2ENHA

Solution structure of the c2h2 type zinc finger (region 556-588) of human zinc finger protein 28 homolog
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECDVCRKAFSHHASLTQHQRVHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 556-588) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2enhA01
2EMWA 2EPAA 3M99B 2EOIA 1X6EA 2EN7A 2DLQA 2YTDA 2EPPA 2EPCA 4R2QA 2YTFA 2JP9A 2EMAA 2EOJA 2ENHA 5KL2A 2EL6A 2EM6A 2YTPA 2WBUA 2RSIA 2GLIA 2NABA 1ZR9A 2EMCA 2DLKA 3MHHC 2YTGA 2YTEA 1ZU1A 1X6FA 2YTOA 2ENAA 2RPCA 2EPRA 2HGHA 2PRTA 5KL6A 1Z1BA 2ELYA 2ELZA 2MKDA 2EPXA 3EPJA 1KJKA 1UBDC 3UK3C 1A1JA 3EPLA 1F2IG 2EMBA 2EQ1A 2EOMA 2EM9A 4FK5C 2LVHA 4R2AA 2YRKA 2YSPA 2EN8A 1X3CA 1G2DC 1YUJA 2EOHA 4IJDA 2A25A 2EM0A 2CTDA 1JK1A 2EM4A 2EN3A 2EMHA 2LCEA 2EP3A 5KL5A 2YTQA 1A1IA 1BB8A 2GHFA 2VRDA 2EL4A 3EPKA 2ENCA 2EM7A 2EM2A 5KL7A 2EMGA 2CT1A 2EL5A 2YU8A 1RMDA 1JK2A 2EOXA 1TF6A 2YTJA 1DGCA 2YTIA 2YRMA 4R2CA 2EM5A 2YTNA 2EN2A 2M9AA 5KL3A 1P47A 1WJPA 4IS1C 2EN1A 2DRPA 2YU5A 4R2DA 3EPHA 2CSHA 1B69A 1NCSA 2WBTA 1LLMC 4F6NA 4R2RA 2EMZA 2E72A 2EOOA 2EPUA 4M9VC 2EE8A 2EOYA 4F2JC 2EM8A 2I13A 2R1FA 1TN9A 1A1LA 2EORA 2MKNA 1X6HA 2EQ0A 1TF3A 4R2SA 2EOSA 2EMIA 2JPAA 1A1GA 4R2PA 1X5WA 1A1KA 1A1HA 2EJ4A 1BBOA 2EMFA 2EOQA 2EM3A 2EPZA 1G2FC 1YUIA 1UN6B 2LT7A 2EMYA 1YSAC 2WBSA 1A1FA 2BB8A 1ZAAC 2YSOA 4GZNC 2J7JA 2LV2A 2EOFA 4X9JA 4F6MA 1AAYA 2EOEA 2WCC3 2EN6A 4R2EA 2EN4A 4WSGA 2DMIA 2EMXA 2EMLA 3MHSC 2D9HA 2ADRA 2EOZA 3VHTB 2EQ3A 2LO3A 2MDGA 5KL4A 1MEYC 2DGCA 2YRHA 2EMKA
chains in the Genus database with same CATH superfamily
4ZYDA 2UXBE 2EOIA 2YTDA 4B3SE 2DSYA 1EKZA 1WHQA 4BS9A 2UUCE 4DV3E 2EL6A 4JI0E 3OTOE 4MLQA 1N32E 2EMCA 2DLKA 5TSEA 4JI4E 2YTEA 4DKKA 4F54A 1HNWE 2Q8UA 2EPRA 4WYQB 5KL6A 4DR3E 5LMUE 3DJWA 5AE1A 4OX9E 2NA2A 1F2IG 4ZYEA 2EQ1A 4JI1E 1AH5A 1O0WA 1SR9A 1YPNA 4FK5C 5AE3A 4R2AA 2YRKA 4JI2E 1G2DC 4HTGA 4X65E 2A25A 2EM0A 3F6HA 4X8WA 4BHCA 2EMHA 5LL6R 2LJHA 4JI6E 5A6AA 3J81C 4M2ZA 3OMLA 1KYQA 2L2NA 2EL5A 2CT1A 2EOXA 2LTRA 4WX9A 3LMLA 2FGGA 2EN2A 5KL3A 4LF8E 2JWOA 4BBYA 3HQ1A 2DRPA 2LRSA 3JTZA 4WXCA 1T4LB 1T38A 4JI7E 3THNA 4KWYA 2V88A 2L2KB 2V87A 3ADIA 2I13A 3THOB 2CPNA 1X49A 2MKNA 3KZYA 4DR2E 2JXPA 1PKPA 1RC7A 3T1YE 1A1GA 4R2PA 1A1KA 2LJUA 1T39A 1J5EE 1G2FC 2EMYA 2M1SA 3C6MA 2K7IA 2HJJA 4DMIA 2YSOA 5CFFE 1EH7A 4M0VA 4NXNE 4NZVA 2LV2A 4X9JA 4F6MA 2WCC3 3HXLA 2EN6A 4R2EA 2JYAA 1FJGE 3VK6A 3MSWA 2DMIA 5AE2A 4GKJE 1PDAA 2EMKA 2FTXB 1T4OA 2EPAA 2DLQA 3IWBA 5KL2A 1SFEA 4HEIA 2B7TA 3C4TA 2NABA 2LBSB 4ZYHA 1PJQA 5BR8E 2ZM6E 1ZU1A 2YTOA 4F9CB 4LFAE 2ENAA 3HPZA 3ECRA 1PJTA 2HGHA 3H09A 2ELZA 2MKDA 4LF9E 1KJKA 1DQ3A 3EPLA 5DNYA 3BBGA 2EMBA 2EOMA 2EPMX 3BIDA 2YSPA 1GQEA 1X3CA 4X64E 4KHPE 4BHBA 1YUJA 2ODRD 1NEIA 1BBGA 2MDRA 4JI3E 2EP3A 5A69A 2JVAA 2HC5A 3EPKA 2ENCA 3J7AG 2EM2A 3ADGA 4L8NA 2UUBE 2YU8A 2V85A 1IBME 1MGTA 2UXCE 2NUGA 2YTJA 1YFHA 2YRMA 2GPIA 2YTNA 4BMJA 2YWQA 2L2MA 2N8XA 5A6BD 4DUZE 2L92A 1XMQE 4R2DA 4JV5E 3EPHA 4F9AB 2B9DA 3EQ1A 1LLMC 1YZ9A 4F6NA 4WFTA 2LMZA 2E72A 5A2QC 2N3HA 4RH8A 2R76A 1N3GA 2VE7C 4DV2E 4P7DA 2EQ0A 4F9BB 4NHRA 2NUFA 1BBOA 4LTYA 2EJ4A 1X47A 2EOQA 5LMNE 1FKAE 1YYWA 3HPSA 3ZOQB 1ZAAC 5A6KA 2F4VE 4GZNC 2J7JA 3P1XA 3L00A 1WHNA 3FIGA 2LTSA 5LLQA 1ZBTA 3MHSC 4O5GA 2BBGA 2D9HA 3KZZA 2MDGA 2DGCA 4MLVA 2JY9A 2YT4A 4IS1C 4WXDA 4DV6E 1XNRE 3M99B 2EN7A 3AUZA 3RMPA 2EPCA 2KONA 2YTFA 4R2QA 2JP9A 2EMAA 2EOJA 2ENHA 2L3JA 2EM6A 2WBUA 2RSIA 1PJSA 1ZR9A 2L8TA 2MC5A 3MHHC 2IHR1 4J8ZA 5IXMB 4N4RB 2EPNA 2DB2A 2RPCA 2UU9E 2PRTA 3EPJA 1X48A 2V8QB 2VQEE 1A1JA 1QNTA 2LUQA 2F8BA 2HHHE 1HNXE 4KZSA 1IMUA 4LF5E 2EN8A 2DMYA 1IBKE 4IJDA 4ZYGA 5ADZA 4JI8E 2CTDA 1N36E 1JK1A 2EM4A 2EN3A 5T6JA 3DF6A 4WSPA 5A6JA 2LCEA 3T1HE 4O43A 2YTQA 4Q35B 3K6QA 1A1IA 4B3TE 2EL4A 2EM7A 4JI5E 1JK2A 4JYAE 1DGCA 4DV7E 4DV0E 2V83A 2YTIA 4DV5E 4R2CA 3J7Yp 2M9AA 2EPKX 1P47A 1IQOA 4LF6E 2EN1A 1N33E 3VYXA 3AV0A 1XMOE 2JR1A 1T4NA 1B69A 5IV8B 1NCSA 4RHBB 5A6BA 2N3GA 1YYOA 4M9VC 2EE8A 2M7QA 2EOYA 5F3WA 2EM8A 2R1FA 1A1LA 5FLXC 2LUPB 2V86A 1X6HA 4B3ME 4M30A 1TF3A 2YZTA 2I9IA 4R2SA 1XNQE 2EMIA 1HNZE 4K0KE 4LFBE 1IQSA 2RS7A 1YUIA 1UN6B 2LT7A 2KHXA 1A1FA 2B7VA 2KOUA 5AC5A 2EWLA 4DUYE 2EZ6A 1WRJA 4GKKE 4TUIA 4DR5E 2EOFA 2EOEA 3F6GA 3VHTB 2EN4A 4BC7A 2EMXA 2EMLA 2ADRA 2EOZA 5KL4A 4LFCE 1MEYC 4WPYA 2L3CA 3VYYA 2EMWA 4BC9A 4O4KA 1X6EA 3JU0A 1RQ0A 2EPPA 2M4IA 4P78A 2YTPA 1N34E 1HR0E 2GLIA 3C4BA 4DR4E 2V89A 2WZOA 2YTGA 1EH8A 1IBLE 2LE2A 1X6FA 2H36X 4DV4E 1I94E 4LF7E 1L4SA 2UUAE 3J80C 2YPNA 4LF4E 1Z1BA 2ELYA 2RS6A 1QU6A 2B3TB 2EPXA 1UBDC 4YY3E 3UK3C 2E5LE 2EM9A 2MC6A 4BCAA 1GZ6A 2G7HA 3BGHA 2LVHA 2NUEA 3ADLA 2EOHA 4LU9A 3TQMA 5KL5A 4I8OA 1BB8A 3ADJA 3C6KA 2EPLX 2RTXA 1GTKA 2GHFA 2VRDA 4YHHE 5KL7A 2EMGA 1RMDA 4X66E 1TF6A 2DIXA 4R03A 4B3RE 3LLHA 1DI2A 1UILA 2EM5A 5IT9C 3HTXA 1J26A 1WJPA 1ZBQA 2ODRC 2E1MA 2YU5A 3IWDA 5AASA 1UHZA 2RSMA 2CSHA 3QG5C 4TUGA 2WBTA 2EPOA 4DR6E 4R2RA 1STUA 2EMZA 2JOXA 2EOOA 2EPUA 5AC4A 4DV1E 4O24A 4F2JC 1TN9A 4DR7E 3BF2A 2EORA 1WXRA 3IWCA 4R8OA 2L6MA 4DR1E 4NXME 4X62E 2FV4B 2EOSA 2JPAA 1X5WA 1A1HA 2EMFA 2UXDE 2EM3A 2EPZA 4GEQB 1YYKA 2L33A 4OOGC 1YSAC 2WBSA 4L5NC 2BB8A 3KWRA 4AQYE 5IWAE 1AAYA 2RQLA 2VQFE 2VF1A 4WSGA 2JOBA 2EQ3A 2K4VA 2LO3A 4Q28A 3JAMC 2YRHA 1EH6A
chains in the Genus database with same CATH topology
2EMWA 2EPAA 3M99B 2EOIA 1X6EA 2EN7A 2DLQA 2YTDA 2EPPA 2EPCA 4R2QA 2YTFA 2JP9A 2EMAA 2EOJA 2ENHA 5KL2A 2EL6A 2EM6A 2YTPA 2WBUA 2RSIA 2GLIA 2NABA 1ZR9A 2EMCA 2DLKA 3MHHC 2YTGA 2YTEA 1ZU1A 1X6FA 2YTOA 2ENAA 2RPCA 2EPRA 2HGHA 2PRTA 5KL6A 1Z1BA 2ELYA 2ELZA 2MKDA 2EPXA 3EPJA 1KJKA 1UBDC 3UK3C 1A1JA 3EPLA 1F2IG 2EMBA 2EQ1A 2EOMA 2EM9A 4FK5C 2LVHA 4R2AA 2YRKA 2YSPA 2EN8A 1X3CA 1G2DC 1YUJA 2EOHA 4IJDA 2A25A 2EM0A 2CTDA 1JK1A 2EM4A 2EN3A 2EMHA 2LCEA 2EP3A 5KL5A 2YTQA 1A1IA 1BB8A 2GHFA 2VRDA 2EL4A 3EPKA 2ENCA 2EM7A 2EM2A 5KL7A 2EMGA 2CT1A 2EL5A 2YU8A 1RMDA 1JK2A 2EOXA 1TF6A 2YTJA 1DGCA 2YTIA 2YRMA 4R2CA 2EM5A 2YTNA 2EN2A 2M9AA 5KL3A 1P47A 1WJPA 4IS1C 2EN1A 2DRPA 2YU5A 4R2DA 3EPHA 2CSHA 1B69A 1NCSA 2WBTA 1LLMC 4F6NA 4R2RA 2EMZA 2E72A 2EOOA 2EPUA 4M9VC 2EE8A 2EOYA 4F2JC 2EM8A 2I13A 2R1FA 1TN9A 1A1LA 2EORA 2MKNA 1X6HA 2EQ0A 1TF3A 4R2SA 2EOSA 2EMIA 2JPAA 1A1GA 4R2PA 1X5WA 1A1KA 1A1HA 2EJ4A 1BBOA 2EMFA 2EOQA 2EM3A 2EPZA 1G2FC 1YUIA 1UN6B 2LT7A 2EMYA 1YSAC 2WBSA 1A1FA 2BB8A 1ZAAC 2YSOA 4GZNC 2J7JA 2LV2A 2EOFA 4X9JA 4F6MA 1AAYA 2EOEA 2WCC3 2EN6A 4R2EA 2EN4A 4WSGA 2DMIA 2EMXA 2EMLA 3MHSC 2D9HA 2ADRA 2EOZA 3VHTB 2EQ3A 2LO3A 2MDGA 5KL4A 1MEYC 2DGCA 2YRHA 2EMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMW A;  2EPA A;  3M99 B;  2EOI A;  1X6E A;  2EN7 A;  2DLQ A;  2YTD A;  2EPP A;  2EPC A;  4R2Q A;  2YTF A;  2JP9 A;  2EMA A;  2EOJ A;  2ENH A;  5KL2 A;  2EL6 A;  2EM6 A;  2YTP A;  2WBU A;  2RSI A;  2GLI A;  2NAB A;  1ZR9 A;  2EMC A;  2DLK A;  3MHH C;  2YTG A;  2YTE A;  1ZU1 A;  1X6F A;  2YTO A;  2ENA A;  2RPC A;  2EPR A;  2HGH A;  2PRT A;  5KL6 A;  1Z1B A;  2ELY A;  2ELZ A;  2MKD A;  2EPX A;  3EPJ A;  1KJK A;  1UBD C;  3UK3 C;  1A1J A;  3EPL A;  1F2I G;  2EMB A;  2EQ1 A;  2EOM A;  2EM9 A;  4FK5 C;  2LVH A;  4R2A A;  2YRK A;  2YSP A;  2EN8 A;  1X3C A;  1G2D C;  1YUJ A;  2EOH A;  4IJD A;  2A25 A;  2EM0 A;  2CTD A;  1JK1 A;  2EM4 A;  2EN3 A;  2EMH A;  2LCE A;  2EP3 A;  5KL5 A;  2YTQ A;  1A1I A;  1BB8 A;  2GHF A;  2VRD A;  2EL4 A;  3EPK A;  2ENC A;  2EM7 A;  2EM2 A;  5KL7 A;  2EMG A;  2CT1 A;  2EL5 A;  2YU8 A;  1RMD A;  1JK2 A;  2EOX A;  1TF6 A;  2YTJ A;  1DGC A;  2YTI A;  2YRM A;  4R2C A;  2EM5 A;  2YTN A;  2EN2 A;  2M9A A;  5KL3 A;  1P47 A;  1WJP A;  4IS1 C;  2EN1 A;  2DRP A;  2YU5 A;  4R2D A;  3EPH A;  2CSH A;  1B69 A;  1NCS A;  2WBT A;  1LLM C;  4F6N A;  4R2R A;  2EMZ A;  2E72 A;  2EOO A;  2EPU A;  4M9V C;  2EE8 A;  2EOY A;  4F2J C;  2EM8 A;  2I13 A;  2R1F A;  1TN9 A;  1A1L A;  2EOR A;  2MKN A;  1X6H A;  2EQ0 A;  1TF3 A;  4R2S A;  2EOS A;  2EMI A;  2JPA A;  1A1G A;  4R2P A;  1X5W A;  1A1K A;  1A1H A;  2EJ4 A;  1BBO A;  2EMF A;  2EOQ A;  2EM3 A;  2EPZ A;  1G2F C;  1YUI A;  1UN6 B;  2LT7 A;  2EMY A;  1YSA C;  2WBS A;  1A1F A;  2BB8 A;  1ZAA C;  2YSO A;  4GZN C;  2J7J A;  2LV2 A;  2EOF A;  4X9J A;  4F6M A;  1AAY A;  2EOE A;  2WCC 3;  2EN6 A;  4R2E A;  2EN4 A;  4WSG A;  2DMI A;  2EMX A;  2EML A;  3MHS C;  2D9H A;  2ADR A;  2EOZ A;  3VHT B;  2EQ3 A;  2LO3 A;  2MDG A;  5KL4 A;  1MEY C;  2DGC A;  2YRH A;  2EMK A; 
#chains in the Genus database with same CATH topology
 4ZYD A;  2UXB E;  2EOI A;  2YTD A;  4B3S E;  2DSY A;  1EKZ A;  1WHQ A;  4BS9 A;  2UUC E;  4DV3 E;  2EL6 A;  4JI0 E;  3OTO E;  4MLQ A;  1N32 E;  2EMC A;  2DLK A;  5TSE A;  4JI4 E;  2YTE A;  4DKK A;  4F54 A;  1HNW E;  2Q8U A;  2EPR A;  4WYQ B;  5KL6 A;  4DR3 E;  5LMU E;  3DJW A;  5AE1 A;  4OX9 E;  2NA2 A;  1F2I G;  4ZYE A;  2EQ1 A;  4JI1 E;  1AH5 A;  1O0W A;  1SR9 A;  1YPN A;  4FK5 C;  5AE3 A;  4R2A A;  2YRK A;  4JI2 E;  1G2D C;  4HTG A;  4X65 E;  2A25 A;  2EM0 A;  3F6H A;  4X8W A;  4BHC A;  2EMH A;  5LL6 R;  2LJH A;  4JI6 E;  5A6A A;  3J81 C;  4M2Z A;  3OML A;  1KYQ A;  2L2N A;  2EL5 A;  2CT1 A;  2EOX A;  2LTR A;  4WX9 A;  3LML A;  2FGG A;  2EN2 A;  5KL3 A;  4LF8 E;  2JWO A;  4BBY A;  3HQ1 A;  2DRP A;  2LRS A;  3JTZ A;  4WXC A;  1T4L B;  1T38 A;  4JI7 E;  3THN A;  4KWY A;  2V88 A;  2L2K B;  2V87 A;  3ADI A;  2I13 A;  3THO B;  2CPN A;  1X49 A;  2MKN A;  3KZY A;  4DR2 E;  2JXP A;  1PKP A;  1RC7 A;  3T1Y E;  1A1G A;  4R2P A;  1A1K A;  2LJU A;  1T39 A;  1J5E E;  1G2F C;  2EMY A;  2M1S A;  3C6M A;  2K7I A;  2HJJ A;  4DMI A;  2YSO A;  5CFF E;  1EH7 A;  4M0V A;  4NXN E;  4NZV A;  2LV2 A;  4X9J A;  4F6M A;  2WCC 3;  3HXL A;  2EN6 A;  4R2E A;  2JYA A;  1FJG E;  3VK6 A;  3MSW A;  2DMI A;  5AE2 A;  4GKJ E;  1PDA A;  2EMK A;  2FTX B;  1T4O A;  2EPA A;  2DLQ A;  3IWB A;  5KL2 A;  1SFE A;  4HEI A;  2B7T A;  3C4T A;  2NAB A;  2LBS B;  4ZYH A;  1PJQ A;  5BR8 E;  2ZM6 E;  1ZU1 A;  2YTO A;  4F9C B;  4LFA E;  2ENA A;  3HPZ A;  3ECR A;  1PJT A;  2HGH A;  3H09 A;  2ELZ A;  2MKD A;  4LF9 E;  1KJK A;  1DQ3 A;  3EPL A;  5DNY A;  3BBG A;  2EMB A;  2EOM A;  2EPM X;  3BID A;  2YSP A;  1GQE A;  1X3C A;  4X64 E;  4KHP E;  4BHB A;  1YUJ A;  2ODR D;  1NEI A;  1BBG A;  2MDR A;  4JI3 E;  2EP3 A;  5A69 A;  2JVA A;  2HC5 A;  3EPK A;  2ENC A;  3J7A G;  2EM2 A;  3ADG A;  4L8N A;  2UUB E;  2YU8 A;  2V85 A;  1IBM E;  1MGT A;  2UXC E;  2NUG A;  2YTJ A;  1YFH A;  2YRM A;  2GPI A;  2YTN A;  4BMJ A;  2YWQ A;  2L2M A;  2N8X A;  5A6B D;  4DUZ E;  2L92 A;  1XMQ E;  4R2D A;  4JV5 E;  3EPH A;  4F9A B;  2B9D A;  3EQ1 A;  1LLM C;  1YZ9 A;  4F6N A;  4WFT A;  2LMZ A;  2E72 A;  5A2Q C;  2N3H A;  4RH8 A;  2R76 A;  1N3G A;  2VE7 C;  4DV2 E;  4P7D A;  2EQ0 A;  4F9B B;  4NHR A;  2NUF A;  1BBO A;  4LTY A;  2EJ4 A;  1X47 A;  2EOQ A;  5LMN E;  1FKA E;  1YYW A;  3HPS A;  3ZOQ B;  1ZAA C;  5A6K A;  2F4V E;  4GZN C;  2J7J A;  3P1X A;  3L00 A;  1WHN A;  3FIG A;  2LTS A;  5LLQ A;  1ZBT A;  3MHS C;  4O5G A;  2BBG A;  2D9H A;  3KZZ A;  2MDG A;  2DGC A;  4MLV A;  2JY9 A;  2YT4 A;  4IS1 C;  4WXD A;  4DV6 E;  1XNR E;  3M99 B;  2EN7 A;  3AUZ A;  3RMP A;  2EPC A;  2KON A;  2YTF A;  4R2Q A;  2JP9 A;  2EMA A;  2EOJ A;  2ENH A;  2L3J A;  2EM6 A;  2WBU A;  2RSI A;  1PJS A;  1ZR9 A;  2L8T A;  2MC5 A;  3MHH C;  2IHR 1;  4J8Z A;  5IXM B;  4N4R B;  2EPN A;  2DB2 A;  2RPC A;  2UU9 E;  2PRT A;  3EPJ A;  1X48 A;  2V8Q B;  2VQE E;  1A1J A;  1QNT A;  2LUQ A;  2F8B A;  2HHH E;  1HNX E;  4KZS A;  1IMU A;  4LF5 E;  2EN8 A;  2DMY A;  1IBK E;  4IJD A;  4ZYG A;  5ADZ A;  4JI8 E;  2CTD A;  1N36 E;  1JK1 A;  2EM4 A;  2EN3 A;  5T6J A;  3DF6 A;  4WSP A;  5A6J A;  2LCE A;  3T1H E;  4O43 A;  2YTQ A;  4Q35 B;  3K6Q A;  1A1I A;  4B3T E;  2EL4 A;  2EM7 A;  4JI5 E;  1JK2 A;  4JYA E;  1DGC A;  4DV7 E;  4DV0 E;  2V83 A;  2YTI A;  4DV5 E;  4R2C A;  3J7Y p;  2M9A A;  2EPK X;  1P47 A;  1IQO A;  4LF6 E;  2EN1 A;  1N33 E;  3VYX A;  3AV0 A;  1XMO E;  2JR1 A;  1T4N A;  1B69 A;  5IV8 B;  1NCS A;  4RHB B;  5A6B A;  2N3G A;  1YYO A;  4M9V C;  2EE8 A;  2M7Q A;  2EOY A;  5F3W A;  2EM8 A;  2R1F A;  1A1L A;  5FLX C;  2LUP B;  2V86 A;  1X6H A;  4B3M E;  4M30 A;  1TF3 A;  2YZT A;  2I9I A;  4R2S A;  1XNQ E;  2EMI A;  1HNZ E;  4K0K E;  4LFB E;  1IQS A;  2RS7 A;  1YUI A;  1UN6 B;  2LT7 A;  2KHX A;  1A1F A;  2B7V A;  2KOU A;  5AC5 A;  2EWL A;  4DUY E;  2EZ6 A;  1WRJ A;  4GKK E;  4TUI A;  4DR5 E;  2EOF A;  2EOE A;  3F6G A;  3VHT B;  2EN4 A;  4BC7 A;  2EMX A;  2EML A;  2ADR A;  2EOZ A;  5KL4 A;  4LFC E;  1MEY C;  4WPY A;  2L3C A;  3VYY A;  2EMW A;  4BC9 A;  4O4K A;  1X6E A;  3JU0 A;  1RQ0 A;  2EPP A;  2M4I A;  4P78 A;  2YTP A;  1N34 E;  1HR0 E;  2GLI A;  3C4B A;  4DR4 E;  2V89 A;  2WZO A;  2YTG A;  1EH8 A;  1IBL E;  2LE2 A;  1X6F A;  2H36 X;  4DV4 E;  1I94 E;  4LF7 E;  1L4S A;  2UUA E;  3J80 C;  2YPN A;  4LF4 E;  1Z1B A;  2ELY A;  2RS6 A;  1QU6 A;  2B3T B;  2EPX A;  1UBD C;  4YY3 E;  3UK3 C;  2E5L E;  2EM9 A;  2MC6 A;  4BCA A;  1GZ6 A;  2G7H A;  3BGH A;  2LVH A;  2NUE A;  3ADL A;  2EOH A;  4LU9 A;  3TQM A;  5KL5 A;  4I8O A;  1BB8 A;  3ADJ A;  3C6K A;  2EPL X;  2RTX A;  1GTK A;  2GHF A;  2VRD A;  4YHH E;  5KL7 A;  2EMG A;  1RMD A;  4X66 E;  1TF6 A;  2DIX A;  4R03 A;  4B3R E;  3LLH A;  1DI2 A;  1UIL A;  2EM5 A;  5IT9 C;  3HTX A;  1J26 A;  1WJP A;  1ZBQ A;  2ODR C;  2E1M A;  2YU5 A;  3IWD A;  5AAS A;  1UHZ A;  2RSM A;  2CSH A;  3QG5 C;  4TUG A;  2WBT A;  2EPO A;  4DR6 E;  4R2R A;  1STU A;  2EMZ A;  2JOX A;  2EOO A;  2EPU A;  5AC4 A;  4DV1 E;  4O24 A;  4F2J C;  1TN9 A;  4DR7 E;  3BF2 A;  2EOR A;  1WXR A;  3IWC A;  4R8O A;  2L6M A;  4DR1 E;  4NXM E;  4X62 E;  2FV4 B;  2EOS A;  2JPA A;  1X5W A;  1A1H A;  2EMF A;  2UXD E;  2EM3 A;  2EPZ A;  4GEQ B;  1YYK A;  2L33 A;  4OOG C;  1YSA C;  2WBS A;  4L5N C;  2BB8 A;  3KWR A;  4AQY E;  5IWA E;  1AAY A;  2RQL A;  2VQF E;  2VF1 A;  4WSG A;  2JOB A;  2EQ3 A;  2K4V A;  2LO3 A;  4Q28 A;  3JAM C;  2YRH A;  1EH6 A; 
#chains in the Genus database with same CATH homology
 2EMW A;  2EPA A;  3M99 B;  2EOI A;  1X6E A;  2EN7 A;  2DLQ A;  2YTD A;  2EPP A;  2EPC A;  4R2Q A;  2YTF A;  2JP9 A;  2EMA A;  2EOJ A;  2ENH A;  5KL2 A;  2EL6 A;  2EM6 A;  2YTP A;  2WBU A;  2RSI A;  2GLI A;  2NAB A;  1ZR9 A;  2EMC A;  2DLK A;  3MHH C;  2YTG A;  2YTE A;  1ZU1 A;  1X6F A;  2YTO A;  2ENA A;  2RPC A;  2EPR A;  2HGH A;  2PRT A;  5KL6 A;  1Z1B A;  2ELY A;  2ELZ A;  2MKD A;  2EPX A;  3EPJ A;  1KJK A;  1UBD C;  3UK3 C;  1A1J A;  3EPL A;  1F2I G;  2EMB A;  2EQ1 A;  2EOM A;  2EM9 A;  4FK5 C;  2LVH A;  4R2A A;  2YRK A;  2YSP A;  2EN8 A;  1X3C A;  1G2D C;  1YUJ A;  2EOH A;  4IJD A;  2A25 A;  2EM0 A;  2CTD A;  1JK1 A;  2EM4 A;  2EN3 A;  2EMH A;  2LCE A;  2EP3 A;  5KL5 A;  2YTQ A;  1A1I A;  1BB8 A;  2GHF A;  2VRD A;  2EL4 A;  3EPK A;  2ENC A;  2EM7 A;  2EM2 A;  5KL7 A;  2EMG A;  2CT1 A;  2EL5 A;  2YU8 A;  1RMD A;  1JK2 A;  2EOX A;  1TF6 A;  2YTJ A;  1DGC A;  2YTI A;  2YRM A;  4R2C A;  2EM5 A;  2YTN A;  2EN2 A;  2M9A A;  5KL3 A;  1P47 A;  1WJP A;  4IS1 C;  2EN1 A;  2DRP A;  2YU5 A;  4R2D A;  3EPH A;  2CSH A;  1B69 A;  1NCS A;  2WBT A;  1LLM C;  4F6N A;  4R2R A;  2EMZ A;  2E72 A;  2EOO A;  2EPU A;  4M9V C;  2EE8 A;  2EOY A;  4F2J C;  2EM8 A;  2I13 A;  2R1F A;  1TN9 A;  1A1L A;  2EOR A;  2MKN A;  1X6H A;  2EQ0 A;  1TF3 A;  4R2S A;  2EOS A;  2EMI A;  2JPA A;  1A1G A;  4R2P A;  1X5W A;  1A1K A;  1A1H A;  2EJ4 A;  1BBO A;  2EMF A;  2EOQ A;  2EM3 A;  2EPZ A;  1G2F C;  1YUI A;  1UN6 B;  2LT7 A;  2EMY A;  1YSA C;  2WBS A;  1A1F A;  2BB8 A;  1ZAA C;  2YSO A;  4GZN C;  2J7J A;  2LV2 A;  2EOF A;  4X9J A;  4F6M A;  1AAY A;  2EOE A;  2WCC 3;  2EN6 A;  4R2E A;  2EN4 A;  4WSG A;  2DMI A;  2EMX A;  2EML A;  3MHS C;  2D9H A;  2ADR A;  2EOZ A;  3VHT B;  2EQ3 A;  2LO3 A;  2MDG A;  5KL4 A;  1MEY C;  2DGC A;  2YRH A;  2EMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...