2ENHA

Solution structure of the c2h2 type zinc finger (region 556-588) of human zinc finger protein 28 homolog
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECDVCRKAFSHHASLTQHQRVHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 556-588) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2enhA01
1A1FA 4X9JA 2ADRA 2GLIA 1JK1A 2EMXA 1JK2A 1A1KA 2YRKA 1G2FC 1A1LA 1LLMC 2RSIA 2EOOA 2DGCA 2EM3A 2YTQA 2CT1A 2EMCA 2YTNA 1UN6B 2YTFA 2LCEA 2LT7A 4IS1C 3EPKA 1YUIA 1KJKA 2MKDA 5KL7A 2EQ1A 2EOMA 2EORA 4M9VC 2EN3A 4R2SA 2BB8A 1B69A 3EPHA 4F6NA 2J7JA 2EPUA 2EN2A 2EOZA 3MHHC 2EM8A 2LVHA 1YUJA 2EN8A 2EMGA 2EMAA 2M9AA 2WCC3 4F2JC 2EMZA 2EM6A 2E72A 2YTDA 4R2EA 4GZNC 1AAYA 2EM2A 2EN1A 2MKNA 2I13A 2EOHA 5KL6A 2JPAA 2DMIA 2YRHA 1YSAC 1A1GA 3VHTB 4R2AA 2EM5A 2R1FA 2YRMA 1NCSA 2EMLA 2YTEA 2GHFA 2A25A 2EOYA 1UBDC 2EQ0A 4R2RA 2EMWA 2YTIA 3EPJA 2ELYA 2EM7A 2EPCA 2EOSA 2YTOA 2EL5A 2NABA 2WBUA 4IJDA 1A1JA 1MEYC 1A1HA 2EOXA 1RMDA 2DLQA 2YTGA 1F2IG 1TF6A 2EMYA 2EQ3A 2CTDA 1X6HA 2EOFA 1WJPA 2EOQA 2JP9A 2EOJA 2DRPA 1X3CA 2YU8A 3UK3C 2ENCA 1X6FA 2ENHA 4R2PA 1ZAAC 2ENAA 2EMBA 4WSGA 4R2CA 4FK5C 2EE8A 2EPAA 2DLKA 1X6EA 2YTPA 2ELZA 1ZR9A 2EMKA 2EOEA 2YSPA 2EP3A 3EPLA 1X5WA 2EMIA 2VRDA 2EMHA 2EL4A 1ZU1A 1BB8A 2EPRA 2EM0A 2PRTA 1A1IA 1Z1BA 3M99B 1G2DC 2EM9A 5KL4A 2EL6A 2YU5A 2RPCA 2LV2A 2YTJA 4R2QA 2EPPA 4R2DA 2EPXA 2MDGA 1TN9A 2EN6A 4F6MA 1BBOA 2WBSA 2D9HA 2HGHA 2WBTA 3MHSC 1DGCA 2EMFA 2YSOA 5KL2A 2EPZA 2EM4A 2LO3A 1TF3A 5KL3A 2EOIA 5KL5A 2EN4A 2EJ4A 1P47A 2CSHA 2EN7A
chains in the Genus database with same CATH superfamily
1STUA 4X9JA 2L2MA 1JK2A 2L2KB 2RSIA 2DGCA 2LJHA 4LF7E 2CT1A 3DF6A 2EPKX 2V8QB 5IT9C 2YTFA 4F54A 1DI2A 1YUIA 5KL7A 2EQ1A 2EN3A 3EPHA 2K7IA 4JI0E 2J7JA 3IWBA 4GEQB 2L8TA 5BR8E 1T4OA 2H36X 2FV4B 2ZM6E 2B7VA 2HJJA 4LF5E 2EMGA 4M0VA 1AAYA 5LMNE 4OX9E 1L4SA 2L2NA 2L6MA 2MKNA 1XNQE 2M1SA 4GKKE 1UBDC 1GZ6A 1DQ3A 5CFFE 1J26A 2N3GA 4DR7E 4WX9A 2EL5A 2WBUA 1I94E 4IJDA 1A1JA 1MEYC 2EOXA 1F2IG 1TF6A 4WSPA 1X6HA 1T39A 2JP9A 4DV3E 2YU8A 2K4VA 1AH5A 2ENCA 2LE2A 3J7Yp 2NA2A 3BF2A 2LMZA 4FK5C 4WFTA 2EPAA 3FIGA 2DLKA 2ELZA 3ADGA 3DJWA 3VK6A 2EP3A 3EPLA 1X5WA 3HQ1A 1IQOA 2HC5A 4O5GA 4BCAA 2EMHA 1WXRA 3JU0A 2EM0A 2PRTA 1X47A 1HR0E 5IXMB 4ZYEA 4BC9A 2IHR1 2YU5A 2RPCA 1RQ0A 2ODRD 2YPNA 1HNZE 4R2DA 4RHBB 2EPXA 2V87A 4LF9E 2L3JA 4JV5E 4BMJA 3ZOQB 2JYAA 1J5EE 4ZYHA 4WPYA 4DUYE 4K0KE 2JOBA 1DGCA 4HEIA 4F9AB 2E1MA 2LO3A 5KL3A 2L3CA 4DKKA 2EN4A 4KHPE 5AC5A 2L33A 2ADRA 1A1FA 4L5NC 1EKZA 1WHQA 4M30A 4DV5E 4X66E 3JTZA 5AE3A 2YRKA 1PKPA 4X64E 1PJSA 2EOOA 3THNA 2YTQA 2YTNA 3ADLA 1BBGA 4JI7E 2LT7A 4IS1C 2LUPB 5AC4A 3BGHA 1QU6A 4M9VC 4Q28A 2V89A 4F6NA 5A6KA 2EPUA 2EM8A 1O0WA 2LVHA 2GPIA 1YUJA 3THOB 2EMAA 2WCC3 2EMZA 2UXDE 3C6MA 2YTDA 2EPOA 1XNRE 2I13A 2N3HA 2YRHA 1YSAC 4R2AA 2R1FA 2BBGA 1X49A 3F6HA 2YTEA 2GHFA 3VYYA 2KONA 5A6AA 2EMWA 2YTIA 2B7TA 3EPJA 2ELYA 2EPCA 4JI6E 1A1HA 5T6JA 4LTYA 1RMDA 4OOGC 2EMYA 3C4TA 1WJPA 2EOJA 4DV7E 3HTXA 2DRPA 2E5LE 1X6FA 4R2PA 4WSGA 1FKAE 4DV1E 4BHCA 3MSWA 1X6EA 4LFCE 2Q8UA 2EMKA 2RS6A 3IWCA 5A6BD 4DV2E 4X8WA 4B3ME 4KWYA 5IV8B 1YYWA 2LRSA 1YFHA 1ZU1A 4BHBA 5AE1A 4F9BB 2VQEE 1Z1BA 1G2DC 4DR6E 5KL4A 1IBKE 4O24A 2V88A 2YTJA 3EQ1A 4R8OA 4R2QA 2LTRA 3JAMC 4WXCA 5ADZA 1BBOA 2V83A 4O43A 4LFBE 2HGHA 2FTXB 2JY9A 5KL2A 4MLVA 2EM4A 3BIDA 1NEIA 3KZYA 4I8OA 2UXBE 5KL5A 2EWLA 4BC7A 2EM3A 2GLIA 3C4BA 4YHHE 1A1KA 2KOUA 2RQLA 5LL6R 2B9DA 2EPNA 2EMCA 4MLQA 1N34E 1UN6B 1HNWE 2LCEA 2V86A 2JXPA 1N32E 4M2ZA 1KJKA 5A6BA 2MKDA 2EORA 2EOMA 2MC6A 5LLQA 1B69A 1QNTA 2UUBE 4AQYE 2EN2A 1EH8A 3MHHC 1WRJA 2UUAE 1PDAA 4DR1E 4BS9A 1YYOA 2EN8A 4DV6E 2M9AA 1XMOE 2RSMA 4F2JC 2EM6A 4GZNC 4B3RE 2EM2A 1GTKA 4DR5E 4WXDA 2EOHA 3VHTB 4Q35B 2YRMA 4LF4E 2EMLA 2RTXA 4JI2E 2A25A 3HXLA 2EQ0A 4R2RA 2I9IA 2YTOA 2EOSA 3P1XA 4TUIA 5A69A 2DLQA 2YTGA 2EQ3A 2CTDA 2YT4A 3C6KA 1KYQA 2DSYA 2EPMX 2EOQA 2UU9E 1X3CA 2JR1A 3BBGA 2ENHA 2ENAA 2L92A 2EPLX 4R2CA 2EE8A 2CPNA 3IWDA 5F3WA 1N36E 2R76A 1ZR9A 2EOEA 1IMUA 2DB2A 2EL4A 1N33E 1BB8A 5TSEA 2EPRA 4JI4E 2JOXA 4R03A 2DIXA 4P7DA 2JVAA 5AE2A 4JI8E 2LV2A 1IQSA 4N4RB 3OTOE 4JI1E 1UHZA 3HPSA 4NHRA 1TN9A 4DUZE 2EN6A 4DMIA 4DV0E 1N3GA 4F6MA 2F4VE 4P78A 2D9HA 4TUGA 4O4KA 2LBSB 1RC7A 2VF1A 4X62E 2NUFA 3LMLA 3J7AG 2YSOA 2LUQA 3RMPA 1IBLE 2EPZA 2MC5A 3QG5C 1TF3A 4DV4E 5A6JA 1T4LB 2EOIA 4F9CB 1HNXE 2EJ4A 1P47A 2DMYA 2CSHA 2EN7A 2NUGA 1JK1A 2EMXA 1PJQA 4B3TE 3AV0A 2VQFE 1GQEA 1LLMC 1A1LA 4X65E 1G2FC 2FGGA 2HHHE 2ODRC 2LJUA 2UXCE 3EPKA 4JYAE 3T1YE 2NUEA 4BBYA 3T1HE 4R2SA 2BB8A 2EOZA 1MGTA 3ECRA 5IWAE 4L8NA 4ZYDA 3J80C 1SFEA 2YZTA 2E72A 4R2EA 2KHXA 2EN1A 4J8ZA 3ADIA 4DR3E 1IBME 4KZSA 4YY3E 5KL6A 2JPAA 2DMIA 3OMLA 1A1GA 1ZBTA 2EM5A 2B3TB 1NCSA 3H09A 2JWOA 2EOYA 3J81C 3L00A 4GKJE 2EM7A 3LLHA 1YYKA 2NABA 2G7HA 5DNYA 3ADJA 4LU9A 1SR9A 3HPZA 2EOFA 3F6GA 2WZOA 1T4NA 2M4IA 1PJTA 5FLXC 4DR4E 3UK3C 1XMQE 1ZBQA 2MDRA 1ZAAC 2EMBA 5A2QC 2RS7A 2VE7C 4NZVA 1UILA 2V85A 2YTPA 1T38A 4HTGA 2YSPA 1EH6A 2N8XA 4NXME 2UUCE 3K6QA 2EMIA 4RH8A 2VRDA 2EZ6A 1A1IA 3M99B 2EM9A 3AUZA 2EL6A 1YZ9A 3KZZA 5AASA 4LF8E 3TQMA 4B3SE 2EPPA 3VYXA 4JI5E 2LTSA 2MDGA 2M7QA 4WYQB 4ZYGA 1WHNA 4LFAE 4LF6E 1EH7A 2WBSA 4NXNE 1YPNA 2WBTA 2F8BA 3MHSC 4DR2E 2EMFA 3KWRA 1X48A 2YWQA 5LMUE 1FJGE 4JI3E
chains in the Genus database with same CATH topology
1A1FA 4X9JA 2ADRA 2GLIA 1JK1A 2EMXA 1JK2A 1A1KA 2YRKA 1G2FC 1A1LA 1LLMC 2RSIA 2EOOA 2DGCA 2EM3A 2YTQA 2CT1A 2EMCA 2YTNA 1UN6B 2YTFA 2LCEA 2LT7A 4IS1C 3EPKA 1YUIA 1KJKA 2MKDA 5KL7A 2EQ1A 2EOMA 2EORA 4M9VC 2EN3A 4R2SA 2BB8A 1B69A 3EPHA 4F6NA 2J7JA 2EPUA 2EN2A 2EOZA 3MHHC 2EM8A 2LVHA 1YUJA 2EN8A 2EMGA 2EMAA 2M9AA 2WCC3 4F2JC 2EMZA 2EM6A 2E72A 2YTDA 4R2EA 4GZNC 1AAYA 2EM2A 2EN1A 2MKNA 2I13A 2EOHA 5KL6A 2JPAA 2DMIA 2YRHA 1YSAC 1A1GA 3VHTB 4R2AA 2EM5A 2R1FA 2YRMA 1NCSA 2EMLA 2YTEA 2GHFA 2A25A 2EOYA 1UBDC 2EQ0A 4R2RA 2EMWA 2YTIA 3EPJA 2ELYA 2EM7A 2EPCA 2EOSA 2YTOA 2EL5A 2NABA 2WBUA 4IJDA 1A1JA 1MEYC 1A1HA 2EOXA 1RMDA 2DLQA 2YTGA 1F2IG 1TF6A 2EMYA 2EQ3A 2CTDA 1X6HA 2EOFA 1WJPA 2EOQA 2JP9A 2EOJA 2DRPA 1X3CA 2YU8A 3UK3C 2ENCA 1X6FA 2ENHA 4R2PA 1ZAAC 2ENAA 2EMBA 4WSGA 4R2CA 4FK5C 2EE8A 2EPAA 2DLKA 1X6EA 2YTPA 2ELZA 1ZR9A 2EMKA 2EOEA 2YSPA 2EP3A 3EPLA 1X5WA 2EMIA 2VRDA 2EMHA 2EL4A 1ZU1A 1BB8A 2EPRA 2EM0A 2PRTA 1A1IA 1Z1BA 3M99B 1G2DC 2EM9A 5KL4A 2EL6A 2YU5A 2RPCA 2LV2A 2YTJA 4R2QA 2EPPA 4R2DA 2EPXA 2MDGA 1TN9A 2EN6A 4F6MA 1BBOA 2WBSA 2D9HA 2HGHA 2WBTA 3MHSC 1DGCA 2EMFA 2YSOA 5KL2A 2EPZA 2EM4A 2LO3A 1TF3A 5KL3A 2EOIA 5KL5A 2EN4A 2EJ4A 1P47A 2CSHA 2EN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1F A;  4X9J A;  2ADR A;  2GLI A;  1JK1 A;  2EMX A;  1JK2 A;  1A1K A;  2YRK A;  1G2F C;  1A1L A;  1LLM C;  2RSI A;  2EOO A;  2DGC A;  2EM3 A;  2YTQ A;  2CT1 A;  2EMC A;  2YTN A;  1UN6 B;  2YTF A;  2LCE A;  2LT7 A;  4IS1 C;  3EPK A;  1YUI A;  1KJK A;  2MKD A;  5KL7 A;  2EQ1 A;  2EOM A;  2EOR A;  4M9V C;  2EN3 A;  4R2S A;  2BB8 A;  1B69 A;  3EPH A;  4F6N A;  2J7J A;  2EPU A;  2EN2 A;  2EOZ A;  3MHH C;  2EM8 A;  2LVH A;  1YUJ A;  2EN8 A;  2EMG A;  2EMA A;  2M9A A;  2WCC 3;  4F2J C;  2EMZ A;  2EM6 A;  2E72 A;  2YTD A;  4R2E A;  4GZN C;  1AAY A;  2EM2 A;  2EN1 A;  2MKN A;  2I13 A;  2EOH A;  5KL6 A;  2JPA A;  2DMI A;  2YRH A;  1YSA C;  1A1G A;  3VHT B;  4R2A A;  2EM5 A;  2R1F A;  2YRM A;  1NCS A;  2EML A;  2YTE A;  2GHF A;  2A25 A;  2EOY A;  1UBD C;  2EQ0 A;  4R2R A;  2EMW A;  2YTI A;  3EPJ A;  2ELY A;  2EM7 A;  2EPC A;  2EOS A;  2YTO A;  2EL5 A;  2NAB A;  2WBU A;  4IJD A;  1A1J A;  1MEY C;  1A1H A;  2EOX A;  1RMD A;  2DLQ A;  2YTG A;  1F2I G;  1TF6 A;  2EMY A;  2EQ3 A;  2CTD A;  1X6H A;  2EOF A;  1WJP A;  2EOQ A;  2JP9 A;  2EOJ A;  2DRP A;  1X3C A;  2YU8 A;  3UK3 C;  2ENC A;  1X6F A;  2ENH A;  4R2P A;  1ZAA C;  2ENA A;  2EMB A;  4WSG A;  4R2C A;  4FK5 C;  2EE8 A;  2EPA A;  2DLK A;  1X6E A;  2YTP A;  2ELZ A;  1ZR9 A;  2EMK A;  2EOE A;  2YSP A;  2EP3 A;  3EPL A;  1X5W A;  2EMI A;  2VRD A;  2EMH A;  2EL4 A;  1ZU1 A;  1BB8 A;  2EPR A;  2EM0 A;  2PRT A;  1A1I A;  1Z1B A;  3M99 B;  1G2D C;  2EM9 A;  5KL4 A;  2EL6 A;  2YU5 A;  2RPC A;  2LV2 A;  2YTJ A;  4R2Q A;  2EPP A;  4R2D A;  2EPX A;  2MDG A;  1TN9 A;  2EN6 A;  4F6M A;  1BBO A;  2WBS A;  2D9H A;  2HGH A;  2WBT A;  3MHS C;  1DGC A;  2EMF A;  2YSO A;  5KL2 A;  2EPZ A;  2EM4 A;  2LO3 A;  1TF3 A;  5KL3 A;  2EOI A;  5KL5 A;  2EN4 A;  2EJ4 A;  1P47 A;  2CSH A;  2EN7 A; 
#chains in the Genus database with same CATH topology
 1STU A;  4X9J A;  2L2M A;  1JK2 A;  2L2K B;  2RSI A;  2DGC A;  2LJH A;  4LF7 E;  2CT1 A;  3DF6 A;  2EPK X;  2V8Q B;  5IT9 C;  2YTF A;  4F54 A;  1DI2 A;  1YUI A;  5KL7 A;  2EQ1 A;  2EN3 A;  3EPH A;  2K7I A;  4JI0 E;  2J7J A;  3IWB A;  4GEQ B;  2L8T A;  5BR8 E;  1T4O A;  2H36 X;  2FV4 B;  2ZM6 E;  2B7V A;  2HJJ A;  4LF5 E;  2EMG A;  4M0V A;  1AAY A;  5LMN E;  4OX9 E;  1L4S A;  2L2N A;  2L6M A;  2MKN A;  1XNQ E;  2M1S A;  4GKK E;  1UBD C;  1GZ6 A;  1DQ3 A;  5CFF E;  1J26 A;  2N3G A;  4DR7 E;  4WX9 A;  2EL5 A;  2WBU A;  1I94 E;  4IJD A;  1A1J A;  1MEY C;  2EOX A;  1F2I G;  1TF6 A;  4WSP A;  1X6H A;  1T39 A;  2JP9 A;  4DV3 E;  2YU8 A;  2K4V A;  1AH5 A;  2ENC A;  2LE2 A;  3J7Y p;  2NA2 A;  3BF2 A;  2LMZ A;  4FK5 C;  4WFT A;  2EPA A;  3FIG A;  2DLK A;  2ELZ A;  3ADG A;  3DJW A;  3VK6 A;  2EP3 A;  3EPL A;  1X5W A;  3HQ1 A;  1IQO A;  2HC5 A;  4O5G A;  4BCA A;  2EMH A;  1WXR A;  3JU0 A;  2EM0 A;  2PRT A;  1X47 A;  1HR0 E;  5IXM B;  4ZYE A;  4BC9 A;  2IHR 1;  2YU5 A;  2RPC A;  1RQ0 A;  2ODR D;  2YPN A;  1HNZ E;  4R2D A;  4RHB B;  2EPX A;  2V87 A;  4LF9 E;  2L3J A;  4JV5 E;  4BMJ A;  3ZOQ B;  2JYA A;  1J5E E;  4ZYH A;  4WPY A;  4DUY E;  4K0K E;  2JOB A;  1DGC A;  4HEI A;  4F9A B;  2E1M A;  2LO3 A;  5KL3 A;  2L3C A;  4DKK A;  2EN4 A;  4KHP E;  5AC5 A;  2L33 A;  2ADR A;  1A1F A;  4L5N C;  1EKZ A;  1WHQ A;  4M30 A;  4DV5 E;  4X66 E;  3JTZ A;  5AE3 A;  2YRK A;  1PKP A;  4X64 E;  1PJS A;  2EOO A;  3THN A;  2YTQ A;  2YTN A;  3ADL A;  1BBG A;  4JI7 E;  2LT7 A;  4IS1 C;  2LUP B;  5AC4 A;  3BGH A;  1QU6 A;  4M9V C;  4Q28 A;  2V89 A;  4F6N A;  5A6K A;  2EPU A;  2EM8 A;  1O0W A;  2LVH A;  2GPI A;  1YUJ A;  3THO B;  2EMA A;  2WCC 3;  2EMZ A;  2UXD E;  3C6M A;  2YTD A;  2EPO A;  1XNR E;  2I13 A;  2N3H A;  2YRH A;  1YSA C;  4R2A A;  2R1F A;  2BBG A;  1X49 A;  3F6H A;  2YTE A;  2GHF A;  3VYY A;  2KON A;  5A6A A;  2EMW A;  2YTI A;  2B7T A;  3EPJ A;  2ELY A;  2EPC A;  4JI6 E;  1A1H A;  5T6J A;  4LTY A;  1RMD A;  4OOG C;  2EMY A;  3C4T A;  1WJP A;  2EOJ A;  4DV7 E;  3HTX A;  2DRP A;  2E5L E;  1X6F A;  4R2P A;  4WSG A;  1FKA E;  4DV1 E;  4BHC A;  3MSW A;  1X6E A;  4LFC E;  2Q8U A;  2EMK A;  2RS6 A;  3IWC A;  5A6B D;  4DV2 E;  4X8W A;  4B3M E;  4KWY A;  5IV8 B;  1YYW A;  2LRS A;  1YFH A;  1ZU1 A;  4BHB A;  5AE1 A;  4F9B B;  2VQE E;  1Z1B A;  1G2D C;  4DR6 E;  5KL4 A;  1IBK E;  4O24 A;  2V88 A;  2YTJ A;  3EQ1 A;  4R8O A;  4R2Q A;  2LTR A;  3JAM C;  4WXC A;  5ADZ A;  1BBO A;  2V83 A;  4O43 A;  4LFB E;  2HGH A;  2FTX B;  2JY9 A;  5KL2 A;  4MLV A;  2EM4 A;  3BID A;  1NEI A;  3KZY A;  4I8O A;  2UXB E;  5KL5 A;  2EWL A;  4BC7 A;  2EM3 A;  2GLI A;  3C4B A;  4YHH E;  1A1K A;  2KOU A;  2RQL A;  5LL6 R;  2B9D A;  2EPN A;  2EMC A;  4MLQ A;  1N34 E;  1UN6 B;  1HNW E;  2LCE A;  2V86 A;  2JXP A;  1N32 E;  4M2Z A;  1KJK A;  5A6B A;  2MKD A;  2EOR A;  2EOM A;  2MC6 A;  5LLQ A;  1B69 A;  1QNT A;  2UUB E;  4AQY E;  2EN2 A;  1EH8 A;  3MHH C;  1WRJ A;  2UUA E;  1PDA A;  4DR1 E;  4BS9 A;  1YYO A;  2EN8 A;  4DV6 E;  2M9A A;  1XMO E;  2RSM A;  4F2J C;  2EM6 A;  4GZN C;  4B3R E;  2EM2 A;  1GTK A;  4DR5 E;  4WXD A;  2EOH A;  3VHT B;  4Q35 B;  2YRM A;  4LF4 E;  2EML A;  2RTX A;  4JI2 E;  2A25 A;  3HXL A;  2EQ0 A;  4R2R A;  2I9I A;  2YTO A;  2EOS A;  3P1X A;  4TUI A;  5A69 A;  2DLQ A;  2YTG A;  2EQ3 A;  2CTD A;  2YT4 A;  3C6K A;  1KYQ A;  2DSY A;  2EPM X;  2EOQ A;  2UU9 E;  1X3C A;  2JR1 A;  3BBG A;  2ENH A;  2ENA A;  2L92 A;  2EPL X;  4R2C A;  2EE8 A;  2CPN A;  3IWD A;  5F3W A;  1N36 E;  2R76 A;  1ZR9 A;  2EOE A;  1IMU A;  2DB2 A;  2EL4 A;  1N33 E;  1BB8 A;  5TSE A;  2EPR A;  4JI4 E;  2JOX A;  4R03 A;  2DIX A;  4P7D A;  2JVA A;  5AE2 A;  4JI8 E;  2LV2 A;  1IQS A;  4N4R B;  3OTO E;  4JI1 E;  1UHZ A;  3HPS A;  4NHR A;  1TN9 A;  4DUZ E;  2EN6 A;  4DMI A;  4DV0 E;  1N3G A;  4F6M A;  2F4V E;  4P78 A;  2D9H A;  4TUG A;  4O4K A;  2LBS B;  1RC7 A;  2VF1 A;  4X62 E;  2NUF A;  3LML A;  3J7A G;  2YSO A;  2LUQ A;  3RMP A;  1IBL E;  2EPZ A;  2MC5 A;  3QG5 C;  1TF3 A;  4DV4 E;  5A6J A;  1T4L B;  2EOI A;  4F9C B;  1HNX E;  2EJ4 A;  1P47 A;  2DMY A;  2CSH A;  2EN7 A;  2NUG A;  1JK1 A;  2EMX A;  1PJQ A;  4B3T E;  3AV0 A;  2VQF E;  1GQE A;  1LLM C;  1A1L A;  4X65 E;  1G2F C;  2FGG A;  2HHH E;  2ODR C;  2LJU A;  2UXC E;  3EPK A;  4JYA E;  3T1Y E;  2NUE A;  4BBY A;  3T1H E;  4R2S A;  2BB8 A;  2EOZ A;  1MGT A;  3ECR A;  5IWA E;  4L8N A;  4ZYD A;  3J80 C;  1SFE A;  2YZT A;  2E72 A;  4R2E A;  2KHX A;  2EN1 A;  4J8Z A;  3ADI A;  4DR3 E;  1IBM E;  4KZS A;  4YY3 E;  5KL6 A;  2JPA A;  2DMI A;  3OML A;  1A1G A;  1ZBT A;  2EM5 A;  2B3T B;  1NCS A;  3H09 A;  2JWO A;  2EOY A;  3J81 C;  3L00 A;  4GKJ E;  2EM7 A;  3LLH A;  1YYK A;  2NAB A;  2G7H A;  5DNY A;  3ADJ A;  4LU9 A;  1SR9 A;  3HPZ A;  2EOF A;  3F6G A;  2WZO A;  1T4N A;  2M4I A;  1PJT A;  5FLX C;  4DR4 E;  3UK3 C;  1XMQ E;  1ZBQ A;  2MDR A;  1ZAA C;  2EMB A;  5A2Q C;  2RS7 A;  2VE7 C;  4NZV A;  1UIL A;  2V85 A;  2YTP A;  1T38 A;  4HTG A;  2YSP A;  1EH6 A;  2N8X A;  4NXM E;  2UUC E;  3K6Q A;  2EMI A;  4RH8 A;  2VRD A;  2EZ6 A;  1A1I A;  3M99 B;  2EM9 A;  3AUZ A;  2EL6 A;  1YZ9 A;  3KZZ A;  5AAS A;  4LF8 E;  3TQM A;  4B3S E;  2EPP A;  3VYX A;  4JI5 E;  2LTS A;  2MDG A;  2M7Q A;  4WYQ B;  4ZYG A;  1WHN A;  4LFA E;  4LF6 E;  1EH7 A;  2WBS A;  4NXN E;  1YPN A;  2WBT A;  2F8B A;  3MHS C;  4DR2 E;  2EMF A;  3KWR A;  1X48 A;  2YWQ A;  5LMU E;  1FJG E;  4JI3 E; 
#chains in the Genus database with same CATH homology
 1A1F A;  4X9J A;  2ADR A;  2GLI A;  1JK1 A;  2EMX A;  1JK2 A;  1A1K A;  2YRK A;  1G2F C;  1A1L A;  1LLM C;  2RSI A;  2EOO A;  2DGC A;  2EM3 A;  2YTQ A;  2CT1 A;  2EMC A;  2YTN A;  1UN6 B;  2YTF A;  2LCE A;  2LT7 A;  4IS1 C;  3EPK A;  1YUI A;  1KJK A;  2MKD A;  5KL7 A;  2EQ1 A;  2EOM A;  2EOR A;  4M9V C;  2EN3 A;  4R2S A;  2BB8 A;  1B69 A;  3EPH A;  4F6N A;  2J7J A;  2EPU A;  2EN2 A;  2EOZ A;  3MHH C;  2EM8 A;  2LVH A;  1YUJ A;  2EN8 A;  2EMG A;  2EMA A;  2M9A A;  2WCC 3;  4F2J C;  2EMZ A;  2EM6 A;  2E72 A;  2YTD A;  4R2E A;  4GZN C;  1AAY A;  2EM2 A;  2EN1 A;  2MKN A;  2I13 A;  2EOH A;  5KL6 A;  2JPA A;  2DMI A;  2YRH A;  1YSA C;  1A1G A;  3VHT B;  4R2A A;  2EM5 A;  2R1F A;  2YRM A;  1NCS A;  2EML A;  2YTE A;  2GHF A;  2A25 A;  2EOY A;  1UBD C;  2EQ0 A;  4R2R A;  2EMW A;  2YTI A;  3EPJ A;  2ELY A;  2EM7 A;  2EPC A;  2EOS A;  2YTO A;  2EL5 A;  2NAB A;  2WBU A;  4IJD A;  1A1J A;  1MEY C;  1A1H A;  2EOX A;  1RMD A;  2DLQ A;  2YTG A;  1F2I G;  1TF6 A;  2EMY A;  2EQ3 A;  2CTD A;  1X6H A;  2EOF A;  1WJP A;  2EOQ A;  2JP9 A;  2EOJ A;  2DRP A;  1X3C A;  2YU8 A;  3UK3 C;  2ENC A;  1X6F A;  2ENH A;  4R2P A;  1ZAA C;  2ENA A;  2EMB A;  4WSG A;  4R2C A;  4FK5 C;  2EE8 A;  2EPA A;  2DLK A;  1X6E A;  2YTP A;  2ELZ A;  1ZR9 A;  2EMK A;  2EOE A;  2YSP A;  2EP3 A;  3EPL A;  1X5W A;  2EMI A;  2VRD A;  2EMH A;  2EL4 A;  1ZU1 A;  1BB8 A;  2EPR A;  2EM0 A;  2PRT A;  1A1I A;  1Z1B A;  3M99 B;  1G2D C;  2EM9 A;  5KL4 A;  2EL6 A;  2YU5 A;  2RPC A;  2LV2 A;  2YTJ A;  4R2Q A;  2EPP A;  4R2D A;  2EPX A;  2MDG A;  1TN9 A;  2EN6 A;  4F6M A;  1BBO A;  2WBS A;  2D9H A;  2HGH A;  2WBT A;  3MHS C;  1DGC A;  2EMF A;  2YSO A;  5KL2 A;  2EPZ A;  2EM4 A;  2LO3 A;  1TF3 A;  5KL3 A;  2EOI A;  5KL5 A;  2EN4 A;  2EJ4 A;  1P47 A;  2CSH A;  2EN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...