A;  1B51 A;  2DVZ A;  1B5H A;  3K1N A;  4I1D A;  1USY H;  4XKQ A;  1B3H A;  3A09 A;  3BKI B;  1O63 A;  5TP9 A;  2O7U A;  4ISU A;  5I59 B;  3HST A;  3KN7 A;  1LAX A;  4IO3 A;  4EXK A;  4FJP A;  5HM4 B;  2ZYK A;  3ZSF A;  2OLB A;  1ZIU A;  1SI0 A;  3UA8 A;  4C1T A;  3PMW A;  1M5D A;  2UVJ A;  1UTB B;  1LFH A;  2R71 A;  5I58 B;  1SW2 A;  1Y3N A;  5HBC A;  4DZ1 A;  4QSC A;  1NH8 A;  1FQA A;  1LLS A;  2PYY A;  2XHD A;  5B70 A;  5J1D A;  3KBR A;  1LCF A;  4LA9 A;  3VVE A;  1RYX A;  1B46 A;  3FD3 A;  3G3H A;  1F9B A;  5F1Q A;  2Z8D A;  1JEU A;  1NNP A;  4DCX A;  4BDR A;  3IOR A;  5KDT B;  2E1S A;  4JSO A;  1Q35 A;  1QW0 A;  4BDO A;  3GBA A;  3TYH A;  1B7U A;  1FQB A;  1A54 A;  4NF5 B;  3HHF A;  3ILT B;  4FIM A;  1OLA A;  3MVZ A;  1S7Y A;  2P0S A;  1PB7 A;  4ZEI A;  2KLF A;  4ZEK A;  3IO6 A;  1NNK A;  3KN3 A;  2Y7I A;  1MXV A;  3CFL A;  3H6V A;  3TTR A;  3ODB A;  4H8I A;  3A3C A;  3VLW A;  3TTN A;  2XXP A;  2I49 A;  1OQH A;  5L8D A;  2ZNU A;  3C35 A;  3VVF A;  3IOV A;  1EZ9 A;  4KQP A;  3CG3 A;  3TEP A;  5I2N B;  4F22 A;  4I9D A;  2IEE A;  3H6U A;  5AE4 A;  2RCA A;  3RGY A;  1TT1 A;  1XT8 A;  1VR5 A;  3K02 A;  4R74 A;  1PB8 A;  4NE4 A;  1GTK A;  2F6G A;  2CZL A;  3VLV A;  1A8E A;  3E3K A;  4Q30 B;  2QSX A;  4RNS A;  1HSL A;  1JW1 A;  4PFY A;  3EQ1 A;  3SDF A;  1NH7 A;  1MM6 A;  3MZ1 A;  4G77 A;  2VP1 A;  1JQF A;  1US5 A;  2I48 A;  4FAT A;  4IGT A;  4U22 A;  3TZA A;  3R7X A;  2F35 A;  4QFK A;  2DWJ A;  1MPB A;  1B40 A;  3C36 A;  4LQ2 A;  2H9B A;  4MFI A;  1QKA A;  4RYA A;  4HS7 A;  1AH5 A;  5CRY A;  2Q89 A;  3MW0 A;  3V83 A;  3MZ9 A;  4YKK A;  3MVX A;  3UOR A;  2H5Y A;  2GFE A;  4TOZ A;  2A5T A;  4QHQ A;  2QMW A;  5AA3 A;  1KWH A;  3K2D A;  1FQC A;  1AOV A;  2QS3 A;  1BKA A;  3O9P A;  5BUU A;  2HEU A;  4H5F A;  1II5 A;  2ONR A;  4OHN A;  2O68 A;  3FV1 A;  1B0H A;  5TPA B;  1GGG A;  3USD A;  4MLQ A;  3L6H A;  1DSN A;  4C0R A;  1AL3 A;  3MP8 A;  3IR1 A;  3O2A A;  5DYH A;  2B3F A;  2UVH A;  3U72 A;  5AA2 B;  5JTY B;  3KJT A;  4OER A;  3OSQ A;  1B4Z A;  3D4G A;  4F3S A;  2XX8 A;  4X1D A;  3LR1 A;  4YAH X;  2I4C A;  1FQE A;  4PP0 A;  3DP8 A;  3E4R A;  4OMB A;  3WAF A;  3O6I A;  2ZYO A;  1B6H A;  2PMS A;  1RYO A;  3SEU A;  3N6U A;  2Y84 A;  3IOT A;  3FJ7 A;  1MQI A;  3KGC A;  2XXH A;  5ITP A;  4ZZA A;  2ALU A;  4Q5T A;  4LUB A;  4H65 A;  2NWJ A;  1UTH A;  5AA1 A;  2F7C A;  3B6W A;  3LC8 A;  3SKP A;  4BDL A;  4Q8R A;  4RPN A;  1B2H A;  4QRZ A;  4H8J A;  3C33 A;  5TU0 A;  3CG1 A;  4EDP A;  1XC1 A;  3KJ7 A;  4X1B A;  1SI1 A;  4RXL A;  4ZE9 A;  3MJN A;  2A5S A;  3EN3 A;  3OO7 A;  1R6Z A;  4H0W A;  2I58 A;  4OQO A;  5I59 A;  2DQV A;  1CB6 A;  3LSL A;  3TMG A;  3MVY A;  1IXH A;  1SW4 A;  3FJM A;  3H3G A;  5IKB A;  2RKM A;  1UTB A;  1H76 A;  3RNN A;  5L9M A;  4H6D A;  3WAE A;  1LAH E;  3FXR A;  5I58 A;  3R26 A;  2RC7 A;  5L9S A;  1Q1K A;  4X48 A;  4G8N A;  4BDQ A;  4U1Z A;  1BLF A;  2FNC A;  4P0G A;  1URD A;  3S2V A;  1EU8 A;  1PEB A;  1FTJ A;  2XD2 A;  4NF6 B;  1MRP A;  4RJZ A;  1FQF A;  5ICT A;  3OMB A;  2DP8 A;  3E9X A;  5CMM A;  1UQW A;  2OCU A;  3HN0 A;  3K00 A;  4F3G A;  1RKM A;  2GH9 A;  5KDT A;  1R9Q A;  2F7A A;  4FEB A;  4KYS A;  4JXI A;  4PFW A;  4NF5 A;  4G2Z A;  1LFI A;  3V89 B;  1DTG A;  3PUZ E;  3RY3 A;  1TFA A;  1MXX A;  1JVX A;  3HHG A;  2QPQ A;  1YPN A;  4ELP A;  1YCJ A;  1B3L A;  3KN8 A;  3D4C A;  4DE8 A;  3RTW B;  2XXW A;  1S9T A;  1NNT A;  1NNF A;  2OK2 A;  5EYF A;  3TPA A;  1MY3 A;  5H8H B;  3PPP A;  5H8N B;  3LUY A;  2VOZ A;  2VD3 A;  4GL0 A;  4M4G A;  3DEL B;  1XVY A;  1GV8 A;  5ISU A;  4GRK A;  1A99 A;  3OEM A;  5I2N A;  2OBG A;  3VDF A;  1MXY A;  1YTV A;  4HCY A;  2P1S A;  4JSD A;  3VLU A;  2X7Q A;  1ZU0 A;  3IAZ A;  4GF8 A;  3M3K A;  1I6A A;  2Q8J A;  2W7Y A;  3K0V A;  2X7P A;  2XXI A;  3OEL A;  4E0W A;  4LVQ A;  1JW4 A;  1MM7 A;  3QAX A;  5EHM A;  3CR9 A;  4IB2 A;  3QUJ A;  3OO9 A;  2PVU A;  1OQG A;  1ZBM A;  1Y1M A;  3TTM A;  4F1U A;  4FOR A;  3T9H B;  3V5A A;  4JBZ A;  4O3C A;  1B32 A;  2F78 A;  4AB6 A;  3G3K A;  2F97 A;  3MPK A;  1IQ7 A;  4DLD A;  1H43 A;  4WKM A;  4F1Y A;  4DDD A;  3UIF A;  2NXO A;  3PV0 E;  5H8F B;  4NF4 B;  4TLM B;  5FTI A;  3MAM A;  3IB0 A;  1GVC A;  2RCB A;  3H6W A;  1I6Q A;  1B3G A;  3AXF A;  4GD5 A;  3U94 A;  2M8C A;  3W9V A;  2HCA A;  1A7L A;  5TPA A;  3TEL A;  3FZV A;  5I84 A;  4IO4 A;  4ZEF A;  4G68 C;  1MY0 A;  3ECR A;  4YB5 A;  3C9H A;  4X9T A;  4IO5 A;  1H44 A;  4HW8 A;  5CBR A;  2AYS A;  1Z7M E;  1M5E A;  1MY1 A;  4IY5 A;  5AA2 A;  5JTY A;  1TWY A;  3S9N C;  2I3W A;  3MC2 A;  1MY4 A;  3LSX A;  1IIT A;  3KG2 A;  3P7I A;  3KZG A;  1PBP A;  5K2X A;  1QUL A;  2HXW A;  1MDP 1;  1ZJL A;  4LAT A;  3GBB A;  4OEU A;  4EQB A;  4RK2 A;  3U8Q A;  1ZTY A;  3OEN A;  2I0C A;  4R2B A;  2Z8F A;  3FGS A;  4F31 B;  4IY6 A;  3Q26 A;  1XHY A;  3ZS6 A;  3K4U A;  4R6H A;  3KOS A;  3OSR A;  1B4H A;  1NL5 A;  3I3V A;  3KEI A;  4MBP A;  2O7I A;  1WOD A;  5H8Q B;  1PB9 A;  4LZ8 A;  5K2Y A;  1NFT A;  3FAS A;  3PD8 A;  1SYH A;  2XXY A;  1N0T A;  5F7V A;  4POW A;  4OTE A;  1JEV A;  4KI0 E;  4U23 A;  2O69 A;  3IL1 B;  1US4 A;  3RN8 A;  4QF9 A;  3FJG A;  4ELQ A;  3VVD A;  1SBP A;  4GXS B;  1LB9 A;  4GFR A;  4LZ5 A;  3N5L A;  1B1X A;  1Y3P A;  1IZ1 A;  3U93 A;  4KCD A;  3T9V A;  3S9E A;  1QUK A;  1N7W A;  3H6T A;  1LST A;  3RPW A;  4P0I A;  1O7T A;  1ZKB A;  4E0X A;  4R9F A;  4AQ4 A;  1R1N A;  4NF6 A;  4YKJ A;  5KCJ B;  4BLA A;  4L17 A;  1BTJ A;  4RY1 A;  4QFO A;  1B7H A;  4IGR A;  3KFM A;  5DT6 A;  2UVI A;  4TQU Q;  3MUQ A;  3M3L A;  2O6A A;  3CIJ A;  2H4I A;  4F1V A;  3MWB A;  3FUZ A;  1MXW A;  3PU5 A;  3T93 B;  1O64 A;  3L6G A;  2UYF A;  1AIV A;  3Q29 A;  3FV2 A;  1Y9U A;  4PQJ A;  1H45 A;  3SES A;  1Y3Q A;  4NWD A;  3MQ9 A;  1LBC A;  4OEN A;  4YU0 A;  3RQT A;  2P2A A;  3IK6 B;  4M1V A;  2Q2C A;  2Q88 A;  1LAG E;  3E13 X;  3FAT A;  3QUF A;  2QJE A;  5H8H A;  3MBP A;  5H8N A;  3H03 A;  4ZE8 A;  3LBS A;  1P1N A;  1OIB A;  1HSE A;  1FTO A; 
#chains in the Genus database with same CATH topology
 4NX1 A;  2WBB A;  3T96 B;  3PD9 A;  2DOJ A;  4LFA E;  2HFB A;  2EPM X;  4GL8 A;  2L3C A;  3H7M A;  2L2N A;  5A6B D;  1IQO A;  3DF6 A;  4JVD A;  2QVV A;  4YB6 A;  4OFJ A;  1LBB A;  2LTR A;  1OVB A;  3ZOQ B;  2LBS B;  3FXB A;  2FVZ A;  2PT2 A;  2QS1 A;  4PFT A;  5CM6 A;  5B7D A;  3RUM A;  1CE2 A;  3PPO A;  3J7Y p;  1B9J A;  5BWJ A;  1VDW A;  2XXR A;  4HCW A;  1IMB A;  4Q0C A;  3TOD A;  4ZS9 A;  3OOA A;  2ABH A;  2F6P A;  5ITO A;  4N8G A;  5AE1 A;  4DV5 E;  3CFX A;  2CT1 A;  2RIN A;  2ZXT A;  1D3K A;  1IME A;  3IJX B;  1JVY A;  1FKA E;  5DTB A;  2A25 A;  4XTC Q;  3ADI A;  3O6H A;  2DRP A;  1FBP A;  1WRJ A;  1PC3 A;  4QBA A;  2OWS A;  3FIG A;  2HHM A;  4DUZ E;  1FPK A;  4R03 A;  1P1O A;  4R2D A;  2HQ0 A;  4GIZ A;  4YHH E;  1XNR E;  4G68 B;  3B7D A;  2XXX A;  4O5G A;  2EMA A;  4JI4 E;  4OVJ A;  1FPF A;  1G2F C;  3BBR A;  4N07 A;  3IJO B;  1LGB C;  4WXJ A;  1B3E A;  3ONM A;  1VFD A;  4JWX A;  2XXQ A;  2VGQ A;  3PUW E;  3B50 A;  5EHS A;  1SPI A;  3MP6 A;  4NF8 B;  5CI5 A;  5I2K B;  4KR5 A;  2Z23 A;  1MG1 A;  2I3V A;  2YLN A;  2UXA A;  2LVH A;  2QMX A;  3TAJ A;  4ONY A;  3O28 A;  2PBW A;  3A3U A;  5H8F A;  3N6T A;  4DV0 E;  4GQO A;  4NF4 A;  4BS9 A;  4U4S A;  1NKX A;  1MS7 A;  4BHC A;  1IUD A;  4O94 A;  3HQ1 A;  1WHN A;  1EYJ A;  4J8Z A;  2AL5 A;  2REJ A;  4FEC A;  2ZZV A;  1IBL E;  2ESN A;  2EPU A;  1ZAA C;  1EH7 A;  3EHU A;  1EZP A;  5DW8 A;  2F3B A;  3BBG A;  4GEQ B;  1X48 A;  5DEX B;  2JR1 A;  2YPN A;  4YMA A;  1LCT A;  2H36 X;  4AQY E;  5A69 A;  1M5C A;  4DV7 E;  4OYV A;  2EN3 A;  1N34 E;  2Y5K A;  1A1J A;  3EF7 A;  4U2R A;  4N6K A;  1CNQ A;  2PX1 A;  4NXM E;  2EOJ A;  4O3A A;  4JI8 E;  4F6M A;  3TKD A;  4ZED A;  4TLL B;  2DWH A;  4YZZ A;  4GX4 A;  4N13 A;  2ELY A;  1XOC A;  1DQ3 A;  3TTK A;  5IZ3 A;  3K01 A;  4R2F A;  1DI2 A;  2N8X A;  4XF5 A;  3PPQ A;  3SEV A;  2LUP B;  1UN6 B;  4PFI A;  1T0K A;  2PT1 A;  3KOT A;  2QRY A;  2LT7 A;  1FQD A;  4Z0I A;  2HZL A;  1NUW A;  2FYI A;  4G4P A;  5AA4 A;  1PDA A;  2THI A;  2ANJ A;  4KFQ A;  2GHB A;  3J81 C;  3SET A;  4PE5 B;  2HXR A;  4DR3 E;  4OES A;  4YKI A;  5IM2 A;  5A5X B;  3C4B A;  5JEI A;  3GXA A;  4F2Q A;  3FVG A;  5ADZ A;  4GBV A;  5FHO A;  4JDF A;  1ELJ A;  2E72 A;  3J7A G;  4QSD A;  4DV2 E;  2V84 A;  4K3F A;  5H8Q A;  2QS2 A;  3A29 A;  1B69 A;  1LBW A;  3UK4 A;  1IMU A;  2F5X A;  4JI7 E;  4F18 A;  1JNF A;  4OAN A;  4TUG A;  2PFZ A;  3LSW A;  2M7Q A;  4G8M A;  4K0K E;  1F2I G;  1B5J A;  5L9O A;  3HXL A;  1LAF E;  1NEI A;  2NUE A;  2ONS A;  4PCD A;  2JY9 A;  3TCF A;  4UA8 A;  3PGF A;  4THI A;  2RS7 A;  3PPR A;  1Y4T A;  2DSF A;  3QK6 A;  1OVT A;  3J80 C;  3SER A;  3DLN A;  4IO7 A;  2QFL A;  4F2O A;  4ESW A;  3EPE A;  3T22 A;  1NV0 A;  2YZT A;  2EPZ A;  1EH3 A;  2LAO A;  3TUS A;  5I57 B;  2QVU A;  1T4L B;  1QUJ A;  4HE2 A;  2EQ1 A;  2JP9 A;  1FPG A;  4OVS A;  4N15 A;  2NOO A;  4X04 A;  4MHF A;  4XKP A;  4KYE A;  3OTO E;  3KSJ A;  4RPO A;  1SVX B;  3G3F A;  3T0J A;  1MH4 A;  4YIC A;  1UIL A;  2NUV A;  2DXY A;  4P11 A;  5M2V A;  4GWO A;  1BBO A;  4MX6 A;  5KCJ A;  2BJJ X;  2XD3 A;  2CMO A;  4GXA A;  4U1O A;  3U1O A;  2V85 A;  1MDQ A;  1OMP A;  1MH3 A;  3O97 A;  1TN9 A;  1URS A;  4F39 A;  4UAC A;  5DVJ A;  4XKN A;  1B3F A;  4C1U A;  2D9H A;  1FBD A;  3IO4 A;  4OXV A;  1OLC A;  3H4Z A;  2UXD E;  4DR4 E;  1J26 A;  2F8D A;  3Q28 A;  2H25 A;  2WBD A;  3DJW A;  2XWO A;  2H98 A;  4PFR A;  1L5T A;  5LL6 R;  1KJK A;  1Y1Z A;  3HTX A;  2F36 A;  3FVN A;  4R6Y A;  2EL5 A;  4U21 A;  4KZS A;  3ADJ A;  1D9Q A;  1NV4 A;  4EF2 A;  2EN7 A;  1PBQ A;  3S9M C;  1QVS A;  2WZO A;  4PFB A;  4DXC A;  3MHH C;  2YTN A;  5J16 A;  4P8B A;  4HTG A;  4DCY A;  3OO8 A;  4ELO A;  3GZG A;  4OVT A;  3KSX A;  3HPI A;  4NED A;  3S9L C;  1YZ0 A;  2RC8 A;  3HV1 A;  3F11 A;  2V89 A;  4MLV A;  4GOT A;  5EYH A;  1XS5 A;  1HNW E;  3IFC A;  4R73 A;  4I8O A;  4O7I A;  3B6T A;  2K7I A;  4WX9 A;  1EYI A;  1M5B A;  1B52 A;  2JYA A;  4M30 A;  2Q9T A;  4H1X A;  4OWD A;  1FTK A;  4RK9 A;  1Z7N E;  2E0S A;  4JI6 E;  3CRB A;  1POT A;  5I5P A;  2ADR A;  3OO6 A;  4OEV A;  3FVO A;  2JXP A;  2YJP A;  4R72 A;  2UYE A;  3QYT A;  4QFL A;  4JWO A;  4Z7E A;  1N04 A;  2P3N A;  2L6M A;  3DP4 A;  4P7D A;  2V93 A;  1DBZ A;  2XXU A;  4BDM A;  3CSB A;  2DWI A;  1FBF A;  2Y5L A;  1P1U A;  2K4V A;  5CBS A;  2DWA A;  3BGH A;  5LOM A;  1YYO A;  1WDN A;  4N81 A;  3U92 A;  1EKZ A;  1N7X A;  4F29 A;  1H3D A;  3ZKL A;  3JV9 A;  3OML A;  5AA4 B;  1SYI A;  3K6X A;  2QS4 A;  1LB8 A;  4I62 A;  2EML A;  1MQH A;  4O43 A;  2EPO A;  3EHS A;  2ZMB A;  4EXL A;  2HGH A;  3VHT B;  5IAI A;  4R2P A;  4DR7 E;  1R9L A;  2G29 A;  4FE8 A;  1ZBQ A;  4KHZ E;  1I6B A;  4EF1 A;  2EL6 A;  1DMB A;  1SDX A;  2Y7R A;  2ONK E;  1D4N A;  1XNQ E;  5KL5 A;  4R8O A;  2Z8E A;  4DXU A;  5IT9 C;  4X8R A;  5F3W A;  3K6V A;  3MPL A;  4LF7 E;  1MQG A;  1J1N A;  4X9J A;  4KCC A;  4OET A;  1N3X A;  5CMK A;  3ILU B;  2NAB A;  1DK4 A;  4MF3 A;  3K1P A;  4G68 A;  1NUZ A;  4JB7 A;  4LZ7 A;  4PDH A;  1B05 A;  2DYX A;  2GRV A;  2H99 A;  4OOG C;  2FA7 A;  3R6U A;  1D9V A;  1POY 1;  2HC5 A;  4XFE A;  4POX A;  5FHM A;  4ZEB A;  3GLB A;  4LQ5 A;  1WVJ A;  2VPO A;  4NF8 A;  5I2K A;  1SW1 A;  2YWQ A;  2MC6 A;  3T66 A;  2KOU A;  1XVX A;  3LSF B;  2G93 A;  4N6D A;  1NUY A;  1P99 A;  2OZZ A;  1BIY A;  5AAS A;  5A5L A;  1BK4 A;  1IEJ A;  4ND9 A;  1JET A;  2YTQ A;  5I56 B;  3HPS A;  3H06 B;  3IWD A;  2REG A;  1QJM A;  1JK2 A;  1LBV A;  3RMP A;  1KZ8 A;  5DVI A;  2BJI A;  1NV6 A;  5ICQ A;  2MKN A;  4GWX A;  5DEX A;  2I13 A;  5KZT A;  2NA2 A;  4EUO A;  2FIX A;  1B7Z A;  3W9W A;  3N26 A;  4F3P A;  3CSG A;  3O66 A;  5IWA E;  2VHA A;  4LON B;  4XXU A;  4XIG Q;  4FED A;  3T9U A;  3TCG A;  2HAU A;  2ZYN A;  4P56 A;  1DPP A;  3SEX A;  3EHT A;  3LV0 A;  2WBU A;  2BB8 A;  1X3C A;  4OX9 E;  1EYK A;  3QSL A;  5CMB A;  3VYY A;  4JYA E;  2UXB E;  2D3I A;  4MNP A;  1A1G A;  2OX3 A;  1YAE A;  4ZDM A;  1DOT A;  3OD7 A;  3T1H E;  1B0L A;  1GR2 A;  1VFE A;  3THI A;  2DXR A;  1FW0 A;  2L2M A;  4LN5 A;  4BMJ A;  1RQ0 A;  3MZB A;  4F3B A;  5TP9 B;  2RQL A;  2R9J A;  5FHN A;  2V3Q A;  5CMC A;  1HSJ A;  1MQJ A;  3CVG A;  4PDD A;  2EMK A;  4EQ9 A;  2J7J A;  1MXZ A;  2EMF A;  2X26 A;  1ATG A;  4IS1 C;  4H67 A;  4DV6 E;  1O0W A;  2DIX A;  1A8F A;  5A5X A;  3IX1 A;  2EM0 A;  1FPD A;  4R9G A;  4DR2 E;  4XKR A;  3VYX A;  3HCQ A;  2L33 A;  1FTM A;  4O3B A;  2FHY A;  2DE4 A;  3M3F A;  4GX6 A;  3CFZ A;  4ELR A;  1Y20 A;  4LFB E;  3C4M A;  4R75 A;  2RC9 A;  1QKB A;  1MXU A;  2D21 A;  2B3T B;  1IXI A;  1ANF A;  2ELZ A;  4N4R B;  1HNZ E;  3G3J A;  3VV5 A;  3IFA A;  4O7M A;  1MPD A;  3TFL A;  2ZYM A;  3D1R A;  3IWC A;  5H8S A;  5IZ1 A;  4PF6 A;  3T9X B;  2DGC A;  1FPE A;  5ELV A;  3IB1 A;  3F6G A;  1UIU A;  2WBT A;  4XEQ A;  2B4M A;  1ZBT A;  1IXG A;  3L00 A;  3RYD A;  5IGA A;  1ZMG A;  4NHB A;  5KL7 A;  4DUY E;  2LJH A;  3UP9 A;  4MMP A;  2EPP A;  5CFF E;  3PPN A;  4JI0 E;  3HPZ A;  3OXN A;  3JYR A;  3VFJ A;  5LMN E;  4OVQ A;  1S50 A;  4NQ8 A;  2DLQ A;  4QFP A;  3HO7 A;  2F34 A;  4WSP A;  4MEV A;  5I57 A;  2R6G E;  2M1S A;  2IA4 A;  2ENH A;  2ZNS A;  2GHA A;  4WED A;  3PUX E;  2VE7 C;  3RT6 B;  2MC5 A;  3C34 A;  2EM3 A;  1LEV A;  2DVC A;  3FVK A;  4PET A;  1FTL A;  1GZ6 A;  3CI8 A;  3TTL A;  4OZ9 A;  5CC2 A;  1A1L A;  2EJ4 A;  1TXF A;  4JVC A;  3VXC A;  4AB5 A;  4ESX A;  2Y7P A;  2Q2A A;  1MY2 A;  1N3W A;  3H09 A;  3K6W A;  4EQB A;  2HAV A;  3S4U A;  4N6P A;  2GQ1 A;  2XXK A;  5TSE A;  1LBX A;  1A55 A;  3RTF B;  3DP6 A;  3UGW A;  1QUI A;  3FBP A;  1A40 A;  4U4X A;  4PGP A;  3NOH A;  1YYW A;  3ZKK A;  3C32 A;  5T6J A;  3VXB A;  4ZEC A;  3JAM C;  4X62 E;  2EMX A;  2XXT A;  1MQD A;  3G3I A;  4ZYD A;  2EOY A;  1JK1 A;  2Y7W A;  3VE1 B;  1DTZ A;  3TQL A;  3TCH A;  4OFO A;  4YB7 A;  3BFU A;  1AMF A;  3IB2 A;  1QNT A;  4HE1 A;  3DM0 A;  4B3R E;  3TDJ A;  3FXU A;  3IOW A;  4R2Q A;  1USY E;  1URG A;  2R76 A;  5A6B A;  3MVW A;  3QXM A;  3ROJ A;  2CZH A;  4IO2 A;  2R1F A;  4KPT A;  1K9Z A;  2XX9 A;  3BFT A;  3KC1 A;  3SEW A;  3B6Q A;  2EPR A;  1N33 E;  1IMD A;  4R6K A;  2B7V A;  4KYD A;  1LFG A;  1NV7 A;  3W15 C;  4JWY A;  2UVG A;  1VE4 A;  2FV4 B;  4WEP A;  2FBP A;  4EQ7 A;  4WYQ B;  1EZO A;  5HPQ A;  1IIW A;  2I6E A;  4H5G A;  4DIG A;  1BP5 A;  2NVU B;  3RPL B;  5IXM B;  2XX7 A;  3PMX A;  4GKK E;  3O6G A;  1SQY A;  2AL4 A;  1I69 A;  3FXQ A;  3I5O A;  3E79 A;  4HXV A;  4JI1 E;  3AUZ A;  3Q25 A;  2LUQ A;  4MH5 A;  3GYY A;  1NMU A;  3EPL A;  5ET5 A;  3TQW A;  2NUG A;  3FIR A;  1LBY A;  2WYK A;  3K1M A;  2RSM A;  3RT8 A;  2V3U A;  3V8X B;  4GLI A;  2V25 A;  1XMQ E;  2V3T A;  2O51 A;  3PMV A;  5F24 A;  4G8H A;  2YTG A;  2XXV A;  2DE3 A;  4I8C A;  2YTO A;  1PJT A;  4F9A B;  2A5T B;  2D5W A;  2O84 X;  1SW5 A;  1P1Q A;  2F7B A;  3C31 A;  4LP2 B;  3Q27 A;  2L2K B;  4OA4 A;  2RF1 A;  2XWV A;  3N94 A;  4PFU A;  2WKY A;  1FCK A;  1NUX A;  1MGT A;  2LE2 A;  1X47 A;  4R2E A;  2QL3 A;  2I0B A;  3PUV E;  2ODR D;  4ZYE A;  1JW5 A;  3JZJ A;  3RLF E;  5DVF A;  1IXC A;  2I4B A;  3O29 A;  1MPC A;  4BBY A;  4F19 A;  2JOX A;  4GWW A;  4NG7 A;  2HZK A;  4NMY A;  4KD5 A;  3KBZ A;  3K6U A;  3QMF A;  2EOM A;  2DSY A;  1G0I A;  2WX9 A;  2ODR C;  4NTL A;  3MP1 A;  1ZLQ A;  2ZZX A;  4GVO A;  5AE3 A;  5ET7 A;  5FTH A;  2B3B A;  4YKP A;  1NV1 A;  2DMY A;  3SEY A;  2GPI A;  2LMZ A;  2N3H A;  1P1W A;  4QFN A;  4P78 A;  1TFD A;  4QSE A;  1SD3 A;  2ZNT A;  4FAJ A;  3I6V A;  2OWT A;  4OVP A;  4IO6 A;  2F4V E;  2B65 A;  1SFE A;  3G7W A;  1DPE A;  4NWC A;  4OVR A;  5I56 A;  4PAI A;  2VD2 A;  1N84 A;  3G3G A;  3IOU A;  3OEK A;  1B5I A;  4ECF A;  1UIV A;  3PUY E;  2DE2 A;  5JK4 A;  2DS9 A;  4FBP A;  1VSO A;  5AA2 D;  2Y7K A;  4HE0 A;  3QIM A;  4RA1 A;  4LF6 E;  1RC7 A;  1T4N A;  5EQA A;  3UN6 A;  1LBZ A;  1FBE A;  2YTF A;  4BDN A;  1D9Y A;  2O1M A;  4YMB A;  5ET8 A;  2EE8 A;  2AIX A;  1B1H A;  1N76 A;  2OJT A;  1M5F A;  2LRS A;  1UTH B;  1X6F A;  2PCR A;  1DGC A;  2VRD A;  2Z22 A;  4ZZE A;  4DXB A;  1Y4C A;  3M8U A;  2O1L A;  1B58 A;  4OFL A;  2YU5 A;  1B51 A;  4BCA A;  2DVZ A;  1B5H A;  5IZZ A;  1UBD C;  3K1N A;  3P1X A;  2EPN A;  4I1D A;  2EP3 A;  1USY H;  4XKQ A;  2EMB A;  1B3H A;  3A09 A;  3BKI B;  1O63 A;  5TP9 A;  2JPA A;  3MHS C;  2O7U A;  4ISU A;  5I59 B;  3HST A;  3KN7 A;  1LAX A;  4IO3 A;  2V87 A;  4EXK A;  4FJP A;  5HM4 B;  3MYU A;  2ZYK A;  3ZSF A;  2OLB A;  2V8Q B;  2YRH A;  2GHF A;  1ZIU A;  4GZN C;  2PFY A;  1SI0 A;  3UA8 A;  4C1T A;  3PMW A;  2E1M A;  1M5D A;  2UVJ A;  1EH6 A;  1UTB B;  4R2C A;  4LF5 E;  1LFH A;  2R71 A;  5I58 B;  3JU0 A;  1SW2 A;  1Y3N A;  5HBC A;  4DZ1 A;  4QSC A;  1NH8 A;  3MST A;  1FQA A;  1LLS A;  2PYY A;  2XHD A;  5B70 A;  2YSP A;  4NHR A;  5J1D A;  2EMY A;  3KBR A;  4GBW A;  3C4T A;  2EN1 A;  1LCF A;  4LA9 A;  3VVE A;  1RYX A;  1B46 A;  3FD3 A;  4IR8 A;  2V4C A;  4LTY A;  3G3H A;  1F9B A;  2V86 A;  1BB8 A;  5F1Q A;  2Z8D A;  1JEU A;  1A1K A;  1FBG A;  1NNP A;  4DMI A;  4P47 A;  4DCX A;  4BDR A;  3IOR A;  2VQF E;  2EM9 A;  5KDT B;  2E1S A;  4JSO A;  3C6M A;  1Q35 A;  1I94 E;  1QW0 A;  4BDO A;  3GBA A;  3TYH A;  1B7U A;  1FQB A;  1A54 A;  4NF5 B;  2G7H A;  3B8B A;  3HHF A;  3ILT B;  4DI3 D;  3BIH A;  4FIM A;  1OLA A;  4JV5 E;  3MVZ A;  2I9I A;  1S7Y A;  2P0S A;  1PB7 A;  4ZEI A;  2KLF A;  4DKK A;  4ZYG A;  4N4U A;  4ZEK A;  3IO6 A;  4PAF A;  2KON A;  1NNK A;  3MSW A;  1T39 A;  2EPX A;  2N3G A;  3KN3 A;  4L5N C;  2Y7I A;  4M0V A;  5KL4 A;  1MXV A;  3CFL A;  1TF6 A;  3H6V A;  3TTR A;  3QG5 C;  3ODB A;  4H8I A;  4AS5 A;  3ISP A;  3A3C A;  4NXN E;  2GLI A;  3VLW A;  3TTN A;  2XXP A;  4GKJ E;  2F3D A;  2I49 A;  1BBG A;  4GWU A;  1OQH A;  2EOO A;  5L8D A;  2HPG A;  2ZNU A;  3C35 A;  3VVF A;  3IOV A;  1EZ9 A;  4KQP A;  3LLH A;  2CEX A;  3CG3 A;  3TEP A;  5I2N B;  4F22 A;  4I9D A;  2IEE A;  3H6U A;  5AE4 A;  2RCA A;  3RGY A;  1FPJ A;  2BBG A;  5A2Q C;  3BIG A;  2MDG A;  1FTA A;  1TT1 A;  1XT8 A;  4MNI A;  2XWI A;  1VR5 A;  2B9D A;  3K02 A;  1PB8 A;  4GWS A;  4R74 A;  1YYK A;  3SZP A;  4NE4 A;  1GTK A;  2YTD A;  2F6G A;  2EPA A;  2YRM A;  2CZL A;  2Q74 A;  3VLV A;  1A8E A;  4I3Y A;  3E3K A;  4Q30 B;  5I3S A;  2EOI A;  2QSX A;  2EPC A;  2UXC E;  4RNS A;  1FPB A;  1HSL A;  1JW1 A;  4PFY A;  1IQS A;  4B3M E;  3EQ1 A;  3SDF A;  1NH7 A;  1MM6 A;  3MZ1 A;  2WYP A;  4G77 A;  2VP1 A;  1JQF A;  1US5 A;  2I48 A;  4FAT A;  1KA0 A;  4N91 A;  4IGT A;  4GWZ A;  2EN2 A;  4U22 A;  3TZA A;  3RPL A;  3R7X A;  2F35 A;  2IHR 1;  4JI3 E;  4QFK A;  2ZM6 E;  2DWJ A;  1MPB A;  2ENA A;  1B40 A;  3C36 A;  1FBH A;  4LQ2 A;  2H9B A;  4N17 A;  2FIE A;  4MFI A;  2EN6 A;  1QKA A;  4RYA A;  4HS7 A;  1AH5 A;  5CRY A;  2Q89 A;  3MW0 A;  3V83 A;  4HEI A;  3MZ9 A;  4YKK A;  2UUA E;  3MVX A;  3UOR A;  1AWB A;  2H5Y A;  2GFE A;  4TOZ A;  5I7I A;  3EPK A;  1G2D C;  2A5T A;  4QHQ A;  1X6E A;  2LTS A;  3T1Y E;  2QMW A;  5AA3 A;  1KWH A;  3K2D A;  1FQC A;  1AOV A;  4BC9 A;  2QS3 A;  1BKA A;  3UK3 C;  3O9P A;  5BUU A;  2HEU A;  4H5F A;  2V88 A;  1II5 A;  2ONR A;  4OHN A;  2O68 A;  3FV1 A;  1B0H A;  1PKP A;  5TPA B;  1GGG A;  1FJ6 A;  1GQE A;  3USD A;  2L5V A;  5FBP A;  4MLQ A;  4TUI A;  3L6H A;  1DSN A;  1RDX A;  4C0R A;  2JVA A;  1FJG E;  4UAB A;  4AS4 A;  4LF9 E;  1AL3 A;  3MP8 A;  2EMI A;  4NZV A;  3E78 A;  2EPK X;  2WCC 3;  3IR1 A;  3O2A A;  5DYH A;  2B3F A;  2UVH A;  4LF8 E;  3U72 A;  4DR5 E;  5AA2 B;  5JTY B;  2ZZW A;  4PGN A;  3KJT A;  2VF1 A;  4OER A;  3BID A;  5ESY A;  3M99 B;  3OSQ A;  1B4Z A;  2Q8M A;  3D4G A;  4F3S A;  2XX8 A;  4X1D A;  4X65 E;  3LR1 A;  4DV3 E;  4YAH X;  2F8B A;  2I4C A;  1FQE A;  4PP0 A;  2OWZ A;  3DP8 A;  3E4R A;  4OMB A;  4PTK A;  4KWY A;  2EQ0 A;  3LML A;  4LU9 A;  4BHB A;  2JWO A;  3WAF A;  2YTI A;  2LO3 A;  4JI2 E;  2ZYO A;  3O6I A;  1B6H A;  2PMS A;  1RYO A;  4P9K A;  3SEU A;  3N6U A;  2Y84 A;  1HR0 E;  1UHZ A;  3IOT A;  1FBC A;  3FJ7 A;  1MQI A;  3KGC A;  2XXH A;  5ITP A;  4NN3 A;  4ZZA A;  2ALU A;  2KR0 A;  4P3L A;  2HHH E;  4PAK A;  1QGX A;  5IV8 B;  4Q5T A;  4LUB A;  4H65 A;  4I3E A;  2NWJ A;  1UTH A;  2EMH A;  4DV1 E;  5AA1 A;  2F7C A;  3B6W A;  3LC8 A;  3SKP A;  2DLK A;  4BDL A;  4Q8R A;  1KYQ A;  2DMI A;  1N32 E;  1RMD A;  1WXR A;  4RPN A;  4PBH A;  1B2H A;  4O24 A;  4QRZ A;  4H8J A;  5A6K A;  4WPY A;  3C33 A;  3ADG A;  5TU0 A;  3CG1 A;  4EDP A;  2Q8U A;  3T1B A;  1XC1 A;  3KJ7 A;  4X1B A;  1SI1 A;  4RXL A;  4ZE9 A;  3MJN A;  2A5S A;  3EN3 A;  3OO7 A;  1R6Z A;  4H0W A;  2I58 A;  4OQO A;  5I59 A;  2DQV A;  2MDR A;  1CB6 A;  3LSL A;  2EWL A;  4R2R A;  3TMG A;  3MVY A;  1IXH A;  4PE3 A;  1SW4 A;  2QVR A;  1WJP A;  3FJM A;  3H3G A;  1G0H A;  4ZYH A;  4DR1 E;  5IKB A;  4H46 A;  3KWR A;  2RKM A;  4Q35 B;  1UTB A;  1H76 A;  3RNN A;  5L9M A;  4H6D A;  3WAE A;  2CTD A;  1LAH E;  3FXR A;  5I58 A;  3R26 A;  2RC7 A;  5L9S A;  1Q1K A;  4X48 A;  4G8N A;  4U1Z A;  4BDQ A;  1BLF A;  2FNC A;  4P0G A;  1URD A;  1YUI A;  3S2V A;  1EU8 A;  2LCE A;  3EKI A;  1PEB A;  1FTJ A;  1J5E E;  2XD2 A;  4NF6 B;  1MRP A;  1Z1B A;  4RJZ A;  3KC0 A;  1FQF A;  5ICT A;  2XA5 A;  4WXC A;  4RHB B;  3OMB A;  1EH8 A;  2DP8 A;  1AAY A;  3E9X A;  4X64 E;  5CMM A;  4O8M A;  1UQW A;  2OCU A;  3HN0 A;  2ENC A;  3K00 A;  2YU8 A;  4F3G A;  1RKM A;  2GH9 A;  2R8T A;  2EM6 A;  5KDT A;  1R9Q A;  2F7A A;  4FEB A;  4KYS A;  1INP A;  4JXI A;  2EOX A;  2YRK A;  4RH8 A;  5AE2 A;  4PFW A;  4NF5 A;  4G2Z A;  3BF2 A;  4R2S A;  4X8W A;  5LTC A;  1LFI A;  3V89 B;  1DTG A;  3PUZ E;  2LV2 A;  3RY3 A;  1TFA A;  2EOH A;  1MXX A;  1JVX A;  3HHG A;  1FJ9 A;  5LMU E;  2QPQ A;  1YPN A;  4ELP A;  3ADL A;  1NI9 A;  1YCJ A;  2EMW A;  1B3L A;  3KN8 A;  3D4C A;  4DE8 A;  1FSA A;  3RTW B;  2XXW A;  4B3S E;  1S9T A;  4X66 E;  2YSO A;  1NNT A;  1NNF A;  2EOQ A;  4YY3 E;  2OK2 A;  5EYF A;  3TPA A;  1MY3 A;  5AC5 A;  5H8H B;  1NV2 A;  3PPP A;  1YXI A;  2CSH A;  2EL4 A;  5H8N B;  2EOF A;  3LUY A;  1HNX E;  2EM5 A;  4JI5 E;  2VOZ A;  2RPC A;  4N8Y A;  1PJS A;  2VD3 A;  2EM4 A;  2WBS A;  4GL0 A;  4M4G A;  3DEL B;  1IMF A;  1XVY A;  2CPN A;  4MJO A;  1X6H A;  1GV8 A;  5ISU A;  2EOR A;  4GRK A;  2P3V A;  1A99 A;  4P1L A;  3OEM A;  2EQ3 A;  5I2N A;  5BR8 E;  2OBG A;  2V83 A;  3VDF A;  2JOB A;  1STU A;  1MXY A;  2L8T A;  1YTV A;  1QU6 A;  5EYG A;  1FPL A;  4HCY A;  2P1S A;  4L8N A;  2MKZ A;  4JSD A;  3VLU A;  2X7Q A;  1ZU0 A;  3IAZ A;  4GF8 A;  4NF0 A;  3M3K A;  1I6A A;  1K9Y A;  2Q8J A;  4WFT A;  2W7Y A;  5KL2 A;  3K0V A;  1FRP A;  2EOZ A;  2X7P A;  4F2J C;  2XXI A;  3OEL A;  4NGU A;  4PF8 A;  3EPH A;  2UUC E;  4E0W A;  1T38 A;  4LVQ A;  1JW4 A;  5LLQ A;  1JP4 A;  1XI6 A;  1MM7 A;  3QAX A;  5EHM A;  3CR9 A;  4QXD A;  5A6A A;  4IB2 A;  5EQ7 A;  3QUJ A;  4JVI A;  2VQE E;  3OO9 A;  2YT4 A;  2PVU A;  1OQG A;  1ZBM A;  1Y1M A;  3TTM A;  4F1U A;  4FOR A;  3T9H B;  2MKD A;  3KZZ A;  3V5A A;  4O4K A;  4JBZ A;  4DR6 E;  4O3C A;  4G61 A;  2M9A A;  4FK5 C;  1B32 A;  2F78 A;  3IWB A;  4AB6 A;  3G3K A;  2F97 A;  5FLX C;  3MPK A;  4F9B B;  1IQ7 A;  4DLD A;  1H43 A;  4WSG A;  4WKM A;  1RDY A;  4F1Y A;  1A1I A;  4DDD A;  3UIF A;  2UUB E;  2NXO A;  3PV0 E;  5H8F B;  4NF4 B;  4TLM B;  5FTI A;  1KA1 A;  3MAM A;  3IB0 A;  1GVC A;  1NV5 A;  3AV0 A;  2RCB A;  3H6W A;  1I6Q A;  1B3G A;  3AXF A;  4GD5 A;  3U94 A;  2M8C A;  3W9V A;  2HCA A;  3EPJ A;  1A7L A;  1XMO E;  2L3J A;  1RDZ A;  5TPA A;  1T4O A;  4IJD A;  3TEL A;  2DDK A;  1A1F A;  2EMG A;  3FZV A;  4GX3 A;  3CHG A;  3HFU A;  4F54 A;  1LLM C;  1ZR9 A;  2EMZ A;  5I84 A;  4IO4 A;  4ZEF A;  4G68 C;  2M4I A;  1IMC A;  1MY0 A;  3ECR A;  4YB5 A;  2EM8 A;  3C9H A;  1N36 E;  4X9T A;  1IMA A;  4IO5 A;  1H44 A;  4HW8 A;  2YTJ A;  5CBR A;  2AYS A;  1Z7M E;  5EQ8 A;  1M5E A;  1MY1 A;  4IY5 A;  5AA2 A;  5JTY A;  1TWY A;  2CEY A;  3S9N C;  2I3W A;  1Q9D A;  3MC2 A;  2EOE A;  1MY4 A;  3THN A;  4M9V C;  3LSX A;  1IIT A;  3KG2 A;  3P7I A;  3KZG A;  2EPL X;  1PBP A;  5IZ3 B;  5K2X A;  2L92 A;  1NV3 A;  1QUL A;  2HXW A;  2E5L E;  2PRT A;  2XWK A;  1MDP 1;  1ZJL A;  4LAT A;  3C6K A;  2YTP A;  3GBB A;  2FTX B;  2RSI A;  4OEU A;  4MCO A;  4PBQ A;  4RK2 A;  5EQ9 A;  1ZTY A;  3OEN A;  4BC7 A;  2I0C A;  3U8Q A;  4R2B A;  2Z8F A;  4KXP A;  3FGS A;  4F31 B;  4IY6 A;  2HJJ A;  3Q26 A;  1XHY A;  1YUJ A;  2JJK A;  4GWY A;  4I40 A;  3ZS6 A;  2CZK A;  2RTX A;  4NAP A;  3K4U A;  4R6H A;  3KOS A;  3OSR A;  3THO B;  1B4H A;  1NL5 A;  3I3V A;  3KEI A;  4MBP A;  2VPN A;  5KL6 A;  3LUZ A;  2O7I A;  1WOD A;  5H8Q B;  1PB9 A;  4LZ8 A;  5K2Y A;  3JTZ A;  4M2Z A;  1NFT A;  1N3G A;  5KL3 A;  3FAS A;  3PD8 A;  5DNY A;  1SR9 A;  2KQZ A;  2EOS A;  4MIJ A;  1SYH A;  2VT5 A;  1ZU1 A;  2NUF A;  2XXY A;  1N0T A;  5F7V A;  4POW A;  4OTE A;  1JEV A;  4KI0 E;  2EN8 A;  3F6H A;  4U23 A;  2O69 A;  3IL1 B;  1US4 A;  3RN8 A;  4QF9 A;  3FJG A;  2RS6 A;  1YFH A;  4ELQ A;  4F9C B;  2KHX A;  3VVD A;  1SBP A;  4GXS B;  1LB9 A;  4DV4 E;  4GFR A;  5ET6 A;  4LF4 E;  4LZ5 A;  3N5L A;  4LFC E;  1B1X A;  1Y3P A;  5T3J A;  1IZ1 A;  3TQM A;  1YYZ A;  4KCD A;  4MAG A;  3T9V A;  3U93 A;  3S9E A;  1QUK A;  1N7W A;  2CZI A;  4H45 A;  3H6T A;  1LST A;  3RPW A;  4P0I A;  1NCS A;  4P1E A;  1O7T A;  2B4L A;  1TF3 A;  2EN4 A;  1ZKB A;  1P47 A;  5A6J A;  4E0X A;  2B7T A;  4R9F A;  4AQ4 A;  1R1N A;  1YSA C;  4NF6 A;  4YKJ A;  4BLA A;  5KCJ B;  2UU9 E;  4L17 A;  1BTJ A;  2YTE A;  2EZ6 A;  1IBM E;  4RY1 A;  2LJU A;  4QFO A;  1B7H A;  1DCU A;  4B3T E;  4IGR A;  3KFM A;  5DT6 A;  4Q28 A;  1X49 A;  2UVI A;  4TQU Q;  3MUQ A;  1IBK E;  1X5W A;  2EMC A;  3M3L A;  2O6A A;  3CIJ A;  1L4S A;  3VK6 A;  2H4I A;  1WHQ A;  4F1V A;  3MWB A;  3FUZ A;  1FPI A;  2DB2 A;  1PJQ A;  1MXW A;  4MNC A;  3PU5 A;  3T93 B;  1O64 A;  3L6G A;  1YZ9 A;  2UYF A;  1AIV A;  3KZY A;  4KHP E;  3Q29 A;  3FV2 A;  1Y9U A;  4PQJ A;  1H45 A;  3SES A;  5AC4 A;  1Y3Q A;  1A1H A;  1MEY C;  4NWD A;  4R2A A;  3MQ9 A;  1LBC A;  4OEN A;  4YU0 A;  2FGG A;  3RQT A;  2P2A A;  3IK6 B;  2EM2 A;  2WEF A;  3U65 A;  3PTY A;  4M1V A;  4PC9 A;  4WXD A;  2Q2C A;  2Q88 A;  1LAG E;  3E13 X;  3FAT A;  3QUF A;  2QJE A;  5H8H A;  3MBP A;  3K6Q A;  3H03 A;  5H8N A;  4ZE8 A;  4F6N A;  5LDZ A;  3LBS A;  2EM7 A;  4DI4 B;  1P1N A;  1OIB A;  1HSE A;  1FTO A; 
#chains in the Genus database with same CATH homology
 3T96 B;  3PD9 A;  2DOJ A;  2HFB A;  4GL8 A;  3H7M A;  4YB6 A;  4OFJ A;  1LBB A;  1OVB A;  2PT2 A;  2QS1 A;  4PFT A;  5CM6 A;  5B7D A;  3RUM A;  1CE2 A;  3PPO A;  1B9J A;  5BWJ A;  2XXR A;  4HCW A;  4Q0C A;  3TOD A;  4ZS9 A;  3OOA A;  2ABH A;  2F6P A;  5ITO A;  3CFX A;  2RIN A;  2ZXT A;  1D3K A;  3IJX B;  1JVY A;  5DTB A;  4XTC Q;  3O6H A;  1PC3 A;  2OWS A;  1P1O A;  2HQ0 A;  4GIZ A;  4G68 B;  3B7D A;  2XXX A;  4OVJ A;  3BBR A;  4N07 A;  3IJO B;  1LGB C;  4WXJ A;  1B3E A;  3ONM A;  1VFD A;  4JWX A;  2XXQ A;  2VGQ A;  3PUW E;  5EHS A;  3MP6 A;  4NF8 B;  5CI5 A;  5I2K B;  4KR5 A;  2Z23 A;  1MG1 A;  2I3V A;  2YLN A;  2UXA A;  2QMX A;  3TAJ A;  4ONY A;  3O28 A;  2PBW A;  3A3U A;  5H8F A;  3N6T A;  4GQO A;  4NF4 A;  4U4S A;  1NKX A;  1MS7 A;  1IUD A;  2AL5 A;  2REJ A;  4FEC A;  2ESN A;  3EHU A;  1EZP A;  5DEX B;  2YPN A;  4YMA A;  1LCT A;  1M5C A;  4OYV A;  3EF7 A;  4U2R A;  2PX1 A;  4O3A A;  3TKD A;  4ZED A;  4TLL B;  2DWH A;  4YZZ A;  4N13 A;  1XOC A;  3TTK A;  3K01 A;  4R2F A;  3PPQ A;  3SEV A;  1T0K A;  2PT1 A;  3KOT A;  2QRY A;  1FQD A;  4Z0I A;  2HZL A;  2FYI A;  4G4P A;  5AA4 A;  1PDA A;  2THI A;  2ANJ A;  4KFQ A;  2GHB A;  3SET A;  4PE5 B;  4OES A;  4YKI A;  5A5X B;  5JEI A;  3GXA A;  4F2Q A;  3FVG A;  5FHO A;  4JDF A;  1ELJ A;  4QSD A;  2V84 A;  4K3F A;  5H8Q A;  2QS2 A;  3UK4 A;  2F5X A;  4F18 A;  1JNF A;  3LSW A;  4G8M A;  1B5J A;  5L9O A;  1LAF E;  2ONS A;  3TCF A;  4UA8 A;  3PGF A;  4THI A;  3PPR A;  1Y4T A;  2DSF A;  3QK6 A;  1OVT A;  3SER A;  3DLN A;  4IO7 A;  4F2O A;  4ESW A;  3EPE A;  3T22 A;  2LAO A;  1EH3 A;  3TUS A;  5I57 B;  1QUJ A;  2NOO A;  4XKP A;  4KYE A;  3KSJ A;  4RPO A;  1SVX B;  3G3F A;  1MH4 A;  4YIC A;  2NUV A;  2DXY A;  4P11 A;  5M2V A;  4GWO A;  5KCJ A;  2BJJ X;  2XD3 A;  2CMO A;  4GXA A;  4U1O A;  3U1O A;  1MDQ A;  1OMP A;  1MH3 A;  3O97 A;  4F39 A;  1URS A;  4UAC A;  5DVJ A;  4XKN A;  1B3F A;  4C1U A;  3IO4 A;  4OXV A;  1OLC A;  3H4Z A;  2F8D A;  3Q28 A;  2H25 A;  2H98 A;  1L5T A;  1Y1Z A;  2F36 A;  3FVN A;  4R6Y A;  4U21 A;  4EF2 A;  1PBQ A;  3S9M C;  1QVS A;  4DXC A;  4HTG A;  4DCY A;  3OO8 A;  4ELO A;  3GZG A;  3KSX A;  3HPI A;  4NED A;  3S9L C;  3HV1 A;  2RC8 A;  3F11 A;  4GOT A;  4MLV A;  1XS5 A;  4R73 A;  3B6T A;  1M5B A;  1B52 A;  2Q9T A;  4H1X A;  4OWD A;  1FTK A;  4RK9 A;  1Z7N E;  2E0S A;  3CRB A;  1POT A;  3OO6 A;  4OEV A;  3FVO A;  2YJP A;  4R72 A;  2UYE A;  3QYT A;  4QFL A;  4JWO A;  4Z7E A;  1N04 A;  3DP4 A;  2V93 A;  2XXU A;  4BDM A;  3CSB A;  2DWI A;  1P1U A;  5CBS A;  2DWA A;  5LOM A;  1WDN A;  3U92 A;  1N7X A;  4F29 A;  1H3D A;  3ZKL A;  3JV9 A;  5AA4 B;  1SYI A;  3K6X A;  2QS4 A;  1LB8 A;  4I62 A;  1MQH A;  3EHS A;  2ZMB A;  4EXL A;  5IAI A;  1R9L A;  2G29 A;  4FE8 A;  4KHZ E;  1I6B A;  4EF1 A;  1DMB A;  1SDX A;  2Y7R A;  2ONK E;  1D4N A;  2Z8E A;  4DXU A;  3K6V A;  3MPL A;  1MQG A;  1J1N A;  4KCC A;  4OET A;  5CMK A;  1N3X A;  3ILU B;  4MF3 A;  3K1P A;  4G68 A;  4JB7 A;  4LZ7 A;  1B05 A;  2DYX A;  2GRV A;  2H99 A;  2FA7 A;  3R6U A;  1D9V A;  1POY 1;  5FHM A;  4POX A;  4ZEB A;  3GLB A;  4LQ5 A;  1WVJ A;  4NF8 A;  5I2K A;  1SW1 A;  3T66 A;  1XVX A;  3LSF B;  2G93 A;  1P99 A;  2OZZ A;  1BIY A;  1IEJ A;  4ND9 A;  1JET A;  5I56 B;  3H06 B;  2REG A;  1QJM A;  5DVI A;  5ICQ A;  5DEX A;  5KZT A;  4EUO A;  1B7Z A;  3W9W A;  3N26 A;  4F3P A;  3CSG A;  3O66 A;  2VHA A;  4LON B;  4XXU A;  4XIG Q;  4FED A;  3T9U A;  3TCG A;  2HAU A;  2ZYN A;  1DPP A;  3SEX A;  3EHT A;  3QSL A;  5CMB A;  2D3I A;  1YAE A;  4ZDM A;  1DOT A;  3OD7 A;  1B0L A;  1GR2 A;  1VFE A;  3THI A;  2DXR A;  1FW0 A;  3MZB A;  4F3B A;  5TP9 B;  2R9J A;  5FHN A;  2V3Q A;  5CMC A;  1HSJ A;  1MQJ A;  3CVG A;  4EQ9 A;  1MXZ A;  2X26 A;  1ATG A;  4H67 A;  1A8F A;  5A5X A;  3IX1 A;  4R9G A;  4XKR A;  3HCQ A;  1FTM A;  4O3B A;  2DE4 A;  3M3F A;  3CFZ A;  4ELR A;  1Y20 A;  3C4M A;  4R75 A;  2RC9 A;  1QKB A;  1MXU A;  2D21 A;  1IXI A;  1ANF A;  3G3J A;  3VV5 A;  1MPD A;  3TFL A;  2ZYM A;  5H8S A;  3T9X B;  5ELV A;  3IB1 A;  1UIU A;  1IXG A;  1ZMG A;  3UP9 A;  3PPN A;  3OXN A;  3JYR A;  3VFJ A;  1S50 A;  4QFP A;  3HO7 A;  2F34 A;  5I57 A;  2R6G E;  2IA4 A;  2ZNS A;  2GHA A;  4WED A;  3PUX E;  3RT6 B;  3C34 A;  2DVC A;  3FVK A;  4PET A;  1FTL A;  3CI8 A;  3TTL A;  4OZ9 A;  5CC2 A;  1TXF A;  3VXC A;  4AB5 A;  4ESX A;  2Y7P A;  2Q2A A;  1MY2 A;  1N3W A;  3K6W A;  2HAV A;  3S4U A;  4N6P A;  1A55 A;  3RTF B;  3DP6 A;  3UGW A;  1QUI A;  1A40 A;  4U4X A;  3ZKK A;  3C32 A;  3VXB A;  4ZEC A;  2XXT A;  1MQD A;  3G3I A;  2Y7W A;  3VE1 B;  1DTZ A;  3TQL A;  3TCH A;  4OFO A;  4YB7 A;  3BFU A;  1AMF A;  3IB2 A;  3DM0 A;  3TDJ A;  3FXU A;  3IOW A;  1USY E;  1URG A;  3MVW A;  3QXM A;  4IO2 A;  4KPT A;  2XX9 A;  3BFT A;  3SEW A;  3B6Q A;  4R6K A;  4KYD A;  1LFG A;  3W15 C;  4JWY A;  2UVG A;  1VE4 A;  4WEP A;  4EQ7 A;  1EZO A;  5HPQ A;  1IIW A;  2I6E A;  4H5G A;  4DIG A;  1BP5 A;  2NVU B;  2XX7 A;  3PMX A;  3O6G A;  1SQY A;  2AL4 A;  1I69 A;  3FXQ A;  3I5O A;  3Q25 A;  4MH5 A;  1NMU A;  3TQW A;  3FIR A;  3K1M A;  3RT8 A;  2V3U A;  3V8X B;  4GLI A;  2V25 A;  2V3T A;  2O51 A;  3PMV A;  4G8H A;  2XXV A;  2DE3 A;  4I8C A;  2A5T B;  2D5W A;  2O84 X;  1SW5 A;  1P1Q A;  2F7B A;  3C31 A;  4LP2 B;  3Q27 A;  2RF1 A;  3N94 A;  4PFU A;  2WKY A;  1FCK A;  2QL3 A;  2I0B A;  3PUV E;  1JW5 A;  3JZJ A;  3RLF E;  5DVF A;  1IXC A;  2I4B A;  3O29 A;  1MPC A;  4F19 A;  2HZK A;  4NMY A;  4KD5 A;  3K6U A;  4NTL A;  3MP1 A;  1ZLQ A;  4GVO A;  5FTH A;  2B3B A;  4YKP A;  3SEY A;  1P1W A;  4QFN A;  1TFD A;  4QSE A;  1SD3 A;  2ZNT A;  4FAJ A;  3I6V A;  2OWT A;  4IO6 A;  2B65 A;  3G7W A;  1DPE A;  4NWC A;  5I56 A;  2VD2 A;  1N84 A;  3G3G A;  3IOU A;  3OEK A;  1B5I A;  4ECF A;  1UIV A;  3PUY E;  2DE2 A;  5JK4 A;  2DS9 A;  1VSO A;  5AA2 D;  2Y7K A;  3QIM A;  4RA1 A;  3UN6 A;  4BDN A;  1D9Y A;  2O1M A;  4YMB A;  2AIX A;  1B1H A;  1N76 A;  2OJT A;  1M5F A;  1UTH B;  2Z22 A;  4ZZE A;  4DXB A;  1Y4C A;  3M8U A;  2O1L A;  1B58 A;  4OFL A;  1B51 A;  2DVZ A;  1B5H A;  3K1N A;  4I1D A;  1USY H;  4XKQ A;  1B3H A;  3A09 A;  3BKI B;  1O63 A;  5TP9 A;  2O7U A;  4ISU A;  5I59 B;  3HST A;  3KN7 A;  1LAX A;  4IO3 A;  4EXK A;  4FJP A;  5HM4 B;  2ZYK A;  3ZSF A;  2OLB A;  1ZIU A;  1SI0 A;  3UA8 A;  4C1T A;  3PMW A;  1M5D A;  2UVJ A;  1UTB B;  1LFH A;  2R71 A;  5I58 B;  1SW2 A;  1Y3N A;  5HBC A;  4DZ1 A;  4QSC A;  1NH8 A;  1FQA A;  1LLS A;  2PYY A;  2XHD A;  5B70 A;  5J1D A;  3KBR A;  1LCF A;  4LA9 A;  3VVE A;  1RYX A;  1B46 A;  3FD3 A;  3G3H A;  1F9B A;  5F1Q A;  2Z8D A;  1JEU A;  1NNP A;  4DCX A;  4BDR A;  3IOR A;  5KDT B;  2E1S A;  4JSO A;  1Q35 A;  1QW0 A;  4BDO A;  3GBA A;  3TYH A;  1B7U A;  1FQB A;  1A54 A;  4NF5 B;  3HHF A;  3ILT B;  4FIM A;  1OLA A;  3MVZ A;  1S7Y A;  2P0S A;  1PB7 A;  4ZEI A;  2KLF A;  4ZEK A;  3IO6 A;  1NNK A;  3KN3 A;  2Y7I A;  1MXV A;  3CFL A;  3H6V A;  3TTR A;  3ODB A;  4H8I A;  3A3C A;  3VLW A;  3TTN A;  2XXP A;  2I49 A;  1OQH A;  5L8D A;  2ZNU A;  3C35 A;  3VVF A;  3IOV A;  1EZ9 A;  4KQP A;  3CG3 A;  3TEP A;  5I2N B;  4F22 A;  4I9D A;  2IEE A;  3H6U A;  5AE4 A;  2RCA A;  3RGY A;  1TT1 A;  1XT8 A;  1VR5 A;  3K02 A;  4R74 A;  1PB8 A;  4NE4 A;  1GTK A;  2F6G A;  2CZL A;  3VLV A;  1A8E A;  3E3K A;  4Q30 B;  2QSX A;  4RNS A;  1HSL A;  1JW1 A;  4PFY A;  3EQ1 A;  3SDF A;  1NH7 A;  1MM6 A;  3MZ1 A;  4G77 A;  2VP1 A;  1JQF A;  1US5 A;  2I48 A;  4FAT A;  4IGT A;  4U22 A;  3TZA A;  3R7X A;  2F35 A;  4QFK A;  2DWJ A;  1MPB A;  1B40 A;  3C36 A;  4LQ2 A;  2H9B A;  4MFI A;  1QKA A;  4RYA A;  4HS7 A;  1AH5 A;  5CRY A;  2Q89 A;  3MW0 A;  3V83 A;  3MZ9 A;  4YKK A;  3MVX A;  3UOR A;  2H5Y A;  2GFE A;  4TOZ A;  2A5T A;  4QHQ A;  2QMW A;  5AA3 A;  1KWH A;  3K2D A;  1FQC A;  1AOV A;  2QS3 A;  1BKA A;  3O9P A;  5BUU A;  2HEU A;  4H5F A;  1II5 A;  2ONR A;  4OHN A;  2O68 A;  3FV1 A;  1B0H A;  5TPA B;  1GGG A;  3USD A;  4MLQ A;  3L6H A;  1DSN A;  4C0R A;  1AL3 A;  3MP8 A;  3IR1 A;  3O2A A;  5DYH A;  2B3F A;  2UVH A;  3U72 A;  5AA2 B;  5JTY B;  3KJT A;  4OER A;  3OSQ A;  1B4Z A;  3D4G A;  4F3S A;  2XX8 A;  4X1D A;  3LR1 A;  4YAH X;  2I4C A;  1FQE A;  4PP0 A;  3DP8 A;  3E4R A;  4OMB A;  3WAF A;  3O6I A;  2ZYO A;  1B6H A;  2PMS A;  1RYO A;  3SEU A;  3N6U A;  2Y84 A;  3IOT A;  3FJ7 A;  1MQI A;  3KGC A;  2XXH A;  5ITP A;  4ZZA A;  2ALU A;  4Q5T A;  4LUB A;  4H65 A;  2NWJ A;  1UTH A;  5AA1 A;  2F7C A;  3B6W A;  3LC8 A;  3SKP A;  4BDL A;  4Q8R A;  4RPN A;  1B2H A;  4QRZ A;  4H8J A;  3C33 A;  5TU0 A;  3CG1 A;  4EDP A;  1XC1 A;  3KJ7 A;  4X1B A;  1SI1 A;  4RXL A;  4ZE9 A;  3MJN A;  2A5S A;  3EN3 A;  3OO7 A;  1R6Z A;  4H0W A;  2I58 A;  4OQO A;  5I59 A;  2DQV A;  1CB6 A;  3LSL A;  3TMG A;  3MVY A;  1IXH A;  1SW4 A;  3FJM A;  3H3G A;  5IKB A;  2RKM A;  1UTB A;  1H76 A;  3RNN A;  5L9M A;  4H6D A;  3WAE A;  1LAH E;  3FXR A;  5I58 A;  3R26 A;  2RC7 A;  5L9S A;  1Q1K A;  4X48 A;  4G8N A;  4BDQ A;  4U1Z A;  1BLF A;  2FNC A;  4P0G A;  1URD A;  3S2V A;  1EU8 A;  1PEB A;  1FTJ A;  2XD2 A;  4NF6 B;  1MRP A;  4RJZ A;  1FQF A;  5ICT A;  3OMB A;  2DP8 A;  3E9X A;  5CMM A;  1UQW A;  2OCU A;  3HN0 A;  3K00 A;  4F3G A;  1RKM A;  2GH9 A;  5KDT A;  1R9Q A;  2F7A A;  4FEB A;  4KYS A;  4JXI A;  4PFW A;  4NF5 A;  4G2Z A;  1LFI A;  3V89 B;  1DTG A;  3PUZ E;  3RY3 A;  1TFA A;  1MXX A;  1JVX A;  3HHG A;  2QPQ A;  1YPN A;  4ELP A;  1YCJ A;  1B3L A;  3KN8 A;  3D4C A;  4DE8 A;  3RTW B;  2XXW A;  1S9T A;  1NNT A;  1NNF A;  2OK2 A;  5EYF A;  3TPA A;  1MY3 A;  5H8H B;  3PPP A;  5H8N B;  3LUY A;  2VOZ A;  2VD3 A;  4GL0 A;  4M4G A;  3DEL B;  1XVY A;  1GV8 A;  5ISU A;  4GRK A;  1A99 A;  3OEM A;  5I2N A;  2OBG A;  3VDF A;  1MXY A;  1YTV A;  4HCY A;  2P1S A;  4JSD A;  3VLU A;  2X7Q A;  1ZU0 A;  3IAZ A;  4GF8 A;  3M3K A;  1I6A A;  2Q8J A;  2W7Y A;  3K0V A;  2X7P A;  2XXI A;  3OEL A;  4E0W A;  4LVQ A;  1JW4 A;  1MM7 A;  3QAX A;  5EHM A;  3CR9 A;  4IB2 A;  3QUJ A;  3OO9 A;  2PVU A;  1OQG A;  1ZBM A;  1Y1M A;  3TTM A;  4F1U A;  4FOR A;  3T9H B;  3V5A A;  4JBZ A;  4O3C A;  1B32 A;  2F78 A;  4AB6 A;  3G3K A;  2F97 A;  3MPK A;  1IQ7 A;  4DLD A;  1H43 A;  4WKM A;  4F1Y A;  4DDD A;  3UIF A;  2NXO A;  3PV0 E;  5H8F B;  4NF4 B;  4TLM B;  5FTI A;  3MAM A;  3IB0 A;  1GVC A;  2RCB A;  3H6W A;  1I6Q A;  1B3G A;  3AXF A;  4GD5 A;  3U94 A;  2M8C A;  3W9V A;  2HCA A;  1A7L A;  5TPA A;  3TEL A;  3FZV A;  5I84 A;  4IO4 A;  4ZEF A;  4G68 C;  1MY0 A;  3ECR A;  4YB5 A;  3C9H A;  4X9T A;  4IO5 A;  1H44 A;  4HW8 A;  5CBR A;  2AYS A;  1Z7M E;  1M5E A;  1MY1 A;  4IY5 A;  5AA2 A;  5JTY A;  1TWY A;  3S9N C;  2I3W A;  3MC2 A;  1MY4 A;  3LSX A;  1IIT A;  3KG2 A;  3P7I A;  3KZG A;  1PBP A;  5K2X A;  1QUL A;  2HXW A;  1MDP 1;  1ZJL A;  4LAT A;  3GBB A;  4OEU A;  4EQB A;  4RK2 A;  3U8Q A;  1ZTY A;  3OEN A;  2I0C A;  4R2B A;  2Z8F A;  3FGS A;  4F31 B;  4IY6 A;  3Q26 A;  1XHY A;  3ZS6 A;  3K4U A;  4R6H A;  3KOS A;  3OSR A;  1B4H A;  1NL5 A;  3I3V A;  3KEI A;  4MBP A;  2O7I A;  1WOD A;  5H8Q B;  1PB9 A;  4LZ8 A;  5K2Y A;  1NFT A;  3FAS A;  3PD8 A;  1SYH A;  2XXY A;  1N0T A;  5F7V A;  4POW A;  4OTE A;  1JEV A;  4KI0 E;  4U23 A;  2O69 A;  3IL1 B;  1US4 A;  3RN8 A;  4QF9 A;  3FJG A;  4ELQ A;  3VVD A;  1SBP A;  4GXS B;  1LB9 A;  4GFR A;  4LZ5 A;  3N5L A;  1B1X A;  1Y3P A;  1IZ1 A;  3U93 A;  4KCD A;  3T9V A;  3S9E A;  1QUK A;  1N7W A;  3H6T A;  1LST A;  3RPW A;  4P0I A;  1O7T A;  1ZKB A;  4E0X A;  4R9F A;  4AQ4 A;  1R1N A;  4NF6 A;  4YKJ A;  5KCJ B;  4BLA A;  4L17 A;  1BTJ A;  4RY1 A;  4QFO A;  1B7H A;  4IGR A;  3KFM A;  5DT6 A;  2UVI A;  4TQU Q;  3MUQ A;  3M3L A;  2O6A A;  3CIJ A;  2H4I A;  4F1V A;  3MWB A;  3FUZ A;  1MXW A;  3PU5 A;  3T93 B;  1O64 A;  3L6G A;  2UYF A;  1AIV A;  3Q29 A;  3FV2 A;  1Y9U A;  4PQJ A;  1H45 A;  3SES A;  1Y3Q A;  4NWD A;  3MQ9 A;  1LBC A;  4OEN A;  4YU0 A;  3RQT A;  2P2A A;  3IK6 B;  4M1V A;  2Q2C A;  2Q88 A;  1LAG E;  3E13 X;  3FAT A;  3QUF A;  2QJE A;  5H8H A;  3MBP A;  5H8N A;  3H03 A;  4ZE8 A;  3LBS A;  1P1N A;  1OIB A;  1HSE A;  1FTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...