2ENHA

Solution structure of the c2h2 type zinc finger (region 556-588) of human zinc finger protein 28 homolog
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECDVCRKAFSHHASLTQHQRVHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 556-588) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2enhA01
2EOIA 2WBTA 1X6FA 2EE8A 2EOMA 3EPHA 2RPCA 1KJKA 2ELZA 2E72A 2EMFA 2J7JA 2LV2A 2RSIA 2CSHA 2YTOA 4R2EA 1G2FC 2EMBA 1A1IA 1TF3A 4X9JA 2EMIA 2YU8A 4F6MA 1WJPA 2EOJA 4F2JC 4IJDA 2ADRA 2EN1A 2MKDA 2YSPA 2EQ1A 2EN2A 1B69A 5KL2A 2YTGA 2EOQA 1UBDC 2EPXA 2EOXA 2EP3A 2EMXA 1ZAAC 2EN8A 4WSGA 5KL5A 2EJ4A 2EMCA 1X6EA 2EMKA 2ELYA 2CTDA 2EM5A 2EOZA 2DLQA 4R2SA 1NCSA 2EN7A 2YTDA 4R2PA 2GHFA 1BB8A 1X6HA 5KL3A 2YSOA 2NABA 1Z1BA 1MEYC 1A1KA 2EPZA 3VHTB 2EN3A 2YTIA 1YSAC 4M9VC 2YRMA 2BB8A 4FK5C 2HGHA 3EPJA 2GLIA 1A1LA 2EMHA 2YTNA 1YUJA 2WCC3 1RMDA 2MKNA 1X3CA 4IS1C 2D9HA 2DLKA 3MHHC 5KL7A 3MHSC 2VRDA 4F6NA 2EL4A 1G2DC 2JP9A 2YU5A 2EPPA 2DGCA 2EQ0A 2EOSA 2EPRA 1DGCA 2EM4A 2YTJA 4R2CA 5KL6A 1A1HA 2EL6A 2EM8A 1UN6B 2WBUA 4GZNC 2EOYA 1JK1A 3UK3C 2ENHA 4R2AA 1ZU1A 2EPCA 2YTFA 2YTPA 2EN4A 2EM9A 2JPAA 4R2DA 2EPUA 3M99B 2PRTA 2R1FA 1TN9A 2I13A 2ENAA 2CT1A 2EMYA 1BBOA 1TF6A 2EOOA 2EOHA 2EM3A 2DRPA 2DMIA 2EM7A 2YRKA 2LVHA 1A1GA 1X5WA 2EOEA 1A1JA 2EORA 4R2QA 1F2IG 2EL5A 2LCEA 2EOFA 1P47A 2ENCA 5KL4A 2YTQA 2EPAA 2MDGA 1AAYA 2EMAA 2WBSA 2LO3A 2EMLA 4R2RA 2LT7A 2EQ3A 3EPKA 1ZR9A 1YUIA 2EMGA 2A25A 2YTEA 1JK2A 1A1FA 2M9AA 2EM0A 2EN6A 2YRHA 2EM2A 2EM6A 2EMZA 2EMWA 1LLMC 3EPLA
chains in the Genus database with same CATH superfamily
2ODRD 1RQ0A 2NUEA 2RPCA 4WYQB 2M4IA 1I94E 2EMBA 5LL6R 1TF3A 4JI3E 4JI7E 5A2QC 1WJPA 3BGHA 4IJDA 1IBKE 2WZOA 2MKDA 2V83A 2CPNA 2YTGA 5AC4A 2L3CA 4JYAE 4DR3E 2EP3A 2EMXA 2EPNA 3P1XA 4B3ME 2IHR1 1X6EA 1EH7A 1N34E 2DLQA 4R2SA 1NCSA 4R2PA 1BB8A 4JI0E 2LMZA 4OOGC 5IXMB 4DV4E 1AH5A 3H09A 4DV5E 4DR7E 4FK5C 1YUJA 4WXDA 2WCC3 3RMPA 4DUZE 4LF9E 4NHRA 2VRDA 4ZYGA 4DR4E 2LRSA 3J80C 2EL4A 2EPPA 4TUGA 2DGCA 4WSPA 5AE1A 5KL6A 2V86A 2RS7A 2EL6A 2EM8A 5A6KA 5A6BD 4WFTA 2ENHA 3ADGA 2EPCA 2EN4A 2JPAA 4DKKA 2L92A 1GQEA 2PRTA 3AUZA 2I13A 2LUPB 1XNQE 4LU9A 1BBOA 1ZBQA 2EOHA 3HQ1A 4N4RB 4X62E 4NXME 1WHNA 2LVHA 1X5WA 2FGGA 3F6GA 4BC9A 2ZM6E 2EOFA 1FKAE 1X47A 1T4OA 2ENCA 2JVAA 4O43A 1PJTA 2NUGA 2EPKX 2RTXA 1HNXE 4L5NC 4L8NA 4LFBE 1O0WA 2RSMA 4ZYHA 2EMGA 2A25A 2L6MA 2K7IA 3L00A 1JK2A 2EMZA 1LLMC 4BS9A 2EOIA 2WBTA 3C6MA 5A69A 1X6FA 1GZ6A 2E72A 2J7JA 4O24A 2LTRA 1G2FC 3DF6A 4LF6E 1T39A 4X9JA 4M0VA 2YU8A 4F6MA 4JI5E 4F2JC 2L33A 3FIGA 4DR2E 1HNZE 3HTXA 2EN1A 2EQ1A 2EN2A 4GEQB 1B69A 2JOBA 2NA2A 3J7AG 4GKKE 1YFHA 1UBDC 3DJWA 4P78A 1X49A 3THOB 1N32E 4DV2E 1ZAAC 4O4KA 2EN8A 2E5LE 5KL5A 4BHBA 4BC7A 3JU0A 4X66E 2RQLA 3LMLA 4HEIA 4DR6E 5BR8E 1X6HA 2NABA 1NEIA 4P7DA 3HPSA 4MLQA 2LTSA 1A1KA 2M7QA 3ZOQB 2YRMA 2HGHA 3EPJA 2BBGA 4F9BB 1A1LA 2GLIA 1IQOA 5LMNE 1YYKA 3MHHC 2HC5A 3MHSC 4F6NA 3VK6A 5A6JA 4DMIA 2EM4A 2YTJA 4R2CA 3OMLA 4Q35B 1PKPA 2EOYA 5T6JA 1JK1A 1DI2A 4JI8E 2YWQA 3UK3C 4R2AA 4OX9E 3TQMA 4R2DA 4TUIA 2L2MA 2EPUA 3T1YE 2V8QB 2ODRC 5LLQA 2K4VA 1YYOA 2ENAA 2CT1A 2EMYA 3ADIA 2JOXA 4YHHE 2EOOA 4DUYE 4DV0E 2YZTA 4NXNE 2VE7C 3EQ1A 1XNRE 2JWOA 2B7TA 2DRPA 4NZVA 2EORA 4K0KE 4R2QA 2B7VA 2EL5A 2LJUA 1P47A 2UUCE 2L2NA 2FV4B 2LO3A 4F9AB 4BBYA 5AASA 4JI2E 4YY3E 1A1FA 2YRHA 4LTYA 2JY9A 4LFAE 1XMQE 2EE8A 2EOMA 5AE2A 1KJKA 2RSIA 2YT4A 3KZYA 2CSHA 2YTOA 4R2EA 1WXRA 1A1IA 4X8WA 4GKJE 2EZ6A 2ADRA 2MC6A 4I8OA 4KHPE 3QG5C 2Q8UA 4DV7E 2EOQA 1GTKA 1UILA 2EPXA 3ECRA 2EPLX 2F8BA 2L8TA 5A6AA 2VQFE 2GPIA 2JXPA 2JR1A 2EMKA 3C4BA 2ELYA 4Q28A 2EOZA 1MGTA 3C4TA 5IT9C 4DR5E 2N3GA 5IV8B 2EN7A 2YTDA 1Z1BA 1MEYC 2EPZA 3VHTB 2EN3A 4ZYEA 2YTIA 1YSAC 2KOUA 2KHXA 4M9VC 4F54A 2EMHA 2MKNA 1RMDA 4LF7E 4IS1C 2I9IA 2D9HA 3ADLA 1EH8A 1HR0E 4JV5E 2FTXB 2JP9A 5DNYA 2EQ0A 4BMJA 4R8OA 2EPRA 1KYQA 3JTZA 5A6BA 2B3TB 1A1HA 1UN6B 4B3RE 4GZNC 1SFEA 1PJSA 5LMUE 1T38A 1ZU1A 2YTPA 2YTFA 1IQSA 4WPYA 1FJGE 2MC5A 1WHQA 3M99B 2R1FA 1TN9A 4RHBB 1IBME 2DB2A 1TF6A 2E1MA 2VQEE 5AE3A 4LF8E 3IWCA 2EM3A 2V87A 1J5EE 2DMIA 2EM7A 2YRKA 1A1JA 2LCEA 1DQ3A 1PDAA 2YPNA 2MDRA 1X48A 2YTQA 4MLVA 4DV1E 4LF4E 4B3SE 4KZSA 2N3HA 2N8XA 4M30A 1BBGA 1EH6A 4BCAA 2M9AA 2EM6A 2EMWA 2UXCE 1EKZA 2RS6A 1T4LB 4WX9A 3EPLA 1XMOE 3MSWA 1J26A 5CFFE 5ADZA 4R03A 3EPHA 2L3JA 2HJJA 2F4VE 2ELZA 3J81C 2EMFA 2LV2A 2LBSB 1YPNA 2EMIA 2EOJA 4B3TE 2UXBE 2YSPA 1YZ9A 1L4SA 2LUQA 3VYYA 5KL2A 4KWYA 2UU9E 3THNA 5IWAE 2EOXA 1N3GA 2DSYA 3K6QA 2L2KB 2JYAA 3BBGA 3HXLA 2R76A 4WSGA 2EJ4A 2EMCA 3IWBA 2CTDA 2EM5A 1STUA 1N36E 4JI1E 2GHFA 3ADJA 2M1SA 5KL3A 2YSOA 1N33E 1IMUA 4X65E 2KONA 2EWLA 3AV0A 3J7Yp 2BB8A 4X64E 3HPZA 2YTNA 1QU6A 2V85A 1X3CA 2DLKA 4RH8A 5KL7A 4BHCA 2V88A 4M2ZA 3C6KA 2EPMX 4F9CB 1G2DC 2YU5A 5AC5A 4AQYE 2EOSA 5FLXC 2DIXA 1DGCA 3KZZA 5F3WA 2V89A 4HTGA 5TSEA 2UUBE 2H36X 3LLHA 4ZYDA 2WBUA 1SR9A 1PJQA 1QNTA 2EM9A 2LE2A 2UXDE 4WXCA 3OTOE 4DV3E 3F6HA 1YYWA 2LJHA 3BF2A 4DV6E 1IBLE 2NUFA 2HHHE 1A1GA 2EOEA 1UHZA 1F2IG 2EPOA 3IWDA 1RC7A 3KWRA 5KL4A 2UUAE 2EPAA 2MDGA 4JI4E 1T4NA 4LFCE 1AAYA 2G7HA 2EMAA 2WBSA 2B9DA 2EMLA 4DR1E 4JI6E 4J8ZA 3BIDA 4R2RA 2LT7A 2EQ3A 3EPKA 3T1HE 1ZR9A 1YUIA 4LF5E 1WRJA 2DMYA 2YTEA 3JAMC 2EM0A 2EN6A 2EM2A 1ZBTA 4O5GA 3VYXA 1HNWE 2VF1A
chains in the Genus database with same CATH topology
2EOIA 2WBTA 1X6FA 2EE8A 2EOMA 3EPHA 2RPCA 1KJKA 2ELZA 2E72A 2EMFA 2J7JA 2LV2A 2RSIA 2CSHA 2YTOA 4R2EA 1G2FC 2EMBA 1A1IA 1TF3A 4X9JA 2EMIA 2YU8A 4F6MA 1WJPA 2EOJA 4F2JC 4IJDA 2ADRA 2EN1A 2MKDA 2YSPA 2EQ1A 2EN2A 1B69A 5KL2A 2YTGA 2EOQA 1UBDC 2EPXA 2EOXA 2EP3A 2EMXA 1ZAAC 2EN8A 4WSGA 5KL5A 2EJ4A 2EMCA 1X6EA 2EMKA 2ELYA 2CTDA 2EM5A 2EOZA 2DLQA 4R2SA 1NCSA 2EN7A 2YTDA 4R2PA 2GHFA 1BB8A 1X6HA 5KL3A 2YSOA 2NABA 1Z1BA 1MEYC 1A1KA 2EPZA 3VHTB 2EN3A 2YTIA 1YSAC 4M9VC 2YRMA 2BB8A 4FK5C 2HGHA 3EPJA 2GLIA 1A1LA 2EMHA 2YTNA 1YUJA 2WCC3 1RMDA 2MKNA 1X3CA 4IS1C 2D9HA 2DLKA 3MHHC 5KL7A 3MHSC 2VRDA 4F6NA 2EL4A 1G2DC 2JP9A 2YU5A 2EPPA 2DGCA 2EQ0A 2EOSA 2EPRA 1DGCA 2EM4A 2YTJA 4R2CA 5KL6A 1A1HA 2EL6A 2EM8A 1UN6B 2WBUA 4GZNC 2EOYA 1JK1A 3UK3C 2ENHA 4R2AA 1ZU1A 2EPCA 2YTFA 2YTPA 2EN4A 2EM9A 2JPAA 4R2DA 2EPUA 3M99B 2PRTA 2R1FA 1TN9A 2I13A 2ENAA 2CT1A 2EMYA 1BBOA 1TF6A 2EOOA 2EOHA 2EM3A 2DRPA 2DMIA 2EM7A 2YRKA 2LVHA 1A1GA 1X5WA 2EOEA 1A1JA 2EORA 4R2QA 1F2IG 2EL5A 2LCEA 2EOFA 1P47A 2ENCA 5KL4A 2YTQA 2EPAA 2MDGA 1AAYA 2EMAA 2WBSA 2LO3A 2EMLA 4R2RA 2LT7A 2EQ3A 3EPKA 1ZR9A 1YUIA 2EMGA 2A25A 2YTEA 1JK2A 1A1FA 2M9AA 2EM0A 2EN6A 2YRHA 2EM2A 2EM6A 2EMZA 2EMWA 1LLMC 3EPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOI A;  2WBT A;  1X6F A;  2EE8 A;  2EOM A;  3EPH A;  2RPC A;  1KJK A;  2ELZ A;  2E72 A;  2EMF A;  2J7J A;  2LV2 A;  2RSI A;  2CSH A;  2YTO A;  4R2E A;  1G2F C;  2EMB A;  1A1I A;  1TF3 A;  4X9J A;  2EMI A;  2YU8 A;  4F6M A;  1WJP A;  2EOJ A;  4F2J C;  4IJD A;  2ADR A;  2EN1 A;  2MKD A;  2YSP A;  2EQ1 A;  2EN2 A;  1B69 A;  5KL2 A;  2YTG A;  2EOQ A;  1UBD C;  2EPX A;  2EOX A;  2EP3 A;  2EMX A;  1ZAA C;  2EN8 A;  4WSG A;  5KL5 A;  2EJ4 A;  2EMC A;  1X6E A;  2EMK A;  2ELY A;  2CTD A;  2EM5 A;  2EOZ A;  2DLQ A;  4R2S A;  1NCS A;  2EN7 A;  2YTD A;  4R2P A;  2GHF A;  1BB8 A;  1X6H A;  5KL3 A;  2YSO A;  2NAB A;  1Z1B A;  1MEY C;  1A1K A;  2EPZ A;  3VHT B;  2EN3 A;  2YTI A;  1YSA C;  4M9V C;  2YRM A;  2BB8 A;  4FK5 C;  2HGH A;  3EPJ A;  2GLI A;  1A1L A;  2EMH A;  2YTN A;  1YUJ A;  2WCC 3;  1RMD A;  2MKN A;  1X3C A;  4IS1 C;  2D9H A;  2DLK A;  3MHH C;  5KL7 A;  3MHS C;  2VRD A;  4F6N A;  2EL4 A;  1G2D C;  2JP9 A;  2YU5 A;  2EPP A;  2DGC A;  2EQ0 A;  2EOS A;  2EPR A;  1DGC A;  2EM4 A;  2YTJ A;  4R2C A;  5KL6 A;  1A1H A;  2EL6 A;  2EM8 A;  1UN6 B;  2WBU A;  4GZN C;  2EOY A;  1JK1 A;  3UK3 C;  2ENH A;  4R2A A;  1ZU1 A;  2EPC A;  2YTF A;  2YTP A;  2EN4 A;  2EM9 A;  2JPA A;  4R2D A;  2EPU A;  3M99 B;  2PRT A;  2R1F A;  1TN9 A;  2I13 A;  2ENA A;  2CT1 A;  2EMY A;  1BBO A;  1TF6 A;  2EOO A;  2EOH A;  2EM3 A;  2DRP A;  2DMI A;  2EM7 A;  2YRK A;  2LVH A;  1A1G A;  1X5W A;  2EOE A;  1A1J A;  2EOR A;  4R2Q A;  1F2I G;  2EL5 A;  2LCE A;  2EOF A;  1P47 A;  2ENC A;  5KL4 A;  2YTQ A;  2EPA A;  2MDG A;  1AAY A;  2EMA A;  2WBS A;  2LO3 A;  2EML A;  4R2R A;  2LT7 A;  2EQ3 A;  3EPK A;  1ZR9 A;  1YUI A;  2EMG A;  2A25 A;  2YTE A;  1JK2 A;  1A1F A;  2M9A A;  2EM0 A;  2EN6 A;  2YRH A;  2EM2 A;  2EM6 A;  2EMZ A;  2EMW A;  1LLM C;  3EPL A; 
#chains in the Genus database with same CATH topology
 2ODR D;  1RQ0 A;  2NUE A;  2RPC A;  4WYQ B;  2M4I A;  1I94 E;  2EMB A;  5LL6 R;  1TF3 A;  4JI3 E;  4JI7 E;  5A2Q C;  1WJP A;  3BGH A;  4IJD A;  1IBK E;  2WZO A;  2MKD A;  2V83 A;  2CPN A;  2YTG A;  5AC4 A;  2L3C A;  4JYA E;  4DR3 E;  2EP3 A;  2EMX A;  2EPN A;  3P1X A;  4B3M E;  2IHR 1;  1X6E A;  1EH7 A;  1N34 E;  2DLQ A;  4R2S A;  1NCS A;  4R2P A;  1BB8 A;  4JI0 E;  2LMZ A;  4OOG C;  5IXM B;  4DV4 E;  1AH5 A;  3H09 A;  4DV5 E;  4DR7 E;  4FK5 C;  1YUJ A;  4WXD A;  2WCC 3;  3RMP A;  4DUZ E;  4LF9 E;  4NHR A;  2VRD A;  4ZYG A;  4DR4 E;  2LRS A;  3J80 C;  2EL4 A;  2EPP A;  4TUG A;  2DGC A;  4WSP A;  5AE1 A;  5KL6 A;  2V86 A;  2RS7 A;  2EL6 A;  2EM8 A;  5A6K A;  5A6B D;  4WFT A;  2ENH A;  3ADG A;  2EPC A;  2EN4 A;  2JPA A;  4DKK A;  2L92 A;  1GQE A;  2PRT A;  3AUZ A;  2I13 A;  2LUP B;  1XNQ E;  4LU9 A;  1BBO A;  1ZBQ A;  2EOH A;  3HQ1 A;  4N4R B;  4X62 E;  4NXM E;  1WHN A;  2LVH A;  1X5W A;  2FGG A;  3F6G A;  4BC9 A;  2ZM6 E;  2EOF A;  1FKA E;  1X47 A;  1T4O A;  2ENC A;  2JVA A;  4O43 A;  1PJT A;  2NUG A;  2EPK X;  2RTX A;  1HNX E;  4L5N C;  4L8N A;  4LFB E;  1O0W A;  2RSM A;  4ZYH A;  2EMG A;  2A25 A;  2L6M A;  2K7I A;  3L00 A;  1JK2 A;  2EMZ A;  1LLM C;  4BS9 A;  2EOI A;  2WBT A;  3C6M A;  5A69 A;  1X6F A;  1GZ6 A;  2E72 A;  2J7J A;  4O24 A;  2LTR A;  1G2F C;  3DF6 A;  4LF6 E;  1T39 A;  4X9J A;  4M0V A;  2YU8 A;  4F6M A;  4JI5 E;  4F2J C;  2L33 A;  3FIG A;  4DR2 E;  1HNZ E;  3HTX A;  2EN1 A;  2EQ1 A;  2EN2 A;  4GEQ B;  1B69 A;  2JOB A;  2NA2 A;  3J7A G;  4GKK E;  1YFH A;  1UBD C;  3DJW A;  4P78 A;  1X49 A;  3THO B;  1N32 E;  4DV2 E;  1ZAA C;  4O4K A;  2EN8 A;  2E5L E;  5KL5 A;  4BHB A;  4BC7 A;  3JU0 A;  4X66 E;  2RQL A;  3LML A;  4HEI A;  4DR6 E;  5BR8 E;  1X6H A;  2NAB A;  1NEI A;  4P7D A;  3HPS A;  4MLQ A;  2LTS A;  1A1K A;  2M7Q A;  3ZOQ B;  2YRM A;  2HGH A;  3EPJ A;  2BBG A;  4F9B B;  1A1L A;  2GLI A;  1IQO A;  5LMN E;  1YYK A;  3MHH C;  2HC5 A;  3MHS C;  4F6N A;  3VK6 A;  5A6J A;  4DMI A;  2EM4 A;  2YTJ A;  4R2C A;  3OML A;  4Q35 B;  1PKP A;  2EOY A;  5T6J A;  1JK1 A;  1DI2 A;  4JI8 E;  2YWQ A;  3UK3 C;  4R2A A;  4OX9 E;  3TQM A;  4R2D A;  4TUI A;  2L2M A;  2EPU A;  3T1Y E;  2V8Q B;  2ODR C;  5LLQ A;  2K4V A;  1YYO A;  2ENA A;  2CT1 A;  2EMY A;  3ADI A;  2JOX A;  4YHH E;  2EOO A;  4DUY E;  4DV0 E;  2YZT A;  4NXN E;  2VE7 C;  3EQ1 A;  1XNR E;  2JWO A;  2B7T A;  2DRP A;  4NZV A;  2EOR A;  4K0K E;  4R2Q A;  2B7V A;  2EL5 A;  2LJU A;  1P47 A;  2UUC E;  2L2N A;  2FV4 B;  2LO3 A;  4F9A B;  4BBY A;  5AAS A;  4JI2 E;  4YY3 E;  1A1F A;  2YRH A;  4LTY A;  2JY9 A;  4LFA E;  1XMQ E;  2EE8 A;  2EOM A;  5AE2 A;  1KJK A;  2RSI A;  2YT4 A;  3KZY A;  2CSH A;  2YTO A;  4R2E A;  1WXR A;  1A1I A;  4X8W A;  4GKJ E;  2EZ6 A;  2ADR A;  2MC6 A;  4I8O A;  4KHP E;  3QG5 C;  2Q8U A;  4DV7 E;  2EOQ A;  1GTK A;  1UIL A;  2EPX A;  3ECR A;  2EPL X;  2F8B A;  2L8T A;  5A6A A;  2VQF E;  2GPI A;  2JXP A;  2JR1 A;  2EMK A;  3C4B A;  2ELY A;  4Q28 A;  2EOZ A;  1MGT A;  3C4T A;  5IT9 C;  4DR5 E;  2N3G A;  5IV8 B;  2EN7 A;  2YTD A;  1Z1B A;  1MEY C;  2EPZ A;  3VHT B;  2EN3 A;  4ZYE A;  2YTI A;  1YSA C;  2KOU A;  2KHX A;  4M9V C;  4F54 A;  2EMH A;  2MKN A;  1RMD A;  4LF7 E;  4IS1 C;  2I9I A;  2D9H A;  3ADL A;  1EH8 A;  1HR0 E;  4JV5 E;  2FTX B;  2JP9 A;  5DNY A;  2EQ0 A;  4BMJ A;  4R8O A;  2EPR A;  1KYQ A;  3JTZ A;  5A6B A;  2B3T B;  1A1H A;  1UN6 B;  4B3R E;  4GZN C;  1SFE A;  1PJS A;  5LMU E;  1T38 A;  1ZU1 A;  2YTP A;  2YTF A;  1IQS A;  4WPY A;  1FJG E;  2MC5 A;  1WHQ A;  3M99 B;  2R1F A;  1TN9 A;  4RHB B;  1IBM E;  2DB2 A;  1TF6 A;  2E1M A;  2VQE E;  5AE3 A;  4LF8 E;  3IWC A;  2EM3 A;  2V87 A;  1J5E E;  2DMI A;  2EM7 A;  2YRK A;  1A1J A;  2LCE A;  1DQ3 A;  1PDA A;  2YPN A;  2MDR A;  1X48 A;  2YTQ A;  4MLV A;  4DV1 E;  4LF4 E;  4B3S E;  4KZS A;  2N3H A;  2N8X A;  4M30 A;  1BBG A;  1EH6 A;  4BCA A;  2M9A A;  2EM6 A;  2EMW A;  2UXC E;  1EKZ A;  2RS6 A;  1T4L B;  4WX9 A;  3EPL A;  1XMO E;  3MSW A;  1J26 A;  5CFF E;  5ADZ A;  4R03 A;  3EPH A;  2L3J A;  2HJJ A;  2F4V E;  2ELZ A;  3J81 C;  2EMF A;  2LV2 A;  2LBS B;  1YPN A;  2EMI A;  2EOJ A;  4B3T E;  2UXB E;  2YSP A;  1YZ9 A;  1L4S A;  2LUQ A;  3VYY A;  5KL2 A;  4KWY A;  2UU9 E;  3THN A;  5IWA E;  2EOX A;  1N3G A;  2DSY A;  3K6Q A;  2L2K B;  2JYA A;  3BBG A;  3HXL A;  2R76 A;  4WSG A;  2EJ4 A;  2EMC A;  3IWB A;  2CTD A;  2EM5 A;  1STU A;  1N36 E;  4JI1 E;  2GHF A;  3ADJ A;  2M1S A;  5KL3 A;  2YSO A;  1N33 E;  1IMU A;  4X65 E;  2KON A;  2EWL A;  3AV0 A;  3J7Y p;  2BB8 A;  4X64 E;  3HPZ A;  2YTN A;  1QU6 A;  2V85 A;  1X3C A;  2DLK A;  4RH8 A;  5KL7 A;  4BHC A;  2V88 A;  4M2Z A;  3C6K A;  2EPM X;  4F9C B;  1G2D C;  2YU5 A;  5AC5 A;  4AQY E;  2EOS A;  5FLX C;  2DIX A;  1DGC A;  3KZZ A;  5F3W A;  2V89 A;  4HTG A;  5TSE A;  2UUB E;  2H36 X;  3LLH A;  4ZYD A;  2WBU A;  1SR9 A;  1PJQ A;  1QNT A;  2EM9 A;  2LE2 A;  2UXD E;  4WXC A;  3OTO E;  4DV3 E;  3F6H A;  1YYW A;  2LJH A;  3BF2 A;  4DV6 E;  1IBL E;  2NUF A;  2HHH E;  1A1G A;  2EOE A;  1UHZ A;  1F2I G;  2EPO A;  3IWD A;  1RC7 A;  3KWR A;  5KL4 A;  2UUA E;  2EPA A;  2MDG A;  4JI4 E;  1T4N A;  4LFC E;  1AAY A;  2G7H A;  2EMA A;  2WBS A;  2B9D A;  2EML A;  4DR1 E;  4JI6 E;  4J8Z A;  3BID A;  4R2R A;  2LT7 A;  2EQ3 A;  3EPK A;  3T1H E;  1ZR9 A;  1YUI A;  4LF5 E;  1WRJ A;  2DMY A;  2YTE A;  3JAM C;  2EM0 A;  2EN6 A;  2EM2 A;  1ZBT A;  4O5G A;  3VYX A;  1HNW E;  2VF1 A; 
#chains in the Genus database with same CATH homology
 2EOI A;  2WBT A;  1X6F A;  2EE8 A;  2EOM A;  3EPH A;  2RPC A;  1KJK A;  2ELZ A;  2E72 A;  2EMF A;  2J7J A;  2LV2 A;  2RSI A;  2CSH A;  2YTO A;  4R2E A;  1G2F C;  2EMB A;  1A1I A;  1TF3 A;  4X9J A;  2EMI A;  2YU8 A;  4F6M A;  1WJP A;  2EOJ A;  4F2J C;  4IJD A;  2ADR A;  2EN1 A;  2MKD A;  2YSP A;  2EQ1 A;  2EN2 A;  1B69 A;  5KL2 A;  2YTG A;  2EOQ A;  1UBD C;  2EPX A;  2EOX A;  2EP3 A;  2EMX A;  1ZAA C;  2EN8 A;  4WSG A;  5KL5 A;  2EJ4 A;  2EMC A;  1X6E A;  2EMK A;  2ELY A;  2CTD A;  2EM5 A;  2EOZ A;  2DLQ A;  4R2S A;  1NCS A;  2EN7 A;  2YTD A;  4R2P A;  2GHF A;  1BB8 A;  1X6H A;  5KL3 A;  2YSO A;  2NAB A;  1Z1B A;  1MEY C;  1A1K A;  2EPZ A;  3VHT B;  2EN3 A;  2YTI A;  1YSA C;  4M9V C;  2YRM A;  2BB8 A;  4FK5 C;  2HGH A;  3EPJ A;  2GLI A;  1A1L A;  2EMH A;  2YTN A;  1YUJ A;  2WCC 3;  1RMD A;  2MKN A;  1X3C A;  4IS1 C;  2D9H A;  2DLK A;  3MHH C;  5KL7 A;  3MHS C;  2VRD A;  4F6N A;  2EL4 A;  1G2D C;  2JP9 A;  2YU5 A;  2EPP A;  2DGC A;  2EQ0 A;  2EOS A;  2EPR A;  1DGC A;  2EM4 A;  2YTJ A;  4R2C A;  5KL6 A;  1A1H A;  2EL6 A;  2EM8 A;  1UN6 B;  2WBU A;  4GZN C;  2EOY A;  1JK1 A;  3UK3 C;  2ENH A;  4R2A A;  1ZU1 A;  2EPC A;  2YTF A;  2YTP A;  2EN4 A;  2EM9 A;  2JPA A;  4R2D A;  2EPU A;  3M99 B;  2PRT A;  2R1F A;  1TN9 A;  2I13 A;  2ENA A;  2CT1 A;  2EMY A;  1BBO A;  1TF6 A;  2EOO A;  2EOH A;  2EM3 A;  2DRP A;  2DMI A;  2EM7 A;  2YRK A;  2LVH A;  1A1G A;  1X5W A;  2EOE A;  1A1J A;  2EOR A;  4R2Q A;  1F2I G;  2EL5 A;  2LCE A;  2EOF A;  1P47 A;  2ENC A;  5KL4 A;  2YTQ A;  2EPA A;  2MDG A;  1AAY A;  2EMA A;  2WBS A;  2LO3 A;  2EML A;  4R2R A;  2LT7 A;  2EQ3 A;  3EPK A;  1ZR9 A;  1YUI A;  2EMG A;  2A25 A;  2YTE A;  1JK2 A;  1A1F A;  2M9A A;  2EM0 A;  2EN6 A;  2YRH A;  2EM2 A;  2EM6 A;  2EMZ A;  2EMW A;  1LLM C;  3EPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...